CA2161796A1 - Hookworm anticoagulant - Google Patents
Hookworm anticoagulantInfo
- Publication number
- CA2161796A1 CA2161796A1 CA002161796A CA2161796A CA2161796A1 CA 2161796 A1 CA2161796 A1 CA 2161796A1 CA 002161796 A CA002161796 A CA 002161796A CA 2161796 A CA2161796 A CA 2161796A CA 2161796 A1 CA2161796 A1 CA 2161796A1
- Authority
- CA
- Canada
- Prior art keywords
- protein
- cys
- lys
- glu
- purified
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/81—Protease inhibitors
- C07K14/8107—Endopeptidase (E.C. 3.4.21-99) inhibitors
- C07K14/811—Serine protease (E.C. 3.4.21) inhibitors
- C07K14/8114—Kunitz type inhibitors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P33/00—Antiparasitic agents
- A61P33/10—Anthelmintics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/02—Antithrombotic agents; Anticoagulants; Platelet aggregation inhibitors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Abstract
A soluble anticoagulant protein isolated and purified from Ancylostoma hookworms markedly prolongs both the prothrombin time and partial thromboplastin time in clotting assays. The protein exhibits amino acid sequence homology to the Kunitz-type serine protease inhibitor family. Chromogenic peptide substrate and clotting time assays indicate that the protein inhibits extrinsic pathway clotting factor VIIa, the enzyme responsible for initiating the human coagulation cascade, and factor Xa in the common pathway of the coagulation cascade.
Description
~ W094/25000 2 1 6 1 7 q 6 PCT~S94/04707 HOOKWORM ANTICOAGULANT
DESCRIPTION
Technical Field of the Invention This invention relates to an anticoagulant isolated from hookworms.
Background of the Invention Hookworms are intestinal nematodes that infect over 1 billion persons worldwide, with a higher prevalence in children than in adults (briefly reviewed in Cecil 's Textbook of Medicine, l9th ed., W.B. Saunders Co., 1992, page 2010). These individuals suffer from intestinal hemorrhage as a direct consequence of blood loss caused by the adult hookworms attached to the mucosa. Hookworm disease is most common in tropical and less developed countries, where environmental and socioeconomic condi-tions including warm, moist soil, lack of public sewage disposal systems and the habit of walking barefoot espe-cially favor transmission. Although other routes of infection are known, such as lactogenic transfer of lar-vae to infants and use of soiled bedding and clothing (Hotez, P.J., Pediatr. Infect. Dis. ~. , 8: 516-520 (1989)), infection often occurs when exposed skin main-tains contact for several minutes with soil contaminated with parasite eggs containing viable larvae. These pene-trate the skin and journey to the lungs to develop into adults that eventually make their way to the upper small intestine, where they attach to the mucosa.
W094/25000 2 1 6 1 7 9 6 PCT~S94/04707 ~
DESCRIPTION
Technical Field of the Invention This invention relates to an anticoagulant isolated from hookworms.
Background of the Invention Hookworms are intestinal nematodes that infect over 1 billion persons worldwide, with a higher prevalence in children than in adults (briefly reviewed in Cecil 's Textbook of Medicine, l9th ed., W.B. Saunders Co., 1992, page 2010). These individuals suffer from intestinal hemorrhage as a direct consequence of blood loss caused by the adult hookworms attached to the mucosa. Hookworm disease is most common in tropical and less developed countries, where environmental and socioeconomic condi-tions including warm, moist soil, lack of public sewage disposal systems and the habit of walking barefoot espe-cially favor transmission. Although other routes of infection are known, such as lactogenic transfer of lar-vae to infants and use of soiled bedding and clothing (Hotez, P.J., Pediatr. Infect. Dis. ~. , 8: 516-520 (1989)), infection often occurs when exposed skin main-tains contact for several minutes with soil contaminated with parasite eggs containing viable larvae. These pene-trate the skin and journey to the lungs to develop into adults that eventually make their way to the upper small intestine, where they attach to the mucosa.
W094/25000 2 1 6 1 7 9 6 PCT~S94/04707 ~
- 2 -Hookworm disease is due primarly to gastrointestinal blood loss and att~ nt iron deficiency anemia. Adult worms attached to the mucosa digest ingested blood as well as cause focal bleeding. Each hookworm can suck as much as 0.2 ml of blood per day (Spellman, G.G., and Nossel, H.L., Amer. J. Phys. 220: 922-927 (1971)). This dramatic blood loss can reduce peripheral hemoglobin concentrations to as low as 3 g/lO0 ml. More commonly, however, blood loss is insidious, and results in chronic iron-deficiency anemia. Thus, in its human host, the adult hookworm functions as a conduit that empties blood into the intestinal tract, producing blood loss on a global scale equivalent to the exsanguination of 1.5 million people per day (Hotez, cited above). Nutritional deficiencies secondary to coexisting conditions that result in low iron stores contribute to morbidity.
The remarkable ability of a single small parasite to cause so much blood loss raises the question of an effec-tive anticoagulating m~.h~n; sm. Loss of blood from the gastrointestinal tract would be facilitated if the abili-ty of blood to clot were impaired in persons infected with this parasite. Early in this century, researchers observed that extracts of the dog hookworm contained a substance that delayed coagulation of human blood (Loeb, L., and Fleisher, M.S., J. Infect. Dis. 7: 625-631 (1910)). Some fifty years later, it was subsequently noted that hookworm protein, when added to m~mm~l ian plasma, markedly prolongs both the prothrombin and par-tial thromboplastin times (Spellman and Nossel, cited above, and Carroll, S.M., et al., Thromb. Haemostas. 51:
222-227 (1984)).
Although some of this effect has been attributed to a fibrinogenolytic and fibrinolytic protease that de-grades fibrinogen (Hotez, P.J., et al., J. Biol. Chem.
260: 7343-7348 (1985)), the exact location in the clot-WO9J/~0~0 2 1 6 1 7 ~ 6 PCT~59~/04707 ting cascade at which the predom;n~nt anticoagulant ef-fect is exerted has not been determined. One investiga-tor reported that extracts of hookworm cephalic glands, while significantly prolonging the prothrombin time, had no appreciable effect on the Stypven-activated factor X
clotting time; the anticoagulant was characterized as a protein with a molecular weight between 20,000 and 50,000 daltons (Eiff, J.A., J. Parasitol . 52: 833-843 (1966) ) .
Other investigators, on the other hand, demonstrated that lo extracts of the whole worms did, in fact, prolong the Stypven time, arguing in favor of the presence of an inhibitor of factor Xa (Spellman and Nossel, cited above).
Blood coagulation, initiated by substances in in-jured tissues, is propagated by an interlocking networkof enzymatic activation, propagation, and control events, the 80- called coagulation cascade. These complex reac-tions ensure that blood coagulation happens quickly and yet rP~;n~ localized. Blood coagulation results in the formation of a protein scaffolding, the fibrin clot, that controls bleeding and serves as a nidus for subse~uent cellular ingrowth and tissue repair. After several days, the fibrin clot is lysed and replaced with a more perma-nent scaffolding of connective tissue matrix molecules.
Abnormalities that result in delay of clot formation or premature lysis of clots are associated with a bleeding tendency.
Coagulation and fibrinolysis involve many blood plasma proteins (see, for example, Table 155-1 in Cecil, cited above, page 1000), with the list growing longer as blood coagulation mech~n; ms are studied in greater de-tail. Structural and functional similarities can be employed to group the proteins. For example, one group are zymogens of serine proteases, and hence members of the serine protease family of proteins which includes W094/25000 2 1 6 1 7 ~ 6 PCT~S94/04707 ~
trypsin, chymotrypsin, elastase, plasmin and cathepsin G.
In the coagulation cascade, Factors II, ~II, IX, X, XI, XII and protein C are in the serine protease family.
These zre modified by a vitamin K-dependent posttransla-tional carboxylation of glutamic acid residues, whichallows the proteins to bind calcium and phospholipids and thereby participate efficiently in blood coagulation.
Tissue plasminogen activator in the coagulation cascade is also a serine protease. Other proteins are serine ~rotease inhibitors and hence members of the "serpin"
family of proteins, which includes antithrombin III, heparin cofactor II, and plasminogen activator.
Blood coagulation can be initiated by exposure of blood to tissue factor, the so-called "extrinsic system", or by activation of contact factors of plasma, the so-called "intrinsic system". Both of these initiation pathways lead to a common pathway, which results in the elaboration of thrombin, the master coagulation enzyme.
Two major coagulation tests mentioned above differentiate these pathways. In the prothrombin time (herein denoted PT) test, tissue factor is added to plasma so that acti-vation proceeds by the extrinsic pathway. In the partial thromoplastin time therein denoted PTT) test, blood plas-ma is activated by the intrinsic pathway. The pathways are related somewhat because deficiencies of Factor IX, an intrinsic factor, as well as the factors that follow Factor IX in the intrinsic and common pathways and Factor VII, an extrinsic factor that activates IX and X, are all associated with a bleeding tendency. In contrast, defi-ciency of Factor XII and prekallikrein, which activatesXII, does not cause a bleeding problem.
SummarY of the Invention It is an object of the invention to provide a new anticoagulant.
W094/2~000 2 1 6 1 7 9 6 PCT~S94/04707 It is a further and more specific object of the invention to provide an anticoagulant that can be used as a therapeutic agent for the treatment of numerous vascu-lar disorders, as well as for the development for vac-cines for hookworm infection and strategies for lesseningthe se~uelae of chronic infection.
These and other objects are accomplished by the pre-sent invention which provides a soluble protein anticoag-ulant isolated and purified from Ancylostoma, particular-ly Ancylostoma CAnim~ hookworms. In clotting assays,the protein prolongs the prothrombin time and partial thromboplastin time. It inhibits clotting factors VIIa, the enzyme responsible for initiating the human clotting cascade, and Xa, thus exhibiting common pathway inhibito-ry activity as well. The protein does not inhibit throm-bin or clotting factors II and V.
The protein has an apparent molecular weight of about 16,500 daltons. It contains the amino acid se-quences Tyr-Gly-Pro-Cys-Lys and Tyr-Pro-Glu-Cys-Gly-Glu-Asn-Cys-Gly-Leu, thus exhibiting sequence homology with polypeptides belonging to the Kunitz-type family of ser-ine protease inhibitors.
The invention also provides DNA encoding the hook-worm anticoagulant, biologically functional circular plasmid or viral DNA vectors comprising the DNA, and procaryotic or eucaryotic host cells such as E. coli.
transformed or transfected with the vectors in a manner allowing the host cell to express the protein.
Description of the Figures Figure 1 shows selective inhibition by hookworm ex-tract of the chromogenic hydrolysis of substrate (40 ~g Chromozym X) by O.Ol units of puri~ied factor Xa (open 2 ~
W094/25000 PCT~S94/04707 bars). Equal amounts of hookworm protein do not inhibit the activity of purified thrombin versus its substrate (Chromozym TH, hatched bars).
Figure 2 shows partial purification of hookworm in-hibitor by Q Sepharose column chromatography. Hookwormextract from 100 adult worms was added to a 1.7 x 9 cm Q
Sepharose column using gravity flow. A major protein peak (denoted -) was eluted from the column with a 2.0 M
NaCl gradient. Individual column fractions (approximate-ly 1 ml) were collected and assayed for factor Xa inhibi-tory activity by chromogenic assay (denoted ---).
Figure 3 shows the effect of Q Sepharose column fractions on prothrombin (open circles) and partial thromboplastin times (closed circles; control clotting times: PT = 1.0 seconds, PTT = 28.3 seconds). The peak of anticoagulant activity, i.e., prolongation of PT/PTT, corresponds to the peak of inhibition observed with the chromogenic assay of factor Xa activity.
Figure 4 shows the effect of purified hookworm anti-coagulant on factors VIIa (open bars) and Xa (hatchedbars) using an in vitro chromogenic assay analogous to that described for Figure 1 above.
Detailed DescriPtion of the Invention This invention is based upon the finding that a low molecular weight protein isolated and purified from hook-worms binds to and inhibits both extrinsic factor VIIa, the enzyme responsible for initiation of the human coagu-lation cascade, and factor Xa in the common pathway.
