Die vorliegende Erfindung betrifft im Allgemeinen das Gebiet der Molekularbiologie und befasst sich mit einem Verfahren zur Verbesserung von verschiedenen Ertragsmerkmalen durch Modulation der Expression einer Nukleinsäure, die ein C3H-ähnliches Polypeptid kodiert, in einer Pflanze. Die vorliegende Erfindung betrifft auch Pflanzen mit einer modulierten Expression einer Nukleinsäure, die ein C3H-ähnliches Polypeptid kodiert, wobei die Pflanzen verbesserte Ertragsmerkmale im Vergleich zu entsprechenden Wildtyp-Pflanzen oder anderen Kontrollpflanzen aufweisen. Die Erfindung stellt auch Konstrukte bereit, die in den Verfahren der Erfindung von Nutzen sind.The present invention relates generally to the field of molecular biology and is directed to a method of enhancing various yield-related traits by modulating the expression of a nucleic acid encoding a C3H-like polypeptide in a plant. The present invention also relates to plants having modulated expression of a nucleic acid encoding a C3H-like polypeptide, said plants having improved yield-related traits relative to corresponding wild type plants or other control plants. The invention also provides constructs useful in the methods of the invention.

Die vorliegende Erfindung betrifft im Allgemeinen das Gebiet der Molekularbiologie und befasst sich mit einem Verfahren zur Verbesserung von verschiedenen Ertragsmerkmalen durch Modulation der Expression einer Nukleinsäure, die ein SPATULA-ähnliches (SPT) Polypeptid kodiert, in einer Pflanze. Die vorliegende Erfindung betrifft auch Pflanzen mit einer modulierten Expression einer Nukleinsäure, die ein SPT-ähnliches Polypeptid kodiert, wobei die Pflanzen verbesserte Ertragsmerkmale im Vergleich zu entsprechenden Wildtyp-Pflanzen oder anderen Kontrollpflanzen aufweisen. Die Erfindung stellt auch Konstrukte bereit, die in den Verfahren der Erfindung von Nutzen sind.The present invention relates generally to the field of molecular biology and is directed to a method of enhancing various yield-related traits by modulating the expression of a nucleic acid encoding a SPATULA-like (SPT) polypeptide in a plant. The present invention also relates to plants having modulated expression of a nucleic acid encoding an SPT-like polypeptide, the plants having improved yield-related traits relative to corresponding wild type plants or other control plants. The invention also provides constructs useful in the methods of the invention.

Die vorliegende Erfindung betrifft im Allgemeinen das Gebiet der Molekularbiologie und befasst sich mit einem Verfahren zur Verbesserung von verschiedenen Wachstumseigenschaften durch Modulation der Expression einer Nukleinsäure, die ein IDI2 (Eisenmangel-induziert-2) Polypeptid kodiert, in einer Pflanze. Die vorliegende Erfindung betrifft auch Pflanzen mit einer modulierten Expression einer Nukleinsäure, die ein IDI2-Polypeptid kodiert, wobei die Pflanzen verbesserte Wachstumseigenschaften im Vergleich zu entsprechenden Wildtyp-Pflanzen oder anderen Kontrollpflanzen aufweisen. Die Erfindung stellt auch Konstrukte bereit, die in den Verfahren der Erfindung von Nutzen sind.The present invention relates generally to the field of molecular biology and is concerned with a method of enhancing various growth characteristics by modulating the expression of a nucleic acid encoding an IDI2 (iron-deficient induced-2) polypeptide in a plant. The present invention also relates to plants having a modulated expression of a nucleic acid encoding an IDI2 polypeptide, the plants having improved growth characteristics compared to corresponding wild type plants or other control plants. The invention also provides constructs useful in the methods of the invention.

Die vorliegende Erfindung betrifft im Allgemeinen das Gebiet der Molekularbiologie und befasst sich mit einem Verfahren zur Verbesserung von verschiedenen Wachstumseigenschaften durch Modulation der Aktivität eines eIF4F-ähnlichen Proteinkomplexes, in einer Pflanze. Die vorliegende Erfindung betrifft auch Pflanzen mit einer modulierten Aktivität eines eIF4F-ähnlichen Proteinkomplexes, wobei die Pflanzen verbesserte Wachstumseigenschaften im Vergleich zu entsprechenden Wildtyp-Pflanzen oder anderen Kontrollpflanzen aufweisen. Die Erfindung stellt auch Konstrukte bereit, die in den Verfahren der Erfindung von Nutzen sind.The present invention relates generally to the field of molecular biology and is directed to a method for improving various growth characteristics by modulating the activity of an eIF4F-like protein complex in a plant. The present invention also relates to plants having a modulated activity of an eIF4F-like protein complex, the plants having improved growth characteristics compared to corresponding wild-type plants or other control plants. The invention also provides constructs useful in the methods of the invention.

Die vorliegende Erfindung betrifft im Allgemeinen das Gebiet der Molekularbiologie und befasst sich mit einem Verfahren zur Verbesserung von verschiedenen Wachstumseigenschaften durch Modulation der Expression einer Nukleinsäure, die ein GR-RBP (Glycin-reiches-RNA-Bindungsprotein) Polypeptid kodiert, in einer Pflanze. Die vorliegende Erfindung betrifft auch Pflanzen mit einer modulierten Expression einer Nukleinsäure, die ein GR-RBP Polypeptid kodiert, wobei die Pflanzen verbesserte Wachstumseigenschaften im Vergleich zu entsprechenden Wildtyp-Pflanzen oder anderen Kontrollpflanzen aufweisen. Die Erfindung stellt auch Konstrukte bereit, die in den Verfahren der Erfindung von Nutzen sind.The present invention relates generally to the field of molecular biology and is concerned with a method of enhancing various growth characteristics by modulating expression in a plant of a nucleic acid encoding a GR-RBP (glycine-rich RNA binding protein) polypeptide. The present invention also relates to plants having modulated expression of a nucleic acid encoding a GR-RBP polypeptide, said plants having enhanced growth characteristics as compared to corresponding wild type plants or other control plants. The invention also provides constructs useful in the methods of the invention.