By "hookworm" is meant any nematode that sucks blood from the small intestine including, but not limited to, the major hookworms that infect humans, Ancylostoma duo-~ wo 94nsooo 2 1 6 ~ 7 ~ 6 rcT~sg41ono7 denale, Nec2tor americanus, and, less commonly, A. cey-lonicum, a~ well as hookworms that infect other animals such as Ancylostoma c~n i n77~ Bunostomum phlebotomum, Agriostomum vryburgi, B. trigonocephalum, and Gaigeria pachyscelis. Other blood-sucking nematodes such as Hae-monchus species, e.g., H. contortus, are also encompassed by this invention. Ancylostoma caninum is preferred in one embodiment.
In the practice of this invention, a soluble protein anticoagulant is isolated and purified from hookworms.
By "purified" is meant essentially homogenous, yielding one polypeptide band on electrophoresis in a system that separates proteins; purified anticoagulant is thus sub-stantially free of other hookworm constituents, including associated proteins. Generally, the preparation is car-ried out by homogenizing or lysing the nematodes to ob-tain soluble extracts, and purifying the protein from the extracts. Any type of protein purification scheme famil-iar to the skilled artesan can be employed, such as, for example, affinity, ion-exchange, exclusion, partition, liquid and/or gas-liquid chromatography; zone, paper, thin layer, cellulose acetate membrane, agar gel, starch gel, and/or acrylamide gel electrophoresis; immunochemi-cal methods; combinations of these with each other and with other separation techniques such as dialysis; and the like.
In one embodiment, protein is obtained by separating proteins in a hookworm extract using a Sepharose ion ex-change column, followed by purification on an affinity column consisting of purified human factor Xa bound to agrose resin and gel filtration through a Sepharose gel column. Experimental details are given hereinafter.
Hookworm anticoagulant protein so obtained prolongs the prothrombin time and partial thromboplastin time in W094/2~000 ~ ~ t ~ ~ ~ PCT~S94/04707 clotting assays, as well as the factor X (Stypven) clot-ting time. It inhibits extrinsic factor VIIa, the enzyme responsible for initiating the human coagulation cascade.
In addition, it is also capable of binding to factor Xa in the common pathway of the coagulation cascade. As such, it bears a striking similarity to the r~mr~l ian Extrinsic Pathway Inhibitor (EPI), a major endogenous anticoagulant produced by human tissues to regulate the coagulation cascade. Hookworm anticoagulant does not inhibit the hydrolytic activity of purified thrombin and does not inhibit clotting factors II and V.
The hookworm anticoagulant of this invention exhib-its a molecular weight of about 16,500 daltons. It con-tains the amino acid sequences Tyr-Gly-Pro-Cys-Lys and Tyr-Pro-Glu-Cys-Gly-Glu-Asn-Cys-Gly-Leu, thus exhibiting sequence homology with polypeptides belonging to the pancreatic trypsin or Kunitz-type family of serine prote-ase inhibitors (named after the first inhibitor to be isolated in crystalline form, the first for which typical 1:1 enzyme-inhibitor stoichiometry was deterr;~, the first for which reversibility was demonstrated, the first to be sequenced, and the first to have the three-dimen-sional structure determined; reviewed by Laskowski, M., and Kato, I., Ann. Rev. Biochem. 49: 593-626 (1980)).
Members of this polypeptide family have been found in many species including other mammals, snails, and sea anemones, as well as in soybeans and snake venoms. The gene coding for Kunitz type inhibitors is thus very old and very widely distributed.
Also encompassed by this invention are synthetic hookworm anticoagulants exhibiting activity and structure similar to the isolated and purified protein. Since the protein is small, it can be prepared from its constituent amino acids by sequential formation of peptide bonds using any chemical means. Alternately, the amino acid 21 6 1 7~6 W094/25000 PCT~S94/04707 _ g _ sequence can be used to prepare cloned complementary DNA
se~le~ces defining the hookworm anticoagulant of this invention, which can then be used to transform or trans-fect a host cell for protein expression using standard means. Also encompassed by this invention are DNA se-quences homologous or closely related to complementary DNA described herein, namely DNA sequences which hybrid-ize, particularly under stringent conditions, to hookworm anticoagulant cDNA, and RNA corresponding thereto. In addition to the anticoagulant-encoding sequences, DNA
encompassed by this invention may contain additional sequences, depending upon vector construction sequences, that facilitate expression of the gene.
Because of the degeneracy of the genetic code, a variety of codon change combinations can be selected to form DNA that encodes the anticoagulant protein of this invention, so that any nucleotide deletion(s), addi-tion(s), or point mutation(s) that result in a DNA encod-ing the protein are Pnco~assed by this invention. Since certain codons are more efficient for polypeptide expres-sion in certain types of organisms, the selection of gene alterations to yield DNA material that codes for the protein of this invention are preferably those that yield the most efficient expression in the type of organism which is to serve as the host of the recombinant vector.
Altered codon selection may also depend upon vector con-struction considerations.
DNA starting material which is employed to form DNA
coding for the hookworm anticoagulant of the invention may be natural, recombinant or synthetic. Thus, DNA
starting material isolated from tissue or tissue culture, constructed from oligonucleotides using conventional methods, obtained commercially, or prepared by isolating RNA coding for anticoagulant protein, and using this RNA
to synthesize single-stranded cDNA which is used as a W094/25000 ~ PCT~S94/04707 ~
template to synthesize the corresponding double stranded DNA can be employed to prepare DNA encoding the anticoag-ulant of this invention.
DNA e~co~;ng the protein of this invention, or RNA
corresponding thereto, are then inserted into a vector, e.g., a pBR, pUC, pUB or pET series plasmid, and the recombinant vector used to transform a microbial host organisms. Host organisms useful in the invention are bacterial (e.g., E. coli or B. subtil is), yeast (e.g., S.
cervisiae) or m~m~lian (e.g., mouse fibroblast). This invention thus also provides novel, biologically func-'ional viral and circular plasmid RNA and DNA vectors incorporating RNA and DNA sequences describing the hook-worm anticoagulant generated by st~n~rd means. Culture of host org~ c stably transformed or transfected with such vectors under conditions facilitative of large scale expression of the exogenous, vector-borne DNA or RNA
sequences and isolation of the desired polypeptides from the growth medium, cellular lysates, or cellular membrane fractions yields the desired products.
The present invention thus provides for the total and/or partial manufacture of DNA sequences coding for hookworm anticoagulants, and including such advantageous characteristics as incorporation of codons preferred for expression by selected non-mammalian hosts, provision of sites of cleavage by restriction by endonuclease enzymes, and provision of additional initial, terminal or interme-diate DNA sequences which facilitate construction of readily expressed vectors. Correspondingly, the present invention provides for manufacture (and development by site specific mutagenesis of cDNA and genomic DNA) of DNA
sequences coding for microbial expression of anticoagu-lant analogues which differ from the forms specifically described herein in terms of identity or location of one or more amino acid residues (i.e., deletion analogues ~ W094/25000 PCT~S94/04707 cont~;n;ng less than all of the residues specified for anticoagulant, and/or substitution analogues wherein one or more residues are added to a terminal or medial por-tion of the polypeptide), and which share the biological properties of hookworm anticoagulant described herein.
DNA (and RNA) sequences of this invention code for all sequences useful in securing expression in procary-otic or eucaryotic host cells of polypeptide products having at least a part of the primary structural confor-mation, and one or more of the biological properties ofhookworm anticoagulant which are comprehended by: (a) the DNA sequences encoding anticoagulant protein as de-scribed herein, or complementary strands; (b~ DNA se-quences which hybridize (under hybridization conditions) to DNA sequences defined in (a) or fragments thereof;
and (c) DNA sequences which, but for the degeneracy of the genetic code, would hybridize to the DNA sequences defined in (a) and (b) above. Specifically comprehended are genomic DNA sequences encoding allelic variant forms of anticoagulants included therein, and sequences encod-ing RNA, fragments thereof, and analogues wherein RNA or DNA sequences may incorporate codons facilitating tran-scription or RNA replication of messenger RNA in non-ver-tebrate hosts.
Isolation and purification of microbially expressed proteins provided by the invention are by conventional means including, for example, preparative chromatographic separations such as that illustrated in the Examples, and immunological separations, including monoclonal and/or polyclonal antibody preparations.
The hookworm anticoagulant protein of this invention exhibits a number of desirable characteristics. Unlike other anticoagulants derived from blood feeding parasites such as the tick Ornithodoros moubata tWaxman, L., et W094/2~000 2 1 6 1 ~ ~ 6 PCT~S94/04707 ~
al., Science 248: 593-596 (1990)), the blackfly Simulium vittatum (Jacobs, J.W., et al., Thromb. Haemost. 61: 235-238 (1989)), and two species of leeches, Haementeria officinalis (Nutt, E., et al., J. Biol. Chem. 263:
10162-10167 (1988)) and Haementeria ghilianii (Condra, C., Thromb. Haemost. 61: 437-441 (1989)), most of which are capable of inhibiting components of the common path-way (factor Xa and thrombin), hookworm anticoagulant binds to and inhibits the activity of clotting factor VIIa, the enzyme responsible for initiating the human coagulation cascade. Moreover, the protein of this in-vention is small, soluble and potent. Thus it has utili-ty as a therapeutic agent for the treatment of numerous vascular disorders including peripheral vascular disease, stroke, coronary heart disease, hypercoagulable states, and other clotting disorders.
As the major morbidity associated with hookworm infection is a reflection of the gastrointestinal blood loss caused by the adult worm, interventions aimed at inhibiting the anticlotting merhA~;c~c of these intesti-nal helminths may significantly lessen the sequelae of chronic infection. The isolation and purification of hookworm anticoagulant thus also provides a means to develop hookworm alternative therapies to prevent blood loss during infection. The isolation and purification of hookworm anticoagulant also provides a polypeptide marker for diagnostic purposes.
In addition, enhancement of an immune response aimed at the hookworm anticoagulant represents a viable strate-gy for vaccine development focused on reducing the burdenof hookworm infection in populations at risk. Hookworm infection is one of the most clinically important soil-transmitted helminthiases, and third world children suf-fer most from this usually insidious hemorrhage (Hotez, W094/25000 2 1 6 1 7 9 6 PCT~S94/04707 cited above). AS an antigen, the protein of this inven-tion offers potential for vaccination.
-The following examples are presented to furtherillustrate and explain the present invention and should not be taken as limiting in any regard.
Examles Adult hookworms of the genus Ancylostoma c~n i n~m were obtained from the intestines of an infected dog as described by Schad, G.A., Exp. Parasitol. 47: 246-253 lo (1979). Briefly stated, infected dogs were sacrificed when they exhibited peak parasite populations (determined by counting the number of hookworm eggs per gram of fe-ces, about 22 to 31 days post-infection). The isolated worms were stored frozen at -70-C. Crude hookworm ex-lS tracts were prepared by suspen~n~ ~100 adult worms at atime in 1 mL of 0.05 M Tris-HCl buffer, pH 7.5 (hereinaf-ter referred to as "buffer"), and grinding in a glass homogenizer for 10 minutes on ice. This suspension was then centrifuged at 8000 g for 2 minutes, and the super-natant was collected. The protein content of the ex-tracts was then determined using Bradford's method, which involves the binding of Coomassie blue to proteins, re-sulting in a shift in absorption maximum of the dye (Bradford, M.M., Anal. Biochem. 72: 248-254 (1976)).
Extracts were frozen at -20-C.
A chromogenic assay employing commercially purified human coagulation factor Xa and chromogenic substrate (Chromozym X, N-methoxycarbonyl-Nle-Gly-Arg-4-nitrani-lide-acetate) purchased from Boehringer-Mannheim (India-napolis) was employed to characterize the hookworm pro-tein extracts and identify proteins subsequently purified from it. Ten ~1 of Factor Xa (0.01 units) were incubated with 20 ~1 of hookworm extracts, protein or buffer A
W094l2s000 PCT~S94/04707 (0.05 M Tris-~Cl, pH 8.2, 0.1% bovine serum albumin) for 10 minutes at 20C. Nine hundred ~1 of buffer A was added, followed by 20 ~1 (40 ~g) of Chromozym X. The mixture was allowed to react for 6 hours and optical density was then measured at 405 nm. Negative controls lacking purified factor Xa showed minimal hydrolysis under the same conditions.