Die stetig anwachsende Weltbevölkerung und die schwindende Reserve an anbaufähigem Land, das für die Landwirtschaft zur Verfügung steht, treibt die Forschung hin zur Erhöhung der Effizienz der Landwirtschaft. Herkömmliche Methoden für Verbesserungen bei Nutzpflanzen und Gartenpflanzen wenden selektive Züchtungstechniken zum Identifizieren von Pflanzen mit wünschenswerten Merkmalen an. Allerdings weisen derartige selektive Züchtungstechniken mehrere Nachteile dahingehend auf, dass diese Techniken typischerweise arbeitsintensiv sind und zu Pflanzen führen, welche häufig heterogene genetische Komponenten enthalten, welche nicht immer dazu führen können, dass die erwünschte Eigenschaft von Elternpflanzen weitergegeben wird. Die Fortschritte in der Molekularbiologie haben es der Menschheit erlaubt, das Keimplasma von Tieren und Pflanzen zu modifizieren. Die gentechnische Manipulation von Pflanzen beinhaltet die Isolierung und Manipulierung von genetischem Material (typischerweise in der Form von DNA oder RNA) und die anschließende Einbringung dieses genetischen Materials in eine Pflanze. Diese Technologie weist das Vermögen auf, Nutzpflanzen oder Pflanzen mit verschiedenen verbesserten wirtschaftlichen, landwirtschaftlichen oder gärtnerischen Eigenschaften zur Verfügung zu stellen.The steadily increasing world population and the dwindling reserve of arable land available for agriculture is driving research to increase the efficiency of agriculture. Conventional methods for crop and garden crop improvement employ selective breeding techniques to identify plants with desirable traits. However, such selective breeding techniques have several disadvantages in that these techniques are typically labor-intensive and result in plants that often contain heterogeneous genetic components that may not always result in the desired trait being passed on to parent plants. Advances in molecular biology have allowed humankind to modify the germplasm of animals and plants. Genetic manipulation of plants involves the isolation and manipulation of genetic material (typically in the form of DNA or RNA) and subsequent introduction of this genetic material into a plant. This technology has the ability to provide crops or plants with various improved commercial, agricultural or horticultural properties.

Eine Eigenschaft von besonderem wirtschaftlichem Interesse ist ein verbesserter Ertrag. Der Ertrag ist normalerweise als der messbare Gewinn von ökonomischem Wert aus einer Nutzpflanze definiert. Dies kann in Bezug auf die Quantität und/oder Qualität definiert sein. Der Ertrag ist direkt von mehreren Faktoren, wie zum Beispiel der Anzahl und Größe der Organe, der Pflanzenarchitektur (zum Beispiel der Anzahl an Verzweigungen), der Samenproduktion, der Blatt-Seneszenz und sonstigem, abhängig. Wurzelentwicklung, Nährstoffaufnahme, Stresstoleranz und Jungpflanzenvitalität können ebenfalls bedeutende Faktoren bei der Bestimmung des Ertrags sein. Das Optimieren der oben erwähnten Faktoren kann daher zu einer Erhöhung des Nutzpflanzenertrags beitragen.A property of particular economic interest is improved yield. The yield is usually defined as the measurable gain of economic value from a crop. This can be defined in terms of quantity and / or quality. Yield depends directly on several factors, such as the number and size of organs, plant architecture (for example, number of branches), seed production, leaf senescence, and others. Root development, Nutrient uptake, stress tolerance and early vigor can also be important factors in determining yield. Optimizing the factors mentioned above can therefore contribute to an increase in crop yield.

Der Samenertrag ist ein besonders wichtiges Merkmal, da die Samen vieler Pflanzen für die menschliche und tierische Ernährung wichtig sind. Nutzpflanzen, wie Mais, Reis, Weizen, Canola und Sojabohne machen über die Hälfte der gesamten menschlichen Kalorienaufnahme aus, ob durch direkten Verzehr der Samen selbst oder durch Verzehr von Fleischprodukten, welche auf Grundlage verarbeiteter Samen erzeugt wurden. Sie stellen ebenfalls eine Quelle für Zucker, Öle und viele Arten von Metaboliten, die in industriellen Verfahren verwendet werden, dar. Samen enthalten einen Embryo (die Quelle von neuen Sprossen und Wurzeln) sowie ein Endosperm (die Quelle von Nährstoffen für das Embryowachstum während der Keimung und während des frühen Wachstums der Setzlinge). Die Entwicklung eines Samens beteiligt zahlreiche Gene und erfordert den Transfer von Metaboliten aus den Wurzeln, Blättern und Stängeln in den wachsenden Semen. Das Endosperm assimiliert im Besonderen die Stoffwechselvorläufer von Kohlehydraten, Ölen und Proteinen und synthetisiert sie zu Speichermakromolekülen, um das Korn auszufüllen.Seed yield is a particularly important feature because the seeds of many plants are important for human and animal nutrition. Crops such as corn, rice, wheat, canola and soybean account for over half of total human caloric intake, whether by direct consumption of the seeds themselves or by eating meat products made from processed seeds. They also provide a source of sugars, oils and many types of metabolites used in industrial processes. Seeds include an embryo (the source of new sprouts and roots) and an endosperm (the source of nutrients for embryo growth during embryo growth) Germination and during the early growth of seedlings). The development of a seed involves many genes and requires the transfer of metabolites from the roots, leaves and stems in the growing semen. Specifically, the endosperm assimilates the metabolic precursors of carbohydrates, oils, and proteins and synthesizes them into storage macromolecules to fill the grain.

Eine andere bedeutende Eigenschaft für viele Nutzpflanzen ist die Jungpflanzenvitalität. Die Verbesserung der Jungpflanzenvitalität ist ein wichtiges Ziel bei modernen Reis-Züchtungsprogrammen sowohl in gemäßigten als auch tropischen Reis-Kultivaren. Lange Wurzeln sind wichtig für eine korrekte Bodenverankerung bei in Wasser ausgesätem Reis. Falls Reis direkt in überflutete Ackerfelder ausgesät wird und falls die Pflanzen rasch durch das Wasser auftauchen müssen, stehen längere Sprosse bzw. Triebe mit der Wuchskraft in Zusammenhang. Wo eine Aussaat mit Drillvorrichtung praktiziert wird, sind längere Mesokotyle und Koleoptile für ein günstiges Auflaufen des Setzlings bedeutsam. Die Fähigkeit, Jungpflanzenvitalität künstlich in Pflanzen einzubringen, wäre für die Landwirtschaft von großer Bedeutung. Zum Beispiel war eine geringe Jungpflanzenvitalität eine Einschränkung bei der Einführung von Mais-(Zea Mais L.)-Hybriden auf Basis von ”Corn Belt”-Keimplasma im europäischen Atlantikraum.Another important trait for many crops is early vigor. Improving early vigor is an important goal of modern rice breeding programs in both temperate and tropical rice cultivars. Long roots are important for proper ground anchoring in rice seeded in water. If rice is sown directly into flooded fields and if the plants have to emerge quickly through the water, longer sprouts or shoots are related to the growth force. Where seeding with a drill is practiced, longer mesocotyles and coleoptiles are important for a favorable emergence of the seedling. The ability to artificially introduce seedling vitality into plants would be of great importance to agriculture. For example, low early vigor was a limitation in the introduction of maize (Zea corn L.) hybrids based on Corn Belt germplasm in the European Atlantic.

Ein weiteres wichtiges Merkmal ist die verbesserte abiotische Stresstoleranz. Abiotischer Stress ist eine Hauptursache für weltweite Ernteverluste und reduziert die durchschnittlichen Erträge bei den meisten Hauptkulturpflanzenarten um mehr als 50% ( Wang et al., Planta (2003), 218: 1–14 ). Abiotischer Stress kann durch Trockenheit, Versalzung, Temperaturextrema, chemische Toxizität und aus 59348: Überschuss oder Fehlen von Nährstoffen (Makroelementen und/oder Mikroelementen), Strahlung und oxidativen Stress verursacht werden. Die Fähigkeit, die Pflanzentoleranz gegenüber abiotischen Stress zu verbessern, wäre weltweit von großem wirtschaftlichem Vorteil für die Landwirte und würde den Anbau von Kulturpflanzen unter ungünstigen Bedingungen und in Gebieten, wo ein Anbau von Kulturpflanzen sonst nicht möglich wäre, gestatten.Another important feature is the improved abiotic stress tolerance. Abiotic stress is a major cause of global crop losses, reducing the average yields of most major crop species by more than 50% ( Wang et al., Planta (2003), 218: 1-14 ). Abiotic stress can be caused by dryness, salinisation, temperature extremes, chemical toxicity and excess 59348: excess or lack of nutrients (macroelements and / or microelements), radiation and oxidative stress. The ability to improve plant tolerance to abiotic stress would be of great economic benefit to farmers worldwide and would permit the cultivation of crops under unfavorable conditions and in areas where cultivation of crops would not otherwise be possible.

Der Nutzpflanzenertrag kann daher durch Optimieren von einem der oben erwähnten Faktoren verbessert werden.The crop yield can therefore be improved by optimizing one of the factors mentioned above.

Abhängig von der Endanwendung kann die Modifikation bestimmter Ertragseigenschaften gegenüber anderen bevorzugt sein. Beispielsweise kann für Anwendungen wie Futtermittel- oder Holzproduktion oder Biotreibstoff-Ressourcen ein Zuwachs bei den vegetativen Teilen einer Pflanze wünschenswert sein, und für Anwendungen wie Mehl-, Stärke- oder Ölproduktion kann ein Zuwachs hinsichtlich der Samenparameter besonders erwünscht sein. Sogar unter den Samenparametern können, abhängig vom Verwendungszweck, manche gegenüber anderen bevorzugt sein. Verschiedene Mechanismen können zur Erhöhung des Samenertrags beitragen, ungeachtet dessen, ob diese in Form einer erhöhten Samengröße oder einer erhöhten Samenzahl vorliegt.Depending on the end use, modification of particular yield characteristics may be preferred over others. For example, for applications such as feed or wood production or biofuel resources, an increase in the vegetative parts of a plant may be desirable, and for applications such as flour, starch or oil production, an increase in seed parameters may be particularly desirable. Even among the seed parameters, depending on the purpose, some may be preferred over others. Various mechanisms may contribute to increasing seed yield, whether in the form of increased seed size or increased seed count.

Ein Ansatz zur Erhöhung des Ertrags (Samenertrag und/oder Biomasse) in Pflanzen kann durch Modifikation der inhärenten Wachstumsmechanismen einer Pflanze erfolgen, wie etwa dem Zellzyklus oder verschiedenen Signalleitungswegen, die am Pflanzenwachstum oder an Abwehrmechanismen beteiligt sind.One approach to increasing the yield (seed yield and / or biomass) in plants may be by modification of the inherent growth mechanisms of a plant, such as the cell cycle or various signaling pathways involved in plant growth or defense mechanisms.

Es wurde jetzt entdeckt, dass verschiedene Ertragsmerkmale in Pflanzen gesteigert werden können durch Modulieren der Expression in einer Pflanze einer Nukleinsäure, die ein C3H-ähnliches Polypeptid kodiert, in einer Pflanze.It has now been discovered that various yield-related traits in plants can be enhanced by modulating expression in a plant of a nucleic acid-encoding nucleic acid encoding a C3H-like polypeptide.

Es wurde jetzt ebenfalls entdeckt, dass verschiedene Ertragsmerkmale in Pflanzen gesteigert werden können durch Modulieren der Expression einer Nukleinsäure, die ein SPT-ähnliches Polypeptid kodiert, in einer Pflanze. It has now also been discovered that various yield-related traits in plants can be increased by modulating the expression of a nucleic acid encoding an SPT-like polypeptide in a plant.

Es wurde jetzt ebenfalls entdeckt, dass verschiedene Wachstumseigenschaften in Pflanzen verbessert werden können durch Modulieren der Expression einer Nukleinsäure, die ein IDI2(Eisenmangel-induziert 2)-Polypeptid kodiert, in einer Pflanze.It has now also been discovered that various growth traits in plants can be improved by modulating the expression of a nucleic acid encoding an IDI2 (iron deficient induced 2) polypeptide in a plant.

Es wurde jetzt ebenfalls entdeckt, dass verschiedene Wachstumseigenschaften in Pflanzen verbessert werden können durch Modulieren der Aktivität von mindestens einer Nukleinsäure, die ein eIF4F-ähnliches Proteinkomplex-Untereinheit-Polypeptid kodiert, und/oder des Spiegels des Proteinkomplexes, in einer Pflanze.It has now also been discovered that various growth traits in plants can be improved by modulating the activity of at least one nucleic acid encoding an eIF4F-like protein complex subunit polypeptide and / or the level of the protein complex in a plant.

Es wurde jetzt ebenfalls entdeckt, dass verschiedene Wachstumseigenschaften in Pflanzen verbessert werden können durch Modulieren der Expression einer Nukleinsäure, die ein GR-RBP (Glycin-reiches RNA-Bindungsprotein) kodiert, in einer Pflanze.It has now also been discovered that various growth traits in plants can be improved by modulating expression in a plant of a nucleic acid encoding a GR-RBP (glycine-rich RNA binding protein).

Hintergrundbackground

1. C3H-ähnliche Polypeptide1. C3H-like polypeptides

Eine der häufigsten Domänen, die im Arabidopsis Proteom nachgewiesen wurde, ist die RING-Finger Domäne. Die RING Domäne wurde ursprünglich nach dem Akronym für das Protein bezeichnet, in dem es zuerst entdeckt wurde, und das von dem Really Interesting New Gene kodiert wurde. Die RING-Finger Domäne ist mit der Zink-Finger Domäne verwandt; jedoch bestehen Zinkfinger aus zwei Paaren von Zinkliganden, die koordiniert ein Zinkion binden, wohingegen RING Finger aus vier Paaren von Liganden bestehen, die zwei Ionen binden. Die RING Domäne kann grundlegendend als Protein-Wechselwirkungs-Domäne angesehen werden.One of the most common domains detected in the Arabidopsis proteome is the RING finger domain. The RING domain was originally named after the acronym for the protein in which it was first discovered and encoded by the Really Interesting New Gene. The RING finger domain is related to the zinc finger domain; however, zinc fingers consist of two pairs of zinc ligands that coordinate to bind a zinc ion, whereas RING fingers consist of four pairs of ligands that bind two ions. The RING domain can basically be regarded as a protein interaction domain.