Identical conditions were used for measuring the effect of hookworm protein on the chromogenic hydrolysis of 40 ~g of substrate (Chromozym~ TH: Tosyl-Gly-Pro-Arg-4-nitranilide-acetate) by commercially purified human thrombin (0.02 units), both purchased from Boehringer-Mannheim.
Factor X clotting time was determined by adding 50 ~L pooled h~ plasma to S0 ~L of hookworm extracts or protein in 150 ~L buffer. To lO0 ~L of this was added 150 ~L bovine factor X-deficient plasma (Sigma, St. Lou-is), lO0 ~L of Stypven~ (Sigma, 1:10 dilution), cephalin tsigma), and CaCl2 (0.035 M) as described by Bachm~nn (Bachmann, F., et al., Thromb. Diathesls H~em. 2: 24-38 (1958)). Time to clot was measured and c~p~red to both standard curve and controls using buffer in the absence of hookworm protein.
As depicted in Figure 1, factor Xa activity was re~llcP~ by 50% in the presence of 40 ~g of crude soluble hookworm protein. Using the factor X clotting time bio-assay, factor X clotting time was increased by 71% rela-tive to control plasma alone in the presence of 500 ~g of crude hookworm extracts.
Prothrombin time (PT) and partial thromboplastin time (PTT) were determined by adding hookworm extracts or protein to 400 ~L of pooled hllm~n plasma at 20C and then measuring PT and PTT using Dade Thromboplastin C Plus$
W094/25000 2 1 6 1 7 9 6 PCT~S94/04707 Dade Actin FSL~ (Baxter Healthcare, Miami), respectively, in a MLA 1000 automatic clotting time recorder (Medical Laboratory Automation, Mount Vernon, NY). Results were expressed as percentage increase in clotting times com-pared to controls in which buffer was substituted forhookworm protein. Using these procedures, A~;ng 0.6 mg of crude soluble hookworm protein to 0.4 ml of human plasma, PT was prolonged by 125% (from 9.9 seconds to 22.3 seconds), and the PTT was prolonged by 57% (from 29.2 seconds to 45.9 seconds).
The supernatant cont~;n;ng soluble hookworm protein was applied to a 2.7 x 9 cm Q-Sepharose ion exchange column (Sigma, fast flow, wet bead size 45 to 165 ~) equilibrated in buffer cont~;n;ng l.O mM ortho-phenan-throline, l.O mM dithiothreitol, 0.1 mg/ml 13,000 to23,000 molecular weight polyvinyl alcohol, and 0.1% poly-oxyethylene 23 lauryl ether (30% wt/vol). Bound protein was eluted with a 0 to 2.0 M NaCl gradient, and those fractions in the elution (Figure 2) which were capable of inhibiting factor Xa in a chromogenic assay described above were pooled and frozen.
The column fractions that exhibited the most signif-icant factor Xa inhibitory activity in vitro also pro-longed the factor X clotting time by 33%. Fractions were also assayed for their ability to prolong the PT and PTT.
As shown in Figure 3, the column fractions that contained the factor Xa inhibitory activity were identical to the column fractions that prolonged both the PT and PTT. No other column fractions inhibited the activity of purified factor Xa or caused prolonged of the PT/PTT.
Specific inhibition of factor Xa hydrolytic activity was enriched fivefold after Q-Sepharose, from 7.75 inhib-itory units (IU)/mg of protein to 42 IU/mg of protein.
one IU was defined as the amount of hookworm protein that W094/25000 ~ t ~ PCT~S94/04707 would cause a 1% reduction in the rate of chromogenic substrate hydrolysis by purified factor Xa, compared to controls. Pooled fractions obtained from the Q-Sepharose column that inhibit factor Xa were dialized against buff-er containing 0.1 M NaC1 and applied to an affinity col-umn consisting of purified human factor Xa bound to aga-rose resin. The protein that bound to this Factor Xa was eluted with 0.17 M acetic acid. Those fractions which were eluted from the column and contained factor Xa in-hibitory activity were pooled, and the buffer changed tobuffer containing 0.1 M NaCl using a Centricon~ 3 micro-concentrator (Amicon).
The pooled fractions were applied to a Superose~ 12 (Pharmacia) gel filtration column (24 ml) using fast pressure liquid chromatography. The fractions cont~; n; ng factor Xa inhibitory activity, which exhibited over a lO0-fold increase over the original extract, were pooled and lyophilized. At this point, the protein was visual-ized as a single band on SDS-polyacrylamide gel electro-phoresis under denaturing and non-denaturing conditions.
Alternatively, purification was achieved using a Q-Sepharose~ ion exchange column, gel filtration as des-cribed above, and reverse phase high-performance liquid chromatography using a Vydac~ C18 column. The apparent molecular weight of the purified anticoagulant protein is approximately 16,500 daltons.
Purified anticoagulant was shown to inhibit the activity of clotting factor VIIa (Figure 4) using a pro-cedure analogous to the one described for the assay of clotting factor Xa above, except that factor VIIa was used instead. Using the chromogenic assay described above, the protein does not appear capable of inhibiting the hydrolytic activity of purified thrombin, another serine protease in the common pathway of the coagulation ~ W094/25000 2 1 6 1 7 9 6 PCT~S94/04707 cascade. Likewise, the soluble protein had no effect on factors II and V (in clotting time assays similar to the prothrombin, partial thromboplastin time assays described above).
In similar tests, trypsin, chymotrypsin, kallikrein, plasmin, protein C, tissue plasminogen activator, uroki-nase, and factor XIIa were not inhibited in the presence of 6.25 nM of the purified anticoagulant.
Preliminary amino acid sequence data identified two peptide fragments, Tyr-Gly-Pro-Cys-Lys (SEQ ID NO 6) and Tyr-Pro-Glu-Cys-Gly-Glu-Asn-Cys-Gly-Leu (SEQ ID NO 7), that are set out in Table I (as item 6). Abbreviations for the amino acid residues are: A, Ala; C, Cys; D, Asp;
E, Glu; F, Phe; G, Gly; H, His; I, Ile; K, Lys; L, Leu;
M, Met; N, Asn; P, Pro; Q, Gln; R, Arg; S, Ser; T, Thr;
V, Val, W, Trp; and Y, Tyr. (Full amino acid se~lenc~c using the U.S. Patent Office format are set forth herein-after in the Sequence ~isting section of this applica-tion.) 1. RPDFCLEPPYTGPCKARIIRYFYNAKAGLCQTPVYGGCRAKRNNEKSAENCMRTCGGA
2. AAKycKLpvRyGpcKKKIpsFyyKwKAKQcLpFDysGcGGNANR~K~ cRRTcvG
The remarkable ability of a single small parasite to cause so much blood loss raises the question of an effec-tive anticoagulating m~.h~n; sm. Loss of blood from the gastrointestinal tract would be facilitated if the abili-ty of blood to clot were impaired in persons infected with this parasite. Early in this century, researchers observed that extracts of the dog hookworm contained a substance that delayed coagulation of human blood (Loeb, L., and Fleisher, M.S., J. Infect. Dis. 7: 625-631 (1910)). Some fifty years later, it was subsequently noted that hookworm protein, when added to m~mm~l ian plasma, markedly prolongs both the prothrombin and par-tial thromboplastin times (Spellman and Nossel, cited above, and Carroll, S.M., et al., Thromb. Haemostas. 51:
222-227 (1984)).
Although some of this effect has been attributed to a fibrinogenolytic and fibrinolytic protease that de-grades fibrinogen (Hotez, P.J., et al., J. Biol. Chem.
260: 7343-7348 (1985)), the exact location in the clot-WO9J/~0~0 2 1 6 1 7 ~ 6 PCT~59~/04707 ting cascade at which the predom;n~nt anticoagulant ef-fect is exerted has not been determined. One investiga-tor reported that extracts of hookworm cephalic glands, while significantly prolonging the prothrombin time, had no appreciable effect on the Stypven-activated factor X
clotting time; the anticoagulant was characterized as a protein with a molecular weight between 20,000 and 50,000 daltons (Eiff, J.A., J. Parasitol . 52: 833-843 (1966) ) .
Other investigators, on the other hand, demonstrated that lo extracts of the whole worms did, in fact, prolong the Stypven time, arguing in favor of the presence of an inhibitor of factor Xa (Spellman and Nossel, cited above).
Blood coagulation, initiated by substances in in-jured tissues, is propagated by an interlocking networkof enzymatic activation, propagation, and control events, the 80- called coagulation cascade. These complex reac-tions ensure that blood coagulation happens quickly and yet rP~;n~ localized. Blood coagulation results in the formation of a protein scaffolding, the fibrin clot, that controls bleeding and serves as a nidus for subse~uent cellular ingrowth and tissue repair. After several days, the fibrin clot is lysed and replaced with a more perma-nent scaffolding of connective tissue matrix molecules.
Abnormalities that result in delay of clot formation or premature lysis of clots are associated with a bleeding tendency.
Coagulation and fibrinolysis involve many blood plasma proteins (see, for example, Table 155-1 in Cecil, cited above, page 1000), with the list growing longer as blood coagulation mech~n; ms are studied in greater de-tail. Structural and functional similarities can be employed to group the proteins. For example, one group are zymogens of serine proteases, and hence members of the serine protease family of proteins which includes W094/25000 2 1 6 1 7 ~ 6 PCT~S94/04707 ~
trypsin, chymotrypsin, elastase, plasmin and cathepsin G.
In the coagulation cascade, Factors II, ~II, IX, X, XI, XII and protein C are in the serine protease family.
These zre modified by a vitamin K-dependent posttransla-tional carboxylation of glutamic acid residues, whichallows the proteins to bind calcium and phospholipids and thereby participate efficiently in blood coagulation.
Tissue plasminogen activator in the coagulation cascade is also a serine protease. Other proteins are serine ~rotease inhibitors and hence members of the "serpin"
family of proteins, which includes antithrombin III, heparin cofactor II, and plasminogen activator.
Blood coagulation can be initiated by exposure of blood to tissue factor, the so-called "extrinsic system", or by activation of contact factors of plasma, the so-called "intrinsic system". Both of these initiation pathways lead to a common pathway, which results in the elaboration of thrombin, the master coagulation enzyme.
Two major coagulation tests mentioned above differentiate these pathways. In the prothrombin time (herein denoted PT) test, tissue factor is added to plasma so that acti-vation proceeds by the extrinsic pathway. In the partial thromoplastin time therein denoted PTT) test, blood plas-ma is activated by the intrinsic pathway. The pathways are related somewhat because deficiencies of Factor IX, an intrinsic factor, as well as the factors that follow Factor IX in the intrinsic and common pathways and Factor VII, an extrinsic factor that activates IX and X, are all associated with a bleeding tendency. In contrast, defi-ciency of Factor XII and prekallikrein, which activatesXII, does not cause a bleeding problem.
SummarY of the Invention It is an object of the invention to provide a new anticoagulant.
W094/2~000 2 1 6 1 7 9 6 PCT~S94/04707 It is a further and more specific object of the invention to provide an anticoagulant that can be used as a therapeutic agent for the treatment of numerous vascu-lar disorders, as well as for the development for vac-cines for hookworm infection and strategies for lesseningthe se~uelae of chronic infection.
These and other objects are accomplished by the pre-sent invention which provides a soluble protein anticoag-ulant isolated and purified from Ancylostoma, particular-ly Ancylostoma CAnim~ hookworms. In clotting assays,the protein prolongs the prothrombin time and partial thromboplastin time. It inhibits clotting factors VIIa, the enzyme responsible for initiating the human clotting cascade, and Xa, thus exhibiting common pathway inhibito-ry activity as well. The protein does not inhibit throm-bin or clotting factors II and V.
The protein has an apparent molecular weight of about 16,500 daltons. It contains the amino acid se-quences Tyr-Gly-Pro-Cys-Lys and Tyr-Pro-Glu-Cys-Gly-Glu-Asn-Cys-Gly-Leu, thus exhibiting sequence homology with polypeptides belonging to the Kunitz-type family of ser-ine protease inhibitors.
The invention also provides DNA encoding the hook-worm anticoagulant, biologically functional circular plasmid or viral DNA vectors comprising the DNA, and procaryotic or eucaryotic host cells such as E. coli.
transformed or transfected with the vectors in a manner allowing the host cell to express the protein.