Die RING Finger Domäne umfasst verschiedene Arten von Unterdomänen, nämlich den C3HC4-Typ und den C3H2C3-Typ, die auch als RING-HC bzw. RING-H2 bezeichnet werden.The RING finger domain includes several types of subdomains, namely the C3HC4 type and the C3H2C3 type, also referred to as RING-HC and RING-H2, respectively.

2. SPATULA(SPT)-ähnliche Polypeptide2. SPATULA (SPT) -like polypeptides

Die basischen/Helix-Loop-Helix (bHLH) Transkriptionsfaktoren und ihre Homologa bilden eine große Familie in Pflanzen- und Tiergenomen. Li et al., 2006 (Plant Physiol Aug; 141 (4): 1167–84) identifizierten 167 bHLH Gene im Reisgenom und berichteten, dass ihre phylogenetische Analyse zeigt, dass sie bestens unterstütze Stämme bilden. Die Phylogenie der bHLH Proteine aus Arabidopsis thaliana wurde ebenfalls untersucht, siehe Toledo-Ortiz et al., 2003 (Plant Cell, Aug; 15(8): 1749–70) ; Buck and Atchley, 2003 (J Mol EBd. Jun; 56(6): 742–50) .The basic / helix-loop helix (bHLH) transcription factors and their homologues form a large family in plant and animal genomes. Li et al., 2006 (Plant Physiol Aug; 141 (4): 1167-84) identified 167 bHLH genes in the rice genome and reported that their phylogenetic analysis indicates that they form well-supported strains. The phylogeny of bHLH proteins from Arabidopsis thaliana was also studied, see Toledo-Ortiz et al., 2003 (Plant Cell, Aug; 15 (8): 1749-70) ; Buck and Atchley, 2003 (J Mol EBd. Jun; 56 (6): 742-50) ,

SPATULA ist ein bHLH Transkriptionsfaktor. Groszmann et al., 2008 (Plant Journal, July 55(1):40–52) beschrieben, dass das SPATULA (SPT) gen an der Erzeugung des Septums, Griffel und Stigma beteiligt ist. Sie identifizierten ebenfalls 12 Orthologa von AtSPT in Eudicotyledonen, Reis und einer Gymnosperme. Sie identifizierten 2 konservierte Struktur-Domänen zusaätzlich zu der BHLH-Domäne: eine amphipathische Helix und eine saure Domäne. SPATULA ist Berichten zufolge ein lichtstabiler Repressor der Samenkeimung, siehe Penfield et al. 2005 (Curr Biol. Nov 22; 15(22): 1988–2006) .SPATULA is a bHLH transcription factor. Groszmann et al., 2008 (Plant Journal, July 55 (1): 40-52) described that the SPATULA (SPT) gene is involved in the production of the septum, stylus and stigma. They also identified 12 orthologs of AtSPT in eudicotyledons, rice and a gymnosperm. They identified 2 conserved structural domains in addition to the BHLH domain: an amphipathic helix and an acidic domain. SPATULA is reportedly a light stable repressor of seed germination, see Penfield et al. 2005 (Curr Biol. Nov 22; 15 (22): 1988-2006) ,

3. IDI2 (Eisenmangel-induziert 2) Polypeptide3. IDI2 (iron deficiency-induced 2) polypeptides

Die Fe-Mangel-induzierbare cDNA IDI2 wurde erstmals isoliert aus eisendefizienten Gerstenwurzeln. Das kodierte Protein hatte eine geringe Ähnlichkeit zu alpha-Untereinheiten des eukaryotischen Initiationsfaktors 2B ( Yamaguchi et al., J. Exp. Bot. 51, 2001–2007, 2000 ), der ein Guanin-Nucleotid-Austauschfaktor (GEF) ist, der eine Schlüsselrolle bei der eine Schlüsselrolle bei der Regulation der Proteinsynthese spielt. Die Translation von mRNA beginnt mit der Bindung der Initiator Met-tRNA, an die 40 S ribosomale Untereinheit und wird vermittelt durch eIF-2 als Teil des eIF-2-GTP-Met-tRNA_i ternären Komplex. Während des Initiationsprozesses, wird das eIF-2 hydrolysiert, und ein binärer Komplex bestehend aus eIF-2 und GDP wird aus dem 80 S Initiationskomplex freigesetzt. Da eIF-2 eine 100–400-fach höhere Affinität für GDP als für GTP hat, benötigt man den als eIF-2B bekannten Guaninnukleotidaustauschfaktor (GEF) zur Regeneration der GTP-gebundenen Form von eIF-2, die dann in einem weiteren Zyklus der Translationsinitiation teilnehmen kann.The Fe-deficient inducible cDNA IDI2 was first isolated from iron-deficient barley roots. The encoded protein was poorly similar to alpha subunits of eukaryotic initiation factor 2B (FIG. Yamaguchi et al., J. Exp. Bot. 51, 2001-2007, 2000 ), which is a guanine nucleotide exchange factor (GEF), which plays a key role in the key role in the regulation of protein synthesis. The translation of mRNA initiated by the binding of the initiator Met-tRNA to the 40 S ribosomal subunit and is mediated by eIF-2 as part of the eIF-2-Met-tRNA _i GTP ternary complex. During the initiation process, the eIF-2 is hydrolyzed and a binary complex consisting of eIF-2 and GDP is released from the 80 S initiation complex. Since eIF-2 has a 100-400-fold higher affinity for GDP than for GTP, one needs the guanine nucleotide exchange factor (GEF) known as eIF-2B for the regeneration of the GTP-bound form of eIF-2, which then in another cycle of the Translationsinitiation can participate.

Der eukaryotische Translationsinitiationsfaktor eIF-2B ist ein Komplex, der aus bis zu 5 verschiedenen Untereinheiten besteht, alpha, beta, gamma, delta und epsilon, und der den Austausch von eIF-2-gebundenem GDP gegen GTP katalysiert. Diese Familie umfasst die Initiationsfaktor 2B alpha, beta und delta Untereinheiten aus Eukaryoten, verwandte Proteine aus Archaebakterien und IF-2 aus prokaryoten, und enthält ebenfalle eine Unterfamilie von Proteinen in Eukaryoten, Archaeae, oder Eubakterien. Das IDI2 Protein ist Teil einer Familie von eIF2Balpha-ähnlichen Proteinen, wobei sich die Familie von der eIF2Balpha/beta/delta unterscheidet. Mitglieder dieser Familie wurden auch als 5-Methylthioribose-1-phosphatisomerasen charakterisiert, einem Enzym des Methionin-Rettungsweg.The eukaryotic translation initiation factor eIF-2B is a complex consisting of up to 5 different subunits, alpha, beta, gamma, delta and epsilon, which catalyzes the exchange of eIF-2 linked GDP for GTP. This family includes the initiation factor 2B alpha, beta and delta subunits from eukaryotes, related proteins from archaebacteria and IF-2 from prokaryotes, and also contains a subfamily of proteins in eukaryotes, archaeae, or eubacteria. The IDI2 protein is part of a family of eIF2Balpha-like proteins, with the family being different from the eIF2Balpha / beta / delta. Members of this family have also been characterized as 5-methylthioribose-1-phosphate isomerases, an enzyme of the methionine rescue route.

Die Transkription von IDI2 wird bei Eisen- oder Zinkmangel induziert, aber nicht durch Kupfer- oder Manganmangel ( Yamaguchi et al., 2000 ). Die Expression von IDI2 unterschied sich nicht signifikant zwischen bortoleranten und borintoleranten Pflanzen ( Patterson et al., Plant Physiol. 144, 1612–1631, 2007 ). Es wurde postuliert, dass IDI2 bei der Regulation der Syntheserate von Proteinen wirkt, die zur Adaptation an Fe-Mangel erforderlich sind ( Yamaguchi et al., 2000 ), insbesondere bei der Initiation der Translation ( Negishi et al., Plant J., 30, 83–94, 2002 ).Transcription of IDI2 is induced by iron or zinc deficiency but not by copper or manganese deficiency ( Yamaguchi et al., 2000 ). The expression of IDI2 did not differ significantly between bortolerant and borin-tolerant plants ( Patterson et al., Plant Physiol. 144, 1612-1631, 2007 ). It has been postulated that IDI2 acts to regulate the rate of synthesis of proteins required to adapt to Fe deficiency ( Yamaguchi et al., 2000 ), especially in the initiation of translation ( Negishi et al., Plant J., 30, 83-94, 2002 ).

4. eIF4F-ähnliche Proteinkomplexuntereinheiten4. eIF4F-like protein complex subunits

Die Proteinsynthese wird durch verschiedene Mechanismen in Prokaryoten und Eukaryoten gesteuert. In Eukaryoten, beinhalten solche Mechanismen mehrere Multiuntereinheitskomplexe einschließlich eukaryotischem Translationsinitiationsfaktor (eIFs). Gewöhnlich werden Initiator-tRNA, 40S und 60S ribosomale Untereinheiten durch eI Fs zu einem 80S Ribosom am Initiationscodon der mRNA zusammengebaut. Daher wird der Initiationstranslationsmechanismus für die Proteintranslation als geschwindigkeitsbestimmend angesehen.Protein synthesis is controlled by various mechanisms in prokaryotes and eukaryotes. In eukaryotes, such mechanisms include multiple multi-subunit complexes including eukaryotic translation initiation factor (eIFs). Usually, initiator tRNA, 40S and 60S ribosomal subunits are assembled by eI Fs to an 80S ribosome at the initiation codon of the mRNA. Therefore, the initiation translation mechanism for protein translation is considered to be rate limiting.

Die beiden Hauptkomplexe, die an der Translationsinitiation beteiligt sind, sind der eIF4F, der an die 7mGppp Kappe der mRNA bindet und der den 43S Komplex, und den 43S Komplex rekrutiert, die die 40 Ribosomen-Untereinheit zur 5'UTR bringen und ein 5'Scanning zum korrekten Initiations-AUG-Codon ermöglichen. Sowohl eIF4F (Komplex von eIF4F + eIF4G + eIF4A) als auch eIF(iso)4F (Komplex von eIF(iso)4E + eIF(iso)4G + eIF4A) haben ähnliche Aktivitäten bei der Unterstützung der Initiation der Translation in vitro ( Lax et al., Mechanisms of Development, Volume 122, Issues 7–8, July 2005, Pp. 865–876 ; Browning et al., J. Biol. Chem. 267 (1992), pp. 10096–10100 ).The two major complexes involved in translation initiation are the eIF4F, which binds to the 7mGppp cap of the mRNA and recruits the 43S complex and the 43S complex, bringing the ribosome subunit to the 5'UTR and a 5 ' Enable scanning to the correct initiation AUG codon. Both eIF4F (complex of eIF4F + eIF4G + eIF4A) and eIF (iso) 4F (complex of eIF (iso) 4E + eIF (iso) 4G + eIF4A) have similar activities in assisting the initiation of translation in vitro ( Lax et al., Mechanisms of Development, Volume 122, Issues 7-8, July 2005, pp. 865-876 ; Browning et al., J. Biol. Chem. 267 (1992), pp. 10096-10100 ).

Das eIF4F Polypeptid bindet mit eIF4G und eIF4A so dass der eIF4F Proteinkomplex erhalten wird, der als Gerüst für den Zusammenbau anderer Initiationsfaktoren dient, wie eIF4B, eIF3, und poly(A)-bindende Proteine.The eIF4F polypeptide binds with eIF4G and eIF4A to give the eIF4F protein complex, which serves as a scaffold for the assembly of other initiation factors, such as eIF4B, eIF3, and poly (A) -binding proteins.

Andere Faktoren, die an der Translation beteiligt sind, sind eIF5, das die Dissoziation des gesamten 43S Komplexes ermöglicht, wenn das Initiations-AUG gegeben ist. Dann fördert eIF5B die Assoziation der 60S und 405 Untereinheit des Ribosoms und die Translation startet tatsächlich. PolyA-bindende Proteine binden an eIF4F, so dass START und END des CDS nahe zusammengebracht werden, was der effizienten Rückführung der Ribosomen-40S Untereinheit dient.Other factors involved in translation are eIF5, which allows the dissociation of the entire 43S complex when the initiation AUG is given. Then, eIF5B promotes association of the 60S and 405 subunits of the ribosome, and translation actually starts. PolyA-binding proteins bind to eIF4F, bringing CDS START and END close together for efficient ribosome 40S subunit recycling.

In Pflanzen besteht eIF4isoF aus eIF4isoE, isoG und eIF4A Untereinheiten. Die ”iso” Untereinheiten sind funktionelle Äquivalente der ”normalen” Untereinheiten, die gewöhnlich viel kürzer sind und wenig Sequenzhomologie zu ihrem normalen Gegenstück aufweisen.In plants, eIF4isoF consists of eIF4isoE, isoG and eIF4A subunits. The "iso" subunits are functional equivalents of the "normal" subunits, which are usually much shorter and have little sequence homology to their normal counterpart.

In Eukaryoten scheint eIF4F verschiedene Rollen zu spielen; in Tieren ist eIF4F ein Oncongen, wobei der Mechanismus durch Suppression der Apoptose wirkt. Überexpression von Reis eIF4isoG steigert die Anfälligkeit gegenüber dem Gelbfleckenvirus, wenn das Allel ein empfindliches Allel ist. eIF5A ist gemeinhin mit dem programmierten Zelltod assoziiert, und seine Überexpression in Pflanzen führt zu widersprüchlichen Ergebnissen: schwere Wachstumsdefekte ( Hopkins et al., Plant Physiology, September 2008, Bd. 148, S. 479–489 ) oder eine erhöhte Rosettengröße ( Liu et al., Journal of Experimental Botany, Bd. 59, No. 4, S. 939–950, 2008 ).In eukaryotes, eIF4F seems to play different roles; In animals, eIF4F is an oncongene, with the mechanism acting by suppressing apoptosis. Overexpression of rice eIF4isoG increases the susceptibility to yellow spot virus when the allele is a sensitive allele. eIF5A is commonly associated with programmed cell death, and its overexpression in plants leads to conflicting results: severe growth defects ( Hopkins et al., Plant Physiology, September 2008, Vol. 148, pp. 479-489 ) or an increased rosette size ( Liu et al., Journal of Experimental Botany, vol. 59, no. 4, pp. 939-950, 2008 ).