Description of the Figures Figure 1 shows selective inhibition by hookworm ex-tract of the chromogenic hydrolysis of substrate (40 ~g Chromozym X) by O.Ol units of puri~ied factor Xa (open 2 ~
W094/25000 PCT~S94/04707 bars). Equal amounts of hookworm protein do not inhibit the activity of purified thrombin versus its substrate (Chromozym TH, hatched bars).
Figure 2 shows partial purification of hookworm in-hibitor by Q Sepharose column chromatography. Hookwormextract from 100 adult worms was added to a 1.7 x 9 cm Q
Sepharose column using gravity flow. A major protein peak (denoted -) was eluted from the column with a 2.0 M
NaCl gradient. Individual column fractions (approximate-ly 1 ml) were collected and assayed for factor Xa inhibi-tory activity by chromogenic assay (denoted ---).
Figure 3 shows the effect of Q Sepharose column fractions on prothrombin (open circles) and partial thromboplastin times (closed circles; control clotting times: PT = 1.0 seconds, PTT = 28.3 seconds). The peak of anticoagulant activity, i.e., prolongation of PT/PTT, corresponds to the peak of inhibition observed with the chromogenic assay of factor Xa activity.
Figure 4 shows the effect of purified hookworm anti-coagulant on factors VIIa (open bars) and Xa (hatchedbars) using an in vitro chromogenic assay analogous to that described for Figure 1 above.
Detailed DescriPtion of the Invention This invention is based upon the finding that a low molecular weight protein isolated and purified from hook-worms binds to and inhibits both extrinsic factor VIIa, the enzyme responsible for initiation of the human coagu-lation cascade, and factor Xa in the common pathway.
By "hookworm" is meant any nematode that sucks blood from the small intestine including, but not limited to, the major hookworms that infect humans, Ancylostoma duo-~ wo 94nsooo 2 1 6 ~ 7 ~ 6 rcT~sg41ono7 denale, Nec2tor americanus, and, less commonly, A. cey-lonicum, a~ well as hookworms that infect other animals such as Ancylostoma c~n i n77~ Bunostomum phlebotomum, Agriostomum vryburgi, B. trigonocephalum, and Gaigeria pachyscelis. Other blood-sucking nematodes such as Hae-monchus species, e.g., H. contortus, are also encompassed by this invention. Ancylostoma caninum is preferred in one embodiment.
In the practice of this invention, a soluble protein anticoagulant is isolated and purified from hookworms.
By "purified" is meant essentially homogenous, yielding one polypeptide band on electrophoresis in a system that separates proteins; purified anticoagulant is thus sub-stantially free of other hookworm constituents, including associated proteins. Generally, the preparation is car-ried out by homogenizing or lysing the nematodes to ob-tain soluble extracts, and purifying the protein from the extracts. Any type of protein purification scheme famil-iar to the skilled artesan can be employed, such as, for example, affinity, ion-exchange, exclusion, partition, liquid and/or gas-liquid chromatography; zone, paper, thin layer, cellulose acetate membrane, agar gel, starch gel, and/or acrylamide gel electrophoresis; immunochemi-cal methods; combinations of these with each other and with other separation techniques such as dialysis; and the like.
In one embodiment, protein is obtained by separating proteins in a hookworm extract using a Sepharose ion ex-change column, followed by purification on an affinity column consisting of purified human factor Xa bound to agrose resin and gel filtration through a Sepharose gel column. Experimental details are given hereinafter.
Hookworm anticoagulant protein so obtained prolongs the prothrombin time and partial thromboplastin time in W094/2~000 ~ ~ t ~ ~ ~ PCT~S94/04707 clotting assays, as well as the factor X (Stypven) clot-ting time. It inhibits extrinsic factor VIIa, the enzyme responsible for initiating the human coagulation cascade.
In addition, it is also capable of binding to factor Xa in the common pathway of the coagulation cascade. As such, it bears a striking similarity to the r~mr~l ian Extrinsic Pathway Inhibitor (EPI), a major endogenous anticoagulant produced by human tissues to regulate the coagulation cascade. Hookworm anticoagulant does not inhibit the hydrolytic activity of purified thrombin and does not inhibit clotting factors II and V.
The hookworm anticoagulant of this invention exhib-its a molecular weight of about 16,500 daltons. It con-tains the amino acid sequences Tyr-Gly-Pro-Cys-Lys and Tyr-Pro-Glu-Cys-Gly-Glu-Asn-Cys-Gly-Leu, thus exhibiting sequence homology with polypeptides belonging to the pancreatic trypsin or Kunitz-type family of serine prote-ase inhibitors (named after the first inhibitor to be isolated in crystalline form, the first for which typical 1:1 enzyme-inhibitor stoichiometry was deterr;~, the first for which reversibility was demonstrated, the first to be sequenced, and the first to have the three-dimen-sional structure determined; reviewed by Laskowski, M., and Kato, I., Ann. Rev. Biochem. 49: 593-626 (1980)).
Members of this polypeptide family have been found in many species including other mammals, snails, and sea anemones, as well as in soybeans and snake venoms. The gene coding for Kunitz type inhibitors is thus very old and very widely distributed.
Also encompassed by this invention are synthetic hookworm anticoagulants exhibiting activity and structure similar to the isolated and purified protein. Since the protein is small, it can be prepared from its constituent amino acids by sequential formation of peptide bonds using any chemical means. Alternately, the amino acid 21 6 1 7~6 W094/25000 PCT~S94/04707 _ g _ sequence can be used to prepare cloned complementary DNA
se~le~ces defining the hookworm anticoagulant of this invention, which can then be used to transform or trans-fect a host cell for protein expression using standard means. Also encompassed by this invention are DNA se-quences homologous or closely related to complementary DNA described herein, namely DNA sequences which hybrid-ize, particularly under stringent conditions, to hookworm anticoagulant cDNA, and RNA corresponding thereto. In addition to the anticoagulant-encoding sequences, DNA
encompassed by this invention may contain additional sequences, depending upon vector construction sequences, that facilitate expression of the gene.
Because of the degeneracy of the genetic code, a variety of codon change combinations can be selected to form DNA that encodes the anticoagulant protein of this invention, so that any nucleotide deletion(s), addi-tion(s), or point mutation(s) that result in a DNA encod-ing the protein are Pnco~assed by this invention. Since certain codons are more efficient for polypeptide expres-sion in certain types of organisms, the selection of gene alterations to yield DNA material that codes for the protein of this invention are preferably those that yield the most efficient expression in the type of organism which is to serve as the host of the recombinant vector.
Altered codon selection may also depend upon vector con-struction considerations.
DNA starting material which is employed to form DNA
coding for the hookworm anticoagulant of the invention may be natural, recombinant or synthetic. Thus, DNA
starting material isolated from tissue or tissue culture, constructed from oligonucleotides using conventional methods, obtained commercially, or prepared by isolating RNA coding for anticoagulant protein, and using this RNA
to synthesize single-stranded cDNA which is used as a W094/25000 ~ PCT~S94/04707 ~
template to synthesize the corresponding double stranded DNA can be employed to prepare DNA encoding the anticoag-ulant of this invention.
DNA e~co~;ng the protein of this invention, or RNA
corresponding thereto, are then inserted into a vector, e.g., a pBR, pUC, pUB or pET series plasmid, and the recombinant vector used to transform a microbial host organisms. Host organisms useful in the invention are bacterial (e.g., E. coli or B. subtil is), yeast (e.g., S.
cervisiae) or m~m~lian (e.g., mouse fibroblast). This invention thus also provides novel, biologically func-'ional viral and circular plasmid RNA and DNA vectors incorporating RNA and DNA sequences describing the hook-worm anticoagulant generated by st~n~rd means. Culture of host org~ c stably transformed or transfected with such vectors under conditions facilitative of large scale expression of the exogenous, vector-borne DNA or RNA
sequences and isolation of the desired polypeptides from the growth medium, cellular lysates, or cellular membrane fractions yields the desired products.
The present invention thus provides for the total and/or partial manufacture of DNA sequences coding for hookworm anticoagulants, and including such advantageous characteristics as incorporation of codons preferred for expression by selected non-mammalian hosts, provision of sites of cleavage by restriction by endonuclease enzymes, and provision of additional initial, terminal or interme-diate DNA sequences which facilitate construction of readily expressed vectors. Correspondingly, the present invention provides for manufacture (and development by site specific mutagenesis of cDNA and genomic DNA) of DNA
sequences coding for microbial expression of anticoagu-lant analogues which differ from the forms specifically described herein in terms of identity or location of one or more amino acid residues (i.e., deletion analogues ~ W094/25000 PCT~S94/04707 cont~;n;ng less than all of the residues specified for anticoagulant, and/or substitution analogues wherein one or more residues are added to a terminal or medial por-tion of the polypeptide), and which share the biological properties of hookworm anticoagulant described herein.
DNA (and RNA) sequences of this invention code for all sequences useful in securing expression in procary-otic or eucaryotic host cells of polypeptide products having at least a part of the primary structural confor-mation, and one or more of the biological properties ofhookworm anticoagulant which are comprehended by: (a) the DNA sequences encoding anticoagulant protein as de-scribed herein, or complementary strands; (b~ DNA se-quences which hybridize (under hybridization conditions) to DNA sequences defined in (a) or fragments thereof;
and (c) DNA sequences which, but for the degeneracy of the genetic code, would hybridize to the DNA sequences defined in (a) and (b) above. Specifically comprehended are genomic DNA sequences encoding allelic variant forms of anticoagulants included therein, and sequences encod-ing RNA, fragments thereof, and analogues wherein RNA or DNA sequences may incorporate codons facilitating tran-scription or RNA replication of messenger RNA in non-ver-tebrate hosts.
Isolation and purification of microbially expressed proteins provided by the invention are by conventional means including, for example, preparative chromatographic separations such as that illustrated in the Examples, and immunological separations, including monoclonal and/or polyclonal antibody preparations.
The hookworm anticoagulant protein of this invention exhibits a number of desirable characteristics. Unlike other anticoagulants derived from blood feeding parasites such as the tick Ornithodoros moubata tWaxman, L., et W094/2~000 2 1 6 1 ~ ~ 6 PCT~S94/04707 ~
al., Science 248: 593-596 (1990)), the blackfly Simulium vittatum (Jacobs, J.W., et al., Thromb. Haemost. 61: 235-238 (1989)), and two species of leeches, Haementeria officinalis (Nutt, E., et al., J. Biol. Chem. 263:
10162-10167 (1988)) and Haementeria ghilianii (Condra, C., Thromb. Haemost. 61: 437-441 (1989)), most of which are capable of inhibiting components of the common path-way (factor Xa and thrombin), hookworm anticoagulant binds to and inhibits the activity of clotting factor VIIa, the enzyme responsible for initiating the human coagulation cascade. Moreover, the protein of this in-vention is small, soluble and potent. Thus it has utili-ty as a therapeutic agent for the treatment of numerous vascular disorders including peripheral vascular disease, stroke, coronary heart disease, hypercoagulable states, and other clotting disorders.
As the major morbidity associated with hookworm infection is a reflection of the gastrointestinal blood loss caused by the adult worm, interventions aimed at inhibiting the anticlotting merhA~;c~c of these intesti-nal helminths may significantly lessen the sequelae of chronic infection. The isolation and purification of hookworm anticoagulant thus also provides a means to develop hookworm alternative therapies to prevent blood loss during infection. The isolation and purification of hookworm anticoagulant also provides a polypeptide marker for diagnostic purposes.
In addition, enhancement of an immune response aimed at the hookworm anticoagulant represents a viable strate-gy for vaccine development focused on reducing the burdenof hookworm infection in populations at risk. Hookworm infection is one of the most clinically important soil-transmitted helminthiases, and third world children suf-fer most from this usually insidious hemorrhage (Hotez, W094/25000 2 1 6 1 7 9 6 PCT~S94/04707 cited above). AS an antigen, the protein of this inven-tion offers potential for vaccination.
-The following examples are presented to furtherillustrate and explain the present invention and should not be taken as limiting in any regard.
Examles Adult hookworms of the genus Ancylostoma c~n i n~m were obtained from the intestines of an infected dog as described by Schad, G.A., Exp. Parasitol. 47: 246-253 lo (1979). Briefly stated, infected dogs were sacrificed when they exhibited peak parasite populations (determined by counting the number of hookworm eggs per gram of fe-ces, about 22 to 31 days post-infection). The isolated worms were stored frozen at -70-C. Crude hookworm ex-lS tracts were prepared by suspen~n~ ~100 adult worms at atime in 1 mL of 0.05 M Tris-HCl buffer, pH 7.5 (hereinaf-ter referred to as "buffer"), and grinding in a glass homogenizer for 10 minutes on ice. This suspension was then centrifuged at 8000 g for 2 minutes, and the super-natant was collected. The protein content of the ex-tracts was then determined using Bradford's method, which involves the binding of Coomassie blue to proteins, re-sulting in a shift in absorption maximum of the dye (Bradford, M.M., Anal. Biochem. 72: 248-254 (1976)).
Extracts were frozen at -20-C.
A chromogenic assay employing commercially purified human coagulation factor Xa and chromogenic substrate (Chromozym X, N-methoxycarbonyl-Nle-Gly-Arg-4-nitrani-lide-acetate) purchased from Boehringer-Mannheim (India-napolis) was employed to characterize the hookworm pro-tein extracts and identify proteins subsequently purified from it. Ten ~1 of Factor Xa (0.01 units) were incubated with 20 ~1 of hookworm extracts, protein or buffer A
W094l2s000 PCT~S94/04707 (0.05 M Tris-~Cl, pH 8.2, 0.1% bovine serum albumin) for 10 minutes at 20C. Nine hundred ~1 of buffer A was added, followed by 20 ~1 (40 ~g) of Chromozym X. The mixture was allowed to react for 6 hours and optical density was then measured at 405 nm. Negative controls lacking purified factor Xa showed minimal hydrolysis under the same conditions.
Identical conditions were used for measuring the effect of hookworm protein on the chromogenic hydrolysis of 40 ~g of substrate (Chromozym~ TH: Tosyl-Gly-Pro-Arg-4-nitranilide-acetate) by commercially purified human thrombin (0.02 units), both purchased from Boehringer-Mannheim.
Factor X clotting time was determined by adding 50 ~L pooled h~ plasma to S0 ~L of hookworm extracts or protein in 150 ~L buffer. To lO0 ~L of this was added 150 ~L bovine factor X-deficient plasma (Sigma, St. Lou-is), lO0 ~L of Stypven~ (Sigma, 1:10 dilution), cephalin tsigma), and CaCl2 (0.035 M) as described by Bachm~nn (Bachmann, F., et al., Thromb. Diathesls H~em. 2: 24-38 (1958)). Time to clot was measured and c~p~red to both standard curve and controls using buffer in the absence of hookworm protein.
As depicted in Figure 1, factor Xa activity was re~llcP~ by 50% in the presence of 40 ~g of crude soluble hookworm protein. Using the factor X clotting time bio-assay, factor X clotting time was increased by 71% rela-tive to control plasma alone in the presence of 500 ~g of crude hookworm extracts.
Prothrombin time (PT) and partial thromboplastin time (PTT) were determined by adding hookworm extracts or protein to 400 ~L of pooled hllm~n plasma at 20C and then measuring PT and PTT using Dade Thromboplastin C Plus$
W094/25000 2 1 6 1 7 9 6 PCT~S94/04707 Dade Actin FSL~ (Baxter Healthcare, Miami), respectively, in a MLA 1000 automatic clotting time recorder (Medical Laboratory Automation, Mount Vernon, NY). Results were expressed as percentage increase in clotting times com-pared to controls in which buffer was substituted forhookworm protein. Using these procedures, A~;ng 0.6 mg of crude soluble hookworm protein to 0.4 ml of human plasma, PT was prolonged by 125% (from 9.9 seconds to 22.3 seconds), and the PTT was prolonged by 57% (from 29.2 seconds to 45.9 seconds).
The supernatant cont~;n;ng soluble hookworm protein was applied to a 2.7 x 9 cm Q-Sepharose ion exchange column (Sigma, fast flow, wet bead size 45 to 165 ~) equilibrated in buffer cont~;n;ng l.O mM ortho-phenan-throline, l.O mM dithiothreitol, 0.1 mg/ml 13,000 to23,000 molecular weight polyvinyl alcohol, and 0.1% poly-oxyethylene 23 lauryl ether (30% wt/vol). Bound protein was eluted with a 0 to 2.0 M NaCl gradient, and those fractions in the elution (Figure 2) which were capable of inhibiting factor Xa in a chromogenic assay described above were pooled and frozen.
The column fractions that exhibited the most signif-icant factor Xa inhibitory activity in vitro also pro-longed the factor X clotting time by 33%. Fractions were also assayed for their ability to prolong the PT and PTT.
As shown in Figure 3, the column fractions that contained the factor Xa inhibitory activity were identical to the column fractions that prolonged both the PT and PTT. No other column fractions inhibited the activity of purified factor Xa or caused prolonged of the PT/PTT.
Specific inhibition of factor Xa hydrolytic activity was enriched fivefold after Q-Sepharose, from 7.75 inhib-itory units (IU)/mg of protein to 42 IU/mg of protein.
one IU was defined as the amount of hookworm protein that W094/25000 ~ t ~ PCT~S94/04707 would cause a 1% reduction in the rate of chromogenic substrate hydrolysis by purified factor Xa, compared to controls. Pooled fractions obtained from the Q-Sepharose column that inhibit factor Xa were dialized against buff-er containing 0.1 M NaC1 and applied to an affinity col-umn consisting of purified human factor Xa bound to aga-rose resin. The protein that bound to this Factor Xa was eluted with 0.17 M acetic acid. Those fractions which were eluted from the column and contained factor Xa in-hibitory activity were pooled, and the buffer changed tobuffer containing 0.1 M NaCl using a Centricon~ 3 micro-concentrator (Amicon).
The pooled fractions were applied to a Superose~ 12 (Pharmacia) gel filtration column (24 ml) using fast pressure liquid chromatography. The fractions cont~; n; ng factor Xa inhibitory activity, which exhibited over a lO0-fold increase over the original extract, were pooled and lyophilized. At this point, the protein was visual-ized as a single band on SDS-polyacrylamide gel electro-phoresis under denaturing and non-denaturing conditions.
Alternatively, purification was achieved using a Q-Sepharose~ ion exchange column, gel filtration as des-cribed above, and reverse phase high-performance liquid chromatography using a Vydac~ C18 column. The apparent molecular weight of the purified anticoagulant protein is approximately 16,500 daltons.
Purified anticoagulant was shown to inhibit the activity of clotting factor VIIa (Figure 4) using a pro-cedure analogous to the one described for the assay of clotting factor Xa above, except that factor VIIa was used instead. Using the chromogenic assay described above, the protein does not appear capable of inhibiting the hydrolytic activity of purified thrombin, another serine protease in the common pathway of the coagulation ~ W094/25000 2 1 6 1 7 9 6 PCT~S94/04707 cascade. Likewise, the soluble protein had no effect on factors II and V (in clotting time assays similar to the prothrombin, partial thromboplastin time assays described above).
In similar tests, trypsin, chymotrypsin, kallikrein, plasmin, protein C, tissue plasminogen activator, uroki-nase, and factor XIIa were not inhibited in the presence of 6.25 nM of the purified anticoagulant.
Preliminary amino acid sequence data identified two peptide fragments, Tyr-Gly-Pro-Cys-Lys (SEQ ID NO 6) and Tyr-Pro-Glu-Cys-Gly-Glu-Asn-Cys-Gly-Leu (SEQ ID NO 7), that are set out in Table I (as item 6). Abbreviations for the amino acid residues are: A, Ala; C, Cys; D, Asp;
E, Glu; F, Phe; G, Gly; H, His; I, Ile; K, Lys; L, Leu;
M, Met; N, Asn; P, Pro; Q, Gln; R, Arg; S, Ser; T, Thr;
V, Val, W, Trp; and Y, Tyr. (Full amino acid se~lenc~c using the U.S. Patent Office format are set forth herein-after in the Sequence ~isting section of this applica-tion.) 1. RPDFCLEPPYTGPCKARIIRYFYNAKAGLCQTPVYGGCRAKRNNEKSAENCMRTCGGA
2. AAKycKLpvRyGpcKKKIpsFyyKwKAKQcLpFDysGcGGNANR~K~ cRRTcvG
3. CAFKADDGPCKAIMKRFFFNIFTRQ~lYGGCEGNQNRFFSLEECKKMC
4. CFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNIC
5. CLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSK ECLRAC
6. YGPCK YPECGENCGL
1. pancreatic trypsin inhibitor 2. green mamba venom 3. tissue factor pathway inhibitor, tail I
4. tissue factor pathway inhibitor, tail II
5. tissue factor pathway inhibitor, tail III
6. hookworm anticoagulant W094/25000 2 1 6 1 7 9 6 PCT~S94/04707 ~
The hookworm protein sequences exhibit homologies to pancreatic trypsin inhibitor (item 1, SEQ ID NO 1), green mamba venom (item 2, SEQ ID NO 2) and tissue pathway inhibitor (items 3 to 5, SEQ ID NOs 3 to 5), suggesting that the purified protein is in the Kunitz-type serine protease inhibitor family with these polypeptides.
~ he sequence predicted from a 2.3 kilobase clone isolated from a cDNA library made with adult Ancylostoma caninum hookworms is set out in SEQ ID NO 8; a stop codon is denoted between the asterisks. It can be seen that the sequence has a number of tandomly arranged Kunitz domains.
Following a similar isolation procedure, an antico-agulant was isolated from Necator americanus hookworms.Extracts were prepared by suspending worms in 0.05 M
Tris-HCl buffer, pH 7.5, and grinding in a glass homoge-nizer on ice. The suspension was then centrifuged, and the supernatant, collected. A chromogenic assay employ-ing commercially purified human coagulation factor Xa andchromogenic substrate Chromozym~ X was employed to char-acterize the protein extracts and identify proteins sub-sequently purified from it. Factor Xa (~0.01 unit) was incubated with the extracts, and factor X clotting time was determined as set out above. Using this procedure, factor Xa activity was reduced 40% with the Necator iso-late.
The above description is for the purpose of teaching the person of ordinary skill in the art how to practice the present invention, and it is not intended to detail all those obvious modifications and variations of it which will become apparent to the skilled worker upon reading the description. It is intended, however, that all such obvious modifications and variations be included ~ W094/25000 PCT~S94/04707 within the scope of the present invention, which is de-fined by the claims that follow. The claims are meant to cover the claimed components and steps in any sequence which is effective to meet the objectives there intended, unless the context specifically indicates the contrary.
W094/25000 2 1 6 1 7 9 6 PCT~S94/04707 ~
SEQUENCE LISTING
t1) GENERAL INFORMATION
(i) APPLICANTS: Michael Capello Peter J. Hotez Frank F. Richards John M. Hawdon (ii) TITLE OF INVENTION: Hookworm Anticoagulant (iii) NUMBER OF SEQUENCES: 8 (iv) CORRESPONDENCE ADDRESS:
MacArthur Center for Molecular Parasitology Yale Parasitology and Tropical Medicine Center 700 Laboratory of Epidemiology and Public Health 60 College Street New Haven, CT 06510 (v) CO~ul~ RE~nART~ FORM
(A) MEDIUM TYPE: 5.25" 360 Kb diskette (B) COM~Ul~K: IBM PC
(C) OPERATING SYSTEM: MS DOS
(D) SOFTWARE: Word Processing (viii) ATTORNEY INFORMATION
(A) NAME: Mary M. Krinsky St. Onge Steward Johnston & Reens 986 Bedford Street Stamford, CT 06905 (B) REGISTRATION NUMBER: 32423 (C) DOCKET NUMBER: 1751-003 (ix) TELECOMMUNICATION INFORMATION
(A) TELEPHONE NUMBER: 203-324-6155 (B) TELEFAX NUMBER: 203-327-1096 ~16~796 W094t25000 PCT~S94/04707 (2) INFORMATION FOR SEQ ID NO: 1 (i) SEQUENCE CHARACTERISTICS
(A) LENGTH: 58 residues (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE
(A) DESCRIPTION: polypeptide (v) FRAGMENT TYPE: internal fragment (ix) FEATURE
(A) NAME: pancreatic trypsin inhibitor (x) PUBLICATION INFORMATION
(A) AUTHOR: Ponte, P., et al .