Daniel R. Gallie (Plant Molecular Biology 50: 949–970, 2002.) offenbart Protein-Protein-Wechselwirkungen, die bei der Translation benötigt werden, konzentriert sich aber nur auf solche, die an der Translation von Kerngenen beteiligt sind, da die Translatiorismaschinerie des Chloroplasten und des Mitochondriums prokaryotischer Natur sind. Daher wird die Rolle von mehreren eIFs bei den Translationsmechanismen dargestellt. Beide Pflanzen eIF4G, die größere Untereinheit von eIF4F, und eIF4A werden in diesem Dokument erwähnt, sowie ihre Rolle bei der Initiation in Pflanzen. Es ist jedoch auch offensichtlich, dass hinsichtlich ihrer Rolle bei dem Initiationsprozess wenig bekannt ist, und es kann keine Beziehung zwischen ihren Beiträgen zu diesem Prozess und den verbesserten Ertragsmerkmalen erstellt werden. Daniel R. Gallie (Plant Molecular Biology 50: 949-970, 2002.) discloses protein-protein interactions required in translation, but focuses only on those involved in the translation of nuclear genes, since the translational machinery of the chloroplast and mitochondrial are prokaryotic in nature. Therefore, the role of several eIFs in the translation mechanisms is presented. Both plants eIF4G, the larger subunit of eIF4F, and eIF4A are mentioned in this document, as well as their role in plant initiation. However, it is also obvious that little is known about their role in the initiation process, and no relationship can be established between their contributions to the process and the improved yield-related traits.

Das Dokument Albar et al. (Mutations in the eIF(iso)4G translation initiation factor confer high resistance of rice to Rice yellow mottle virus – The Plant Journal (2006) 47, 417–426) offenbart die Rolle der Isoform von IF4G in den auftretenden Wechselwirkungen in Reis und der Virusresistenz, nämlich in Bezug auf das Reis-Gelbfleckenvirus (RYMV). Wiederum konnte keine Beziehung zwischen der Hauptaufgabe des zitierten Dokumentes und den verbesserten Ertragsmerkmalen herbeigeführt werden, wenn die Pflanzen nicht schwer durch Virus infiziert sind. The document Albar et al. (Mutations in the eIF (iso) 4G translation initiation factor confer high resistance of Rice yellow mottle virus - The Plant Journal (2006) 47, 417-426) discloses the role of the isoform of IF4G in the interactions occurring in rice and virus resistance, namely rice yellow spot virus (RYMV). Again, no relationship could be established between the main task of the cited document and the improved yield-related traits, if the plants are not heavily infected by virus.

Andere Dokumente betreffen Pflanzen eIF4F, wie Laura K. Mayberry et al. (Methods in Enzymology, Bd. 430, Kapitel 15 – S. 397–408 – Elsevier 2007) das die Expression und Reinigung von rekombinantem Weizen-eIFs betrifft, aber wiederum wird nichts in Bezug auf die Wirkungen oder die Anwendung von Methoden zum Verbessern der Ertragsmerkmale offenbart.Other documents concern plants eIF4F, like Laura K. Mayberry et al. (Methods in Enzymology, Vol. 430, Chapter 15 - pp. 397-408 - Elsevier 2007) On the other hand, nothing is said about the effects or the application of methods for improving the yield-related traits.

Das erfindungsgemäße Verfahren betrifft ein Verfahren zum Gewinnen von Pflanzen mit verbesserten Ertragsmerkmalen und Pflanzen davon.The method of the invention relates to a method of obtaining plants having improved yield-related traits and plants thereof.

5. GR-RBP (Glycin-reiches-RNA bindendes Protein) Polypeptid5. GR-RBP (glycine-rich RNA binding protein) polypeptide

Das Genom von Arabidopsis thaliana kodiert mehr als 200 verschiedene RNA bindende Proteine (RBPs). Diese RBPs spielen eine Rolle bei der post-transkriptionalen Genregulation in Entwicklungsprozessen (Übersicht von Lorkovic, Trends in Plant Science, 2009 ), da sie an Spleißstellen binden und an Bindungsstellen für Spleißfaktoren auf naszierenden pre-mRNAs, die somit mit Spleißfaktoren um negatives Kontrollspleißen konkurrieren. Die meisten RBPs sind pflanzenspezifisch und können an pflanzenspezifischen Funktionen beteiligt sein. Die Gruppe der RBPs umfasst eine Superfamilie der Glycin-reichen RNA-bindenden Proteine ( GR-RBPs; Wang & Brendel, Genome Biol. 5, R102, 2004 ). GR-RBPs umfassen gewöhnlich RNA Erkennungsmotive (RRMs) am N-terminus und eine C-terminale Glycin-reiche Domäne (GD).The genome of Arabidopsis thaliana encodes more than 200 different RNA binding proteins (RBPs). These RBPs play a role in post-transcriptional gene regulation in developmental processes (reviewed by Lorkovic, Trends in Plant Science, 2009 ), because they bind to splice sites and to binding sites for splicing factors on nascent pre-mRNAs, thus competing with splice factors for negative control splicing. Most RBPs are plant-specific and may be involved in plant-specific functions. The group of RBPs comprises a superfamily of glycine-rich RNA-binding proteins ( GR-RBPs; Wang & Brendel, Genome Biol. 5, R102, 2004 ). GR-RBPs usually include RNA recognition motifs (RRMs) at the N-terminus and a C-terminal glycine-rich domain (GD).

Obgleich GR-RBPs Berichten zufolge an verschiedenen Entwicklungsprozessen beteiligt sind, einschließlich an der Adaptation von Pflanzen an verschiedene Umweltbedingungen, führte die Überexpression von GR-RBPs ebenfalls zu Nebenwirkungen in Bezug auf das Pflanzenwachstum: GR-RBP4 Expression in Arabidopsis verursachte beispielsweise eine verzögerte Keimung und steigerte nicht die Kälte- oder Gefriertoleranz ( Kwak et al. J. Exp. Bot. 56, 3007–3016, 2005 ). Für andere RBPs, wurde eine Wirkung auf den Kältestress oder Hochtemperaturstress nur in Mikroorganismen gezeigt ( Kwak et al. Nucl. Ac. Res. 35, 506–516, 2007 ; Sahi et al., Plant Science 173, 144–155, 2007 ).Although GR-RBPs are reported to be involved in several developmental processes, including adaptation of plants to various environmental conditions, overexpression of GR-RBPs has also resulted in plant growth side effects: for example, GR-RBP4 expression in Arabidopsis caused delayed germination and did not increase the freezing or freezing tolerance ( Kwak et al. J. Exp. Bot. 56, 3007-3016, 2005 ). For other RBPs, an effect on cold stress or high temperature stress was shown only in microorganisms ( Kwak et al. Nucl. Ac. Res. 35, 506-516, 2007 ; Sahi et al., Plant Science 173, 144-155, 2007 ).

ZusammenfassungSummary

1. C3H-ähnliche Polypeptide1. C3H-like polypeptides

Es wurde nun überraschend entdeckt, dass eine Modulation der Expression einer Nukleinsäure, die ein Polypeptid kodiert, das eine RING Domäne des C3H2C3-Typs umfasst, Pflanzen mit verbesserten Ertragsmerkmalen im Vergleich zu Kontrollpflanzen ergibt.It has now surprisingly been discovered that modulation of expression of a nucleic acid encoding a polypeptide comprising a C3H2C3-type RING domain yields plants with improved yield-related traits relative to control plants.

Gemäß einer Ausführungsform wird ein Verfahren zum Verbessern verschiedener Ertragsmerkmale im Vergleich zu Kontrollpflanzen bereitgestellt, umfassend das Modulieren der Expression einer Nukleinsäure, die ein C3H-ähnliches Polypeptid kodiert, in einer Pflanze.According to one embodiment, there is provided a method of enhancing various yield-related traits relative to control plants, comprising modulating the expression of a nucleic acid encoding a C3H-like polypeptide in a plant.

2. SPATULA-ähnliche (SPT) Polypeptide2. SPATULA-like (SPT) polypeptides

Es wurde nun überraschend entdeckt, dass eine Modulation der Expression einer Nukleinsäure, die ein SPT-Polypeptid kodiert, Pflanzen mit verbesserten Ertragsmerkmalen im Vergleich zu Kontrollpflanzen ergibt.It has now surprisingly been discovered that modulation of expression of a nucleic acid encoding an SPT polypeptide yields plants with improved yield-related traits relative to control plants.

Gemäß einer Ausführungsform wird ein Verfahren zum Verbessern von Ertragsmerkmalen im Vergleich zu Kontrollpflanzen bereitgestellt, umfassend das Modulieren der Expression einer Nukleinsäure, die ein SPT-ähnliches Polypeptid kodiert, in einer Pflanze.According to one embodiment, there is provided a method of enhancing yield-related traits relative to control plants comprising modulating expression in a plant of a nucleic acid encoding an SPT-like polypeptide.

3. IDI2 (Eisenmangel-induziert 2) Polypeptide3. IDI2 (iron deficiency-induced 2) polypeptides

Es wurde nun überraschend entdeckt, dass eine Modulation der Expression einer Nukleinsäure, die ein IDI2-Polypeptid kodiert, Pflanzen mit verbesserten Ertragsmerkmalen, insbesondere verbessertem Ertrag und/oder Jungpflanzenvitalität, im Vergleich zu Kontrollpflanzen ergibt.It has now surprisingly been discovered that modulation of the expression of a nucleic acid encoding an IDI2 polypeptide yields plants having improved yield-related traits, in particular improved yield and / or early vigor, compared to control plants.

Gemäß einer Ausführungsform wird ein Verfahren zum Verbessern von Ertragsmerkmalen einer Pflanze im Vergleich zu Kontrollpflanzen bereitgestellt, umfassend das Modulieren der Expression einer Nukleinsäure, die ein IDI2-ähnliches Polypeptid kodiert, in einer Pflanze. According to one embodiment, there is provided a method of enhancing yield-related traits of a plant relative to control plants, comprising modulating expression of a nucleic acid encoding an IDI2-like polypeptide in a plant.

4. eIF4F-ähnliche Proteinkomplex-Untereinheiten4. eIF4F-like protein complex subunits

Die vorliegende Erfindung betrifft im Allgemeinen das Gebiet der Molekularbiologie und befasst sich mit einem Verfahren zur Verbesserung von verschiedenen Wachstumseigenschaften durch Modulation der Aktivität eines eIF4F-ähnlichen Proteinkomplexes, in einer Pflanze. Die vorliegende Erfindung betrifft auch Pflanzen mit einer modulierten Aktivität eines eIF4F-ähnlichen Proteinkomplexes, wobei die Pflanzen verbesserte Wachstumseigenschaften im Vergleich zu entsprechenden Wildtyp-Pflanzen oder anderen Kontrollpflanzen aufweisen. Die Erfindung stellt auch Konstrukte bereit, die in den Verfahren der Erfindung von Nutzen sind.The present invention relates generally to the field of molecular biology and is directed to a method for improving various growth characteristics by modulating the activity of an eIF4F-like protein complex in a plant. The present invention also relates to plants having a modulated activity of an eIF4F-like protein complex, the plants having improved growth characteristics compared to corresponding wild-type plants or other control plants. The invention also provides constructs useful in the methods of the invention.

Es wurde nun überraschend entdeckt, dass eine Modulation der Aktivität eines eIF4F-ähnlichen Polypeptidkomplexes Pflanzen mit verbesserten Ertragsmerkmalen im Vergleich zu Kontrollpflanzen ergibt.It has now surprisingly been discovered that modulating the activity of an eIF4F-like polypeptide complex yields plants with improved yield-related traits relative to control plants.

Gemäß einer Ausführungsform wird ein Verfahren zum Verbessern von Ertragsmerkmalen einer Pflanze im Vergleich zu Kontrollpflanzen bereitgestellt, umfassend das Modulieren der Aktivität eines eIF4F-ähnlichen Polypeptidkomplexes in einer Pflanze.In one embodiment, there is provided a method of enhancing yield-related traits of a plant relative to control plants, comprising modulating the activity of an eIF4F-like polypeptide complex in a plant.

5. GR-RBP (Glycin-reiche-RNA bindendes Protein) Polypeptide5. GR-RBP (glycine rich RNA binding protein) polypeptides

Es wurde nun überraschend entdeckt, dass eine Modulation der Expression einer Nukleinsäure, die ein GR-RBP-Polypeptid kodiert, Pflanzen mit verbesserten Ertragsmerkmalen, insbesondere verbessertem Ertrag und/oder Jungpflanzenvitalität, im Vergleich zu Kontrollpflanzen ergibt.It has now surprisingly been discovered that modulation of the expression of a nucleic acid encoding a GR-RBP polypeptide yields plants having improved yield-related traits, in particular improved yield and / or early vigor, compared to control plants.