(B) TITLE (excerpt): mRNA contains domain homolo-gous to serine proteinase inhibitors (C) JOURNAL: Na ture (D) VOLUME: 331 (F) PAGES: 525-527, Figure 1 (G) DATE: 11 February 1988 (K) RELEVANT RESIDUES: segment corresponding to polypeptide residues 287 to 344 (xi) SEQUENCE DESCRIPTION: SEQ ID NO 1:
Arg Pro Asp Phe Cys Leu Glu Phe Phe Tyr Thr Gly Pro Cys Ly~
Ala Arg Ile Ile Arg Tyr Phe Tyr Asn Ala Lys Ala Gly Leu Cys Gln Thr Pro Val Tyr Gly Gly Cys Arg Ala Lys Arg Asn Asn Glu 216~796 WO94/2s000 PCT~S94/04707 Lys Ser Ala Glu Asn Cys Met Arg Thr Cys Gly Gly Ala (3) INFORMATION FOR SEQ ID NO: 2 (i) SEQUENCE CHARACTERISTICS
(A) LENGTH: 57 residues (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE
(A) DESCRIPTION: polypeptide (v) F~A~M~NT TYPE: amino terminus (ix) FEATURE
(A) NAME: green mamba venom serine protease in-hibitor, delta-Da-TX
(x) PUBLICATION INFORMATION
(A) AUTHOR: R~n; ~h;n, C.G.
(B) TITLE (excerpt): Four Polypeptide Components of Green Mamba Venom (C) JOURNAL: Molecular Pharmacology (D) VOLUME: 3 (F) PAGES: 152-159, Figure 8 (G) DATE: 1988 (K) RELEVANT RESIDUES: numbered relative to ~-DaTX
(xi) SEQUENCE DESCRIPTION: SEQ ID NO. 2:
Ala Ala Lys Tyr Cys Lys Leu Pro Val Arg Tyr Gly Pro Cys Lys .~ WO 94125000 2 ~ 6 ~ 7 9 6 PCT/US94/04707 Lys Lys Ile Pro Ser Phe Tyr Tyr Lys Trp Lys Ala Lys Gln Cys Leu Pro Phe Asp Tyr Ser Gly Cys Gly Gly Asn Ala Asn Arg Phe Lys Thr Ile Glu Glu Cys Arg Arg Thr Cys Val Gly (4) INFORMATION FOR SEQ ID NO: 3 (i) SEQUENCE CHARACTERISTICS
(A) LENGTH: 51 residues (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE
(A) DESCRIPTION: polypeptide (v) FRAGMENT TYPE: internal fragment (ix) FEATURE
(A) NAME: Tissue Factor Pathway Inhibitor, Tail I
(x) PUBLICATION INFORMATION
(A) AUTHOR: Rapaport, S.I.
(B) TITLE (excerpt): The Extrinsic Pathway Inhibi-tor (C) JOURNAL: Thrombosis and Haemostasis (D) VOLUME: 66 (E) ISSUE: 1 (F) PAGES: 6-15, Figure 5 (G) DATE: 1991 (K) RELEVA~T RESIDUES: segment corresponding to peptide residues 26 to 76 W094/2~000 2 1 6 1 7 9 6 PCT~S94/04707 ~
(xi) SEQUENCE DESCRIPTION: SEQ ID NO. 3:
ys Ala Phe Lys Ala Asp Asp Gly Pro Cys Lys Ala Ile Met Lys rg Phe Phe Phe Asn Ile Phe Thr Arg Gln Cys Glu Glu Phe Ile yr Gly Gly Cys Glu Gly Asn Gln Asn Arg Phe Phe Ser Leu Glu lu Cys Lys Lys Met Cys 5) INFORMATION FOR SEQ ID NO: 4 (i) SEQUENCE CHARACTERISTICS
(A) LENGTH: 51 residues (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE
(A) DESCRIPTION: polypeptide (v) FRAGMENT TYPE: internal frasment (ix) FEATURE
(A) NAME: Tissue Factor Pathway Inhibitor, Tail II
(x) PUBLICATION INFORMATION
(A) AUTHOR: Rapaport, S.I.
(B) TITLE (excerpt): The Extrinsic Pathway Inhibi-tor (C) JOURNAL: Throm~osis and Haemostasis (D) VOLUME: 66 (E) ISSUE: 1 (F) PAGES: 6-15, Figure 5 W094/2~000 2 1 6 1 7 9 6 PCT~S94104707 (G) DATE: 1991 (K) RELEVANT RESIDUES: segment corresponding to peptide residues 98 to 148 (Xi) SEQUENCE DESCRIPTION: SEQ ID NO 4:
Cys Phe Leu Glu Glu Asp Pro Gly Ile Cys Arg Gly Tyr Ile Thr lOO 105 110 Arg Tyr Phe Tyr Asn Asn Gln Thr Lys Gln Cys Glu Arg Phe Lys Tyr Gly Gly Cys Leu Gly Asn Met Asn Asn Phe Glu Thr Leu Glu Glu Cys Lys Asn Ile Cys (6) INFORMATION FOR SEQ ID NO: 5 (i) SEQUENCE CHARACTERISTICS
(A) LENGTH: 51 residues (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE
(A) DESCRIPTION: polypeptide (v) FRAGMENT TYPE: internal fragment (ix) FEATURE
(A) NAME: Tissue Factor Pathway Inhibitor, Tail III
(x) PUBLICATION INFORMATION
(A) AUTHOR: Rapaport, S.I.
(B) TITLE (excerpt): The Extrinsic Pathway Inhibi-tor W094/25000 2 1 6 1 7 q 6 PCT~S94/04707 ~
(C) JOURNAL: Thrombosis and Haemostasis (D) VOLUME: 66 (E) ISSUE: 1 (F) PAGES: 6-15, Figure 5 (G) DATE: 1991 (K) RELEVANT RESIDUES: segment corresponding to peptide residues 190 to 240 (xi) SEQUENCE DESCRIPTION: SEQ ID NO 5:
Cys Leu Thr Pro Ala Asp Arg Gly Leu Cys Arg Ala Asn Glu Asn Arg Phe Tyr Tyr Asn Ser Val Ile Gly Lys Cys Arg Pro Phe Lys Tyr Ser Gly Cys Gly Gly Asn Glu Asn Asn Phe Thr Ser Lys Gln Glu Cys Leu Arg Ala Cys
1. pancreatic trypsin inhibitor 2. green mamba venom 3. tissue factor pathway inhibitor, tail I
4. tissue factor pathway inhibitor, tail II
5. tissue factor pathway inhibitor, tail III
6. hookworm anticoagulant W094/25000 2 1 6 1 7 9 6 PCT~S94/04707 ~
The hookworm protein sequences exhibit homologies to pancreatic trypsin inhibitor (item 1, SEQ ID NO 1), green mamba venom (item 2, SEQ ID NO 2) and tissue pathway inhibitor (items 3 to 5, SEQ ID NOs 3 to 5), suggesting that the purified protein is in the Kunitz-type serine protease inhibitor family with these polypeptides.
~ he sequence predicted from a 2.3 kilobase clone isolated from a cDNA library made with adult Ancylostoma caninum hookworms is set out in SEQ ID NO 8; a stop codon is denoted between the asterisks. It can be seen that the sequence has a number of tandomly arranged Kunitz domains.
Following a similar isolation procedure, an antico-agulant was isolated from Necator americanus hookworms.Extracts were prepared by suspending worms in 0.05 M
Tris-HCl buffer, pH 7.5, and grinding in a glass homoge-nizer on ice. The suspension was then centrifuged, and the supernatant, collected. A chromogenic assay employ-ing commercially purified human coagulation factor Xa andchromogenic substrate Chromozym~ X was employed to char-acterize the protein extracts and identify proteins sub-sequently purified from it. Factor Xa (~0.01 unit) was incubated with the extracts, and factor X clotting time was determined as set out above. Using this procedure, factor Xa activity was reduced 40% with the Necator iso-late.
The above description is for the purpose of teaching the person of ordinary skill in the art how to practice the present invention, and it is not intended to detail all those obvious modifications and variations of it which will become apparent to the skilled worker upon reading the description. It is intended, however, that all such obvious modifications and variations be included ~ W094/25000 PCT~S94/04707 within the scope of the present invention, which is de-fined by the claims that follow. The claims are meant to cover the claimed components and steps in any sequence which is effective to meet the objectives there intended, unless the context specifically indicates the contrary.
W094/25000 2 1 6 1 7 9 6 PCT~S94/04707 ~
SEQUENCE LISTING
t1) GENERAL INFORMATION
(i) APPLICANTS: Michael Capello Peter J. Hotez Frank F. Richards John M. Hawdon (ii) TITLE OF INVENTION: Hookworm Anticoagulant (iii) NUMBER OF SEQUENCES: 8 (iv) CORRESPONDENCE ADDRESS:
MacArthur Center for Molecular Parasitology Yale Parasitology and Tropical Medicine Center 700 Laboratory of Epidemiology and Public Health 60 College Street New Haven, CT 06510 (v) CO~ul~ RE~nART~ FORM
(A) MEDIUM TYPE: 5.25" 360 Kb diskette (B) COM~Ul~K: IBM PC
(C) OPERATING SYSTEM: MS DOS
(D) SOFTWARE: Word Processing (viii) ATTORNEY INFORMATION
(A) NAME: Mary M. Krinsky St. Onge Steward Johnston & Reens 986 Bedford Street Stamford, CT 06905 (B) REGISTRATION NUMBER: 32423 (C) DOCKET NUMBER: 1751-003 (ix) TELECOMMUNICATION INFORMATION
(A) TELEPHONE NUMBER: 203-324-6155 (B) TELEFAX NUMBER: 203-327-1096 ~16~796 W094t25000 PCT~S94/04707 (2) INFORMATION FOR SEQ ID NO: 1 (i) SEQUENCE CHARACTERISTICS
(A) LENGTH: 58 residues (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE
(A) DESCRIPTION: polypeptide (v) FRAGMENT TYPE: internal fragment (ix) FEATURE
(A) NAME: pancreatic trypsin inhibitor (x) PUBLICATION INFORMATION
(A) AUTHOR: Ponte, P., et al .
(B) TITLE (excerpt): mRNA contains domain homolo-gous to serine proteinase inhibitors (C) JOURNAL: Na ture (D) VOLUME: 331 (F) PAGES: 525-527, Figure 1 (G) DATE: 11 February 1988 (K) RELEVANT RESIDUES: segment corresponding to polypeptide residues 287 to 344 (xi) SEQUENCE DESCRIPTION: SEQ ID NO 1:
Arg Pro Asp Phe Cys Leu Glu Phe Phe Tyr Thr Gly Pro Cys Ly~
Ala Arg Ile Ile Arg Tyr Phe Tyr Asn Ala Lys Ala Gly Leu Cys Gln Thr Pro Val Tyr Gly Gly Cys Arg Ala Lys Arg Asn Asn Glu 216~796 WO94/2s000 PCT~S94/04707 Lys Ser Ala Glu Asn Cys Met Arg Thr Cys Gly Gly Ala (3) INFORMATION FOR SEQ ID NO: 2 (i) SEQUENCE CHARACTERISTICS
(A) LENGTH: 57 residues (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE
(A) DESCRIPTION: polypeptide (v) F~A~M~NT TYPE: amino terminus (ix) FEATURE
(A) NAME: green mamba venom serine protease in-hibitor, delta-Da-TX
(x) PUBLICATION INFORMATION
(A) AUTHOR: R~n; ~h;n, C.G.
(B) TITLE (excerpt): Four Polypeptide Components of Green Mamba Venom (C) JOURNAL: Molecular Pharmacology (D) VOLUME: 3 (F) PAGES: 152-159, Figure 8 (G) DATE: 1988 (K) RELEVANT RESIDUES: numbered relative to ~-DaTX
(xi) SEQUENCE DESCRIPTION: SEQ ID NO. 2:
Ala Ala Lys Tyr Cys Lys Leu Pro Val Arg Tyr Gly Pro Cys Lys .~ WO 94125000 2 ~ 6 ~ 7 9 6 PCT/US94/04707 Lys Lys Ile Pro Ser Phe Tyr Tyr Lys Trp Lys Ala Lys Gln Cys Leu Pro Phe Asp Tyr Ser Gly Cys Gly Gly Asn Ala Asn Arg Phe Lys Thr Ile Glu Glu Cys Arg Arg Thr Cys Val Gly (4) INFORMATION FOR SEQ ID NO: 3 (i) SEQUENCE CHARACTERISTICS
(A) LENGTH: 51 residues (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE
(A) DESCRIPTION: polypeptide (v) FRAGMENT TYPE: internal fragment (ix) FEATURE
(A) NAME: Tissue Factor Pathway Inhibitor, Tail I
(x) PUBLICATION INFORMATION
(A) AUTHOR: Rapaport, S.I.
(B) TITLE (excerpt): The Extrinsic Pathway Inhibi-tor (C) JOURNAL: Thrombosis and Haemostasis (D) VOLUME: 66 (E) ISSUE: 1 (F) PAGES: 6-15, Figure 5 (G) DATE: 1991 (K) RELEVA~T RESIDUES: segment corresponding to peptide residues 26 to 76 W094/2~000 2 1 6 1 7 9 6 PCT~S94/04707 ~
(xi) SEQUENCE DESCRIPTION: SEQ ID NO. 3:
ys Ala Phe Lys Ala Asp Asp Gly Pro Cys Lys Ala Ile Met Lys rg Phe Phe Phe Asn Ile Phe Thr Arg Gln Cys Glu Glu Phe Ile yr Gly Gly Cys Glu Gly Asn Gln Asn Arg Phe Phe Ser Leu Glu lu Cys Lys Lys Met Cys 5) INFORMATION FOR SEQ ID NO: 4 (i) SEQUENCE CHARACTERISTICS
(A) LENGTH: 51 residues (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE
(A) DESCRIPTION: polypeptide (v) FRAGMENT TYPE: internal frasment (ix) FEATURE
(A) NAME: Tissue Factor Pathway Inhibitor, Tail II
(x) PUBLICATION INFORMATION
(A) AUTHOR: Rapaport, S.I.
(B) TITLE (excerpt): The Extrinsic Pathway Inhibi-tor (C) JOURNAL: Throm~osis and Haemostasis (D) VOLUME: 66 (E) ISSUE: 1 (F) PAGES: 6-15, Figure 5 W094/2~000 2 1 6 1 7 9 6 PCT~S94104707 (G) DATE: 1991 (K) RELEVANT RESIDUES: segment corresponding to peptide residues 98 to 148 (Xi) SEQUENCE DESCRIPTION: SEQ ID NO 4:
Cys Phe Leu Glu Glu Asp Pro Gly Ile Cys Arg Gly Tyr Ile Thr lOO 105 110 Arg Tyr Phe Tyr Asn Asn Gln Thr Lys Gln Cys Glu Arg Phe Lys Tyr Gly Gly Cys Leu Gly Asn Met Asn Asn Phe Glu Thr Leu Glu Glu Cys Lys Asn Ile Cys (6) INFORMATION FOR SEQ ID NO: 5 (i) SEQUENCE CHARACTERISTICS
(A) LENGTH: 51 residues (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE
(A) DESCRIPTION: polypeptide (v) FRAGMENT TYPE: internal fragment (ix) FEATURE
(A) NAME: Tissue Factor Pathway Inhibitor, Tail III
(x) PUBLICATION INFORMATION
(A) AUTHOR: Rapaport, S.I.
(B) TITLE (excerpt): The Extrinsic Pathway Inhibi-tor W094/25000 2 1 6 1 7 q 6 PCT~S94/04707 ~
(C) JOURNAL: Thrombosis and Haemostasis (D) VOLUME: 66 (E) ISSUE: 1 (F) PAGES: 6-15, Figure 5 (G) DATE: 1991 (K) RELEVANT RESIDUES: segment corresponding to peptide residues 190 to 240 (xi) SEQUENCE DESCRIPTION: SEQ ID NO 5:
Cys Leu Thr Pro Ala Asp Arg Gly Leu Cys Arg Ala Asn Glu Asn Arg Phe Tyr Tyr Asn Ser Val Ile Gly Lys Cys Arg Pro Phe Lys Tyr Ser Gly Cys Gly Gly Asn Glu Asn Asn Phe Thr Ser Lys Gln Glu Cys Leu Arg Ala Cys
(7) INFORMATION FOR SEQ ID NO: 6 (i) SEQUENCE CHARACTERISTICS
(A) LENGTH: 5 residues (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE
(A) DESCRIPTION: peptide (v) FRAGMENT TYPE: internal fragment (vi) ORIGINAL SOURCE
(A) ORGANISM: Ancylostoma c~n i n~7m (C) INDIVIDUAL ISOLATE: purified protein (D) DEVELOPMENTAL STAGE: adult hookworm (ix) FEATURES
(A) NAME: hookworm anticoagulant peptide (xi) SEQUENCE DESCRIPTION: SEQ ID NO 6:
Tyr Gly Pro Cys Lys W094/25000 2 1 6 1 7 9 6 PCT~S94/04707
(A) LENGTH: 5 residues (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE
(A) DESCRIPTION: peptide (v) FRAGMENT TYPE: internal fragment (vi) ORIGINAL SOURCE
(A) ORGANISM: Ancylostoma c~n i n~7m (C) INDIVIDUAL ISOLATE: purified protein (D) DEVELOPMENTAL STAGE: adult hookworm (ix) FEATURES
(A) NAME: hookworm anticoagulant peptide (xi) SEQUENCE DESCRIPTION: SEQ ID NO 6:
Tyr Gly Pro Cys Lys W094/25000 2 1 6 1 7 9 6 PCT~S94/04707
(8) INFORMATION FOR SEQ ID NO: 7 (i) SEQUENCE CHARACTERISTICS
(A) LENGTH: lO residues (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE
(A) DESCRIPTION: peptide (v) FRAGMENT TYPE: internal fragment (vi) ORIGINAL SOURCE
(A) ORGANISM: Ancylostoma CAn i nl7m (C) INDIVIDUAL ISOLATE: purified protein (D) DEVELOPMENTAL STAGE: adult hookworm (ix) FEATURES
(A) NAME: hookworm anticoagulant peptide (xi) SEQUENCE DESCRIPTION: SEQ ID NO: 7 Tyr Pro Glu Cys Gly Glu Asn Cys Gly Leu
(A) LENGTH: lO residues (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE
(A) DESCRIPTION: peptide (v) FRAGMENT TYPE: internal fragment (vi) ORIGINAL SOURCE
(A) ORGANISM: Ancylostoma CAn i nl7m (C) INDIVIDUAL ISOLATE: purified protein (D) DEVELOPMENTAL STAGE: adult hookworm (ix) FEATURES
(A) NAME: hookworm anticoagulant peptide (xi) SEQUENCE DESCRIPTION: SEQ ID NO: 7 Tyr Pro Glu Cys Gly Glu Asn Cys Gly Leu
(9) INFORMATION FOR SEQ ID NO: 8 (i) SEQUENCE CHARACTERISTICS
(A) LENGTH: 560 residues (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE
(A) DESCRIPTION: polypeptide (vi) ORIGINAL SOURCE
(A) ORGANISM: Ancylostoma ~Anin77m (vii) IMMEDIATE SOURCE
(A) LIBRARY: cDNA from adult Ancylostoma c~n i n77m (B) CLONE: 2.3 kb (isolated from the library) (xi) SEQUENCE DESCRIPTION: SEQ ID NO: 8 Thr Ser Leu Ala Leu Val Leu Leu Trp Ala Ala Thr Ala Thr Ala WO 94/25000 2 1 6 1 7 ~ 6 PCT/US94/04707 ~
Leu Leu Asp Ile Cys Lys Glu GlU Ile Lys Thr Gly Asn Cys Arg ly Ala Phe Arg Lys Phe Gly Tyr Asp Arg Cys Thr Asn Lys Cys le Pro Tyr Thr Tyr Gly Gly Cys Gly Gly Ser Ser Asn Met Phe ly Thr Leu Glu GlU Cys Gln Glu Lys Cys Gly Lys Pro Glu Asp rg Cys Ser Lys Pro Leu Glu Arg Gly Ile Cys Leu Ala Ser Met ys Arg Tyr Gly Tyr Asp Thr Ser Ser Lys Lys Cys Lys Ala Phe le Tyr Gly Gly Cys Gly Gly Asn Glu Asn Asn Phe Glu Thr Met la Glu Cys Arg Glu Thr Cys Lys Asp Thr Ser Ser Glu Glu Glu er Val Pro Asp Ala Cys Leu Leu Pro Ser Glu Val Gly Pro Cys ys Gly Lys Glu Arg Arg Phe Tyr Phe Asp Gln Lys Arg Gly Asn ys Lys Ser Phe Phe Phe Gly Gly Cys Gly Gly Asn Gly Asn Asn he Met Thr Lys Ala Lys Cys Met Glu Thr Cys Ser Lys His Ile ys Pro Glu Thr Glu Gln Asp Val Cys Ser Gln Pro Ile Lys Ala ly Pro Cys Met Ala Met Leu Lys Arg Tyr Ala Tyr Asp Asn Lys ys Lys Arg Cys Val Gln Phe Ile Tyr Gly Gly Cys Lys Gly Asn ys Asn Asn Phe Glu Ser Met Glu Glu Cys Thr Arg Thr Cys Lys ys Ala Val Pro Glu Pro Glu Gln Asp Thr Cys Ser Gln Pro Ile lu Val Gly Pro Cys Lys Ala Met Leu Lys Arg Tyr Ala Tyr Asp ~ WO 94/25000 2 t ~ ~ 7 9 6 PCT/US94/04707 Asn Lys Lys Asn Lys Cys Val Arg Phe Ile Tyr Gly Gly Cys Lys Gly Asn Lys Asn Asn Phe Glu Ser Met Glu Glu Cys Thr Tyr Thr Cys Lys Lys Ala Val Pro Glu Pro Glu Gln Asp Thr Cys Ser Gln Pro Ile Glu Val Gly Pro Cys Lys Ala Met Leu Lys Arg Tyr Ala Tyr Asp Asn Lys Lys Asn Lys Cys Val Arg Phe Ile Tyr Gly Gly Cys Lys Gly Asn Lys Asn Asn Phe Glu Ser Met Glu Glu Cys Thr Arg Thr Cys Lys Lys Ala Val Pro Glu Pro Glu Pro Glu Lys Glu Thr Cys Ser Gln Pro Ile Glu Val Gly Pro Cys Lys Ala Met Leu Lys Arg Tyr Ala Tyr Asp Asn Lys Lys Asn Lys Cys Val Arg Phe Ile Tyr Gly Gly Cys Lys Gly Asn Lys Asn Asn Phe G1U Ser Met Glu Glu Cys Thr Tyr Thr Cys Lys Lys Ala Val Pro Glu Pro Glu Gln Asp Thr Cys Ser Gln Pro Ile Glu Val Gly Pro Cys Lys Ala Met Leu Lys Arg Tyr Ala Tyr Asp Asn Lys Lys Asn Lys Cys Val Arg Phe Ile Tyr Gly Gly Cys Lys Gly Asn Lys Asn Asn Phe Glu Met His Gly Arg Val His Pro Asp Ile Ala Arg Lys Gln Tyr Gln Ser Leu Asn Leu Arg Lys Arg Pro Ala Leu Ser Pro Leu Lys Leu Val Leu Ala Arg Gln Trp*Asp Asp Leu Leu Thr Thr Thr Gln Arg Lys Ser Ala*Ser Ser Phe Thr Ala Asp Ala Lys Glu Thr Arg Thr Thr Ser Lys Pro Trp
(A) LENGTH: 560 residues (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE
(A) DESCRIPTION: polypeptide (vi) ORIGINAL SOURCE
(A) ORGANISM: Ancylostoma ~Anin77m (vii) IMMEDIATE SOURCE
(A) LIBRARY: cDNA from adult Ancylostoma c~n i n77m (B) CLONE: 2.3 kb (isolated from the library) (xi) SEQUENCE DESCRIPTION: SEQ ID NO: 8 Thr Ser Leu Ala Leu Val Leu Leu Trp Ala Ala Thr Ala Thr Ala WO 94/25000 2 1 6 1 7 ~ 6 PCT/US94/04707 ~
Leu Leu Asp Ile Cys Lys Glu GlU Ile Lys Thr Gly Asn Cys Arg ly Ala Phe Arg Lys Phe Gly Tyr Asp Arg Cys Thr Asn Lys Cys le Pro Tyr Thr Tyr Gly Gly Cys Gly Gly Ser Ser Asn Met Phe ly Thr Leu Glu GlU Cys Gln Glu Lys Cys Gly Lys Pro Glu Asp rg Cys Ser Lys Pro Leu Glu Arg Gly Ile Cys Leu Ala Ser Met ys Arg Tyr Gly Tyr Asp Thr Ser Ser Lys Lys Cys Lys Ala Phe le Tyr Gly Gly Cys Gly Gly Asn Glu Asn Asn Phe Glu Thr Met la Glu Cys Arg Glu Thr Cys Lys Asp Thr Ser Ser Glu Glu Glu er Val Pro Asp Ala Cys Leu Leu Pro Ser Glu Val Gly Pro Cys ys Gly Lys Glu Arg Arg Phe Tyr Phe Asp Gln Lys Arg Gly Asn ys Lys Ser Phe Phe Phe Gly Gly Cys Gly Gly Asn Gly Asn Asn he Met Thr Lys Ala Lys Cys Met Glu Thr Cys Ser Lys His Ile ys Pro Glu Thr Glu Gln Asp Val Cys Ser Gln Pro Ile Lys Ala ly Pro Cys Met Ala Met Leu Lys Arg Tyr Ala Tyr Asp Asn Lys ys Lys Arg Cys Val Gln Phe Ile Tyr Gly Gly Cys Lys Gly Asn ys Asn Asn Phe Glu Ser Met Glu Glu Cys Thr Arg Thr Cys Lys ys Ala Val Pro Glu Pro Glu Gln Asp Thr Cys Ser Gln Pro Ile lu Val Gly Pro Cys Lys Ala Met Leu Lys Arg Tyr Ala Tyr Asp ~ WO 94/25000 2 t ~ ~ 7 9 6 PCT/US94/04707 Asn Lys Lys Asn Lys Cys Val Arg Phe Ile Tyr Gly Gly Cys Lys Gly Asn Lys Asn Asn Phe Glu Ser Met Glu Glu Cys Thr Tyr Thr Cys Lys Lys Ala Val Pro Glu Pro Glu Gln Asp Thr Cys Ser Gln Pro Ile Glu Val Gly Pro Cys Lys Ala Met Leu Lys Arg Tyr Ala Tyr Asp Asn Lys Lys Asn Lys Cys Val Arg Phe Ile Tyr Gly Gly Cys Lys Gly Asn Lys Asn Asn Phe Glu Ser Met Glu Glu Cys Thr Arg Thr Cys Lys Lys Ala Val Pro Glu Pro Glu Pro Glu Lys Glu Thr Cys Ser Gln Pro Ile Glu Val Gly Pro Cys Lys Ala Met Leu Lys Arg Tyr Ala Tyr Asp Asn Lys Lys Asn Lys Cys Val Arg Phe Ile Tyr Gly Gly Cys Lys Gly Asn Lys Asn Asn Phe G1U Ser Met Glu Glu Cys Thr Tyr Thr Cys Lys Lys Ala Val Pro Glu Pro Glu Gln Asp Thr Cys Ser Gln Pro Ile Glu Val Gly Pro Cys Lys Ala Met Leu Lys Arg Tyr Ala Tyr Asp Asn Lys Lys Asn Lys Cys Val Arg Phe Ile Tyr Gly Gly Cys Lys Gly Asn Lys Asn Asn Phe Glu Met His Gly Arg Val His Pro Asp Ile Ala Arg Lys Gln Tyr Gln Ser Leu Asn Leu Arg Lys Arg Pro Ala Leu Ser Pro Leu Lys Leu Val Leu Ala Arg Gln Trp*Asp Asp Leu Leu Thr Thr Thr Gln Arg Lys Ser Ala*Ser Ser Phe Thr Ala Asp Ala Lys Glu Thr Arg Thr Thr Ser Lys Pro Trp