Gemäß einer Ausführungsform wird ein Verfahren zum Verbessern von Ertragsmerkmalen einer Pflanze im Vergleich zu Kontrollpflanzen bereitgestellt, umfassend das Modulieren der Expression einer Nukleinsäure, die ein GR-RBP Polypeptid kodiert, in einer Pflanze.In one embodiment, there is provided a method of enhancing yield-related traits of a plant relative to control plants, comprising modulating expression of a nucleic acid encoding a GR-RBP polypeptide in a plant.

Definitionendefinitions

Polypeptid(e)/Protein(e)Polypeptide (s) / protein (s)

Die Begriffe ”Polypeptid” und ”Protein” werden im vorliegenden Text austauschbar eingesetzt und beziehen sich auf Aminosäuren in polymerer Form mit beliebiger Länge, welche über Peptidbindungen miteinander verbunden sind.The terms "polypeptide" and "protein" are used interchangeably herein to refer to amino acids in polymeric form of any length which are linked by peptide bonds.

Polynukleotid(e)/Nukleinsäure(n)/Nukleinsäuresequenz(en)/Nukleotidsequenz(en)Polynucleotide (s) / nucleic acid (s) / Nucleic acid sequence (s) / nucleotide sequence (s)

Die Begriffe ”Polynukleotid(e)”, ”Nukleinsäuresequenz(en)”, ”Nukleotidsequenz(en)”, ”Nukleinsäure(n)”, ”Nukleinsäuremolekül” werden im vorliegenden Text austauschbar eingesetzt und beziehen sich auf Nukleotide, und zwar entweder Ribonukleotide oder Desoxyribonukleotide oder eine Kombination von beiden, in einer polymeren unverzweigten Form mit einer beliebigen Länge.The terms "polynucleotide (s)", "nucleic acid sequence (s)", "nucleotide sequence (s)", "nucleic acid (s)", "nucleic acid molecule" are used interchangeably herein and refer to nucleotides, either ribonucleotides or Deoxyribonucleotides, or a combination of both, in a polymeric unbranched form of any length.

Homologon/HomologaHomologue / homologues

”Homologa” eines Proteins umfassen Peptide, Oligopeptide, Polypeptide, Proteine und Enzyme mit Aminosäuresubstitutionen, -deletionen und/oder -insertionen im Vergleich zu dem jeweiligen nichtmodifizierten Protein, sie weisen eine ähnliche biologische und funktionelle Aktivität wie das nichtmodifizierte Protein, von dem sie abstammen, auf."Homologs" of a protein include peptides, oligopeptides, polypeptides, proteins, and enzymes having amino acid substitutions, deletions, and / or insertions relative to the respective unmodified protein, having similar biological and functional activity to the unmodified protein from which they are derived , on.

Eine Deletion bezieht sich auf die Entfernung von einer oder mehreren Aminosäuren aus einem Protein.A deletion refers to the removal of one or more amino acids from a protein.

Eine Insertion bezieht sich auf einen oder mehrere Aminosäurereste, die in eine vorbestimmte Stelle in ein Protein eingeführt werden. Insertionen können N-terminale und/oder C-terminale Fusionen sowie Insertionen von einzelnen oder multiplen Aminosäuren in eine Sequenz hinein umfassen. Im Allgemeinen sind Insertionen innerhalb der Aminosäuresequenz kleiner als N- oder C-terminale Fusionen, und zwar in einer Größenordnung von ungefähr 1 bis 10 Resten. Zu Beispielen für N- oder C-terminale Fusionsproteine oder -peptide gehören die Bindungsdomäne oder Aktivierungsdomäne eines Transkriptionsaktivators, wie er im Hefe-Zwei-Hybrid-System verwendet wird, Phagen-Hüllproteine, (Histidin)-6-Tag, Glutathion-S-Transferase-Tag, Protein A, Maltose-Bindungsprotein, Dihydrofolatreduktase, Tag-100-Epitop, c-myc-Epitop, FLAG^®-Epitop, IacZ, CMP (Calmodulin-bindendes Peptid), HA-Epitop, Protein-C-Epitop und VSV-Epitop.An insertion refers to one or more amino acid residues introduced into a predetermined site in a protein. Insertions may include N-terminal and / or C-terminal fusions as well as insertions of single or multiple amino acids into a sequence. In general, insertions within the amino acid sequence are smaller than N- or C-terminal fusions, on the order of about 1 to 10 residues. Examples of N- or C-terminal fusion proteins or peptides include the binding domain or activation domain of a transcriptional activator, as used in yeast two- Hybrid system used, phage coat proteins, (histidine) 6-day, glutathione-S-transferase tag, protein A, maltose-binding protein, dihydrofolate reductase, tag 100 epitope, c-myc epitope, FLAG ^® - Epitope, lacZ, CMP (calmodulin-binding peptide), HA epitope, protein C epitope and VSV epitope.

Eine Substitution bezieht sich auf den Austausch von Aminosäuren des Proteins durch andere Aminosäuren mit ähnlichen Eigenschaften (wie ähnlicher Hydrophobie, Hydrophilie, Antigenität, Neigung zur Bildung oder zum Bruch von α-Helixstrukturen oder β-Faltblattstrukturen). Aminosäuresubstitutionen sind typischerweise solche von einzelnen Resten, sie können jedoch je nach den funktionellen Zwängen, die dem Polypeptid auferlegt werden, in Form von Clustern vorliegen und können von 1 bis 10 Aminosäuren reichen; Insertionen liegen üblicherweise in der Größenordnung von ungefähr 1 bis 10 Aminosäureresten vor. Bei den Aminosäuresubstitutionen handelt es sich vorzugsweise um konservative Aminosäuresubstitutionen. Konservative Substitutionstabellen sind dem Fachmann bestens bekannt (siehe zum Beispiel Creighton (1984), Proteins. W. H. Freeman and Company(Hrsg.) und Tabelle 1 unten). Tabelle 1: Beispiele für konservierte Aminosäuresubstitutionen Rest konservative Substitutionen Rest konservative Substitutionen Ala Ser Leu Ile; Val Arg Lys Lys Arg; Gin Asn Gln; His Met Leu; Ile Asp Glu Phe Met; Leu; Tyr Gln Asn Ser Thr; Gly Cys Ser Thr Ser; Val Glu Asp Trp Tyr Gly Pro Tyr Trp; Phe His Asn; Gln Val Ile; Leu Ile Leu, Val Substitution refers to the replacement of amino acids of the protein with other amino acids having similar properties (such as similar hydrophobicity, hydrophilicity, antigenicity, tendency to form or break α-helix structures or β-sheet structures). Amino acid substitutions are typically those of single residues, however, depending on the functional constraints imposed on the polypeptide, they may be in the form of clusters and may range from 1 to 10 amino acids; Insertions are usually on the order of about 1 to 10 amino acid residues. The amino acid substitutions are preferably conservative amino acid substitutions. Conservative substitution tables are well known to those skilled in the art (see for example Creighton (1984), Proteins. WH Freeman and Company (ed.) and Table 1 below). Table 1: Examples of conserved amino acid substitutions rest conservative