Claims (10)
1. An anticoagulant composition comprising a purified soluble protein isolated from hookworms selected from the group consisting of Ancylostoma duodenale, Ancylostoma celanicum, Necator americanus, and Ancylostoma caninum, wherein said protein prolongs the prothrombin time and partial thromboplastin time.
2. A composition according to claim 1 wherein said pro-tein inhibits clotting factor Xa.
3. An anticoagulant composition comprising a purified soluble protein isolated from hookworms, wherein said protein inhibits clotting factor Xa and does not inhibit thrombin or clotting factors II and V.
4. A composition according to claim 3 wherein said pro-tein is isolated and purified from hookworms selected from the group consisting of Ancylostoma duodenale, Ancy-lostoma ceylonicum, Nectator americanus, and Ancyclostoma caninum .
5. A composition according to claims 1, 2, 3, or 4, wherein said protein contains the amino acid sequence Tyr-Pro-Glu-Cys-Gly-Glu-Asn.
6. A composition according to claims 1, 2, or 4, wherein said protein does not inhibit thrombin or clotting fac-tors II and V.
7. A composition according to claims 1, 2, 3, or 4, wherein said protein is isolated and purified from Ancy-lostoma caninum hookworms.
8. A composition according to claims 1, 2, 3, or 4, wherein said protein is isolated and purified from Neca-tor americanus hookworms.
9. A purified and isolated DNA sequence comprising a DNA
sequence encoding the anticoagulant protein according to claims 1, 2, 3, or 4.
sequence encoding the anticoagulant protein according to claims 1, 2, 3, or 4.
10. A procaryotic or eucaryotic host cell transformed or transfected with a DNA sequence according to claim 9 in a manner allowing the host cell to express said protein.
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US08/055,988 US5427937A (en) | 1993-04-30 | 1993-04-30 | Hookworm anticoagulant |
US055,988 | 1993-04-30 | ||
PCT/US1994/004707 WO1994025000A1 (en) | 1993-04-30 | 1994-04-29 | Hookworm anticoagulant |
Publications (1)
Publication Number | Publication Date |
---|---|
CA2161796A1 true CA2161796A1 (en) | 1994-11-10 |
Family
ID=22001413
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CA002161796A Abandoned CA2161796A1 (en) | 1993-04-30 | 1994-04-29 | Hookworm anticoagulant |
Country Status (5)
Country | Link |
---|---|
US (1) | US5427937A (en) |
EP (1) | EP0697857A4 (en) |
JP (1) | JPH08510212A (en) |
CA (1) | CA2161796A1 (en) |
WO (1) | WO1994025000A1 (en) |
Families Citing this family (10)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5863894A (en) * | 1995-06-05 | 1999-01-26 | Corvas International, Inc. | Nematode-extracted anticoagulant protein |
US5866542A (en) * | 1994-10-18 | 1999-02-02 | Corvas International, Inc. | Nematode-extracted anticoagulant protein |
ATE346928T1 (en) * | 1994-10-18 | 2006-12-15 | Dendreon Corp | SERINE PROTEASE INHIBITORS AND COAGULATION-INHIBITING PROTEINS EXTRACTED FROM NEMATODES |
US5866543A (en) * | 1995-06-05 | 1999-02-02 | Corvas International, Inc. | Nematode-extracted anticoagulant protein |
US5945275A (en) * | 1994-10-18 | 1999-08-31 | Corvas International, Inc. | Nematode-extracted anticoagulant protein |
US5872098A (en) * | 1995-06-05 | 1999-02-16 | Corvas International, Inc. | Nematode-extracted anticoagulant protein |
CA2202351A1 (en) * | 1994-10-18 | 1996-04-25 | George Phillip Vlasuk | Nematode-extracted serine protease inhibitors and anticoagulant proteins |
CN101041690B (en) * | 2006-03-22 | 2010-10-06 | 北京大学 | Recombinant dog hookworm coagulate peptide resistant 5 mutant, its encoding gene, preparation and application thereof |
ES2374054B1 (en) * | 2010-07-03 | 2012-12-26 | Instituto De Salud Carlos Iii | NEW SERINA PROTEASA INHIBITOR AND ITS USE. |
KR101374194B1 (en) * | 2013-05-16 | 2014-03-13 | 대한민국 | Kunitz-type serine protease inhibitor peptide from fenneropenaeus chinensis |
Family Cites Families (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4788149A (en) * | 1983-04-29 | 1988-11-29 | The Rockefeller University | Proteolytic enzyme from blood-sucking nematodes and its uses as an anticoagulant as a vaccine and as an antithelminic agent |
-
1993
- 1993-04-30 US US08/055,988 patent/US5427937A/en not_active Expired - Lifetime
-
1994
- 1994-04-29 WO PCT/US1994/004707 patent/WO1994025000A1/en not_active Application Discontinuation
- 1994-04-29 EP EP94915940A patent/EP0697857A4/en not_active Withdrawn
- 1994-04-29 JP JP6524552A patent/JPH08510212A/en not_active Ceased
- 1994-04-29 CA CA002161796A patent/CA2161796A1/en not_active Abandoned
Also Published As
Publication number | Publication date |
---|---|
EP0697857A1 (en) | 1996-02-28 |
EP0697857A4 (en) | 1997-11-12 |
US5427937A (en) | 1995-06-27 |
JPH08510212A (en) | 1996-10-29 |
WO1994025000A1 (en) | 1994-11-10 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
Cappello et al. | Ancylostoma caninum anticoagulant peptide: a hookworm-derived inhibitor of human coagulation factor Xa. | |
US6090916A (en) | Nematode-extracted serine protease inhibitors and anticoagulant proteins | |
Tanaka et al. | A double headed serine proteinase inhibitor—human plasma kallikrein and elastase inhibitor—from Boophilus microplus larvae | |
Baskova et al. | Proteinase inhibitors from the medicinal leech Hirudo medicinalis | |
Assakura et al. | Hemorrhagic, fibrinogenolytic and edema-forming activities of the venom of the colubrid snake Philodryas olfersii (green snake) | |
Johansson et al. | Purification and cDNA cloning of a four‐domain Kazal proteinase inhibitor from crayfish blood cells | |
HU226419B1 (en) | Human bikunin | |
KR20130093508A (en) | Phospholipid-enriched vesicles bearing tissue factor having haemostatic activities and uses thereof | |
US5427937A (en) | Hookworm anticoagulant | |
Sasaki et al. | Boophilus microplus tick larvae, a rich source of Kunitz type serine proteinase inhibitors | |
CA2393529A1 (en) | Inhibitors of complement activation, their preparation and use | |
Rocha-Campos et al. | Specific heterologous F (ab') 2 antibodies revert blood incoagulability resulting from envenoming by Lonomia obliqua caterpillars. | |
Apitz-Castro et al. | Purification and partial characterization of draculin, the anticoagulant factor present in the saliva of vampire bats (Desmodus rotundus) | |
Li et al. | Hematological studies on DIC-like findings observed in patients with snakebite in south China | |
Tanaka-Azevedo et al. | Thrombin inhibitors from different animals | |
CA2203827A1 (en) | Novel family of protease inhibitors, and other biologic active substances | |
US20160046728A1 (en) | Identification and molecular characterisation of proteins, expressed in the ixodes ricinus salivary glands | |
Chanhome et al. | Biochemical and proteomic analyses of venom from a new pit viper, Protobothrops kelomohy | |
Dunwiddie et al. | [18] Purification and characterization of inhibitors of blood coagulation factor Xa from hematophagous organisms | |
US4788149A (en) | Proteolytic enzyme from blood-sucking nematodes and its uses as an anticoagulant as a vaccine and as an antithelminic agent | |
Sánchez et al. | Partial characterization of a basic protein from Crotalus molossus molossus (northern blacktail rattlesnake) venom and production of a monoclonal antibody | |
US5955294A (en) | Nematode-extracted serine protease inhibitors and anticoagulant proteins | |
US6841534B2 (en) | Protein Z-dependent protease inhibitor | |
Gray et al. | Construction, non-denaturing affinity purification, and characterization of baculovirally expressed human secretory leukocyte protease inhibitor | |
Day et al. | Bacterial expression, purification, and partial characterization of amino acids 94–155 of human tissue factor pathway inhibitor (TFPI) as an inhibitor of blood coagulation factor Xa |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
EEER | Examination request | ||
FZDE | Discontinued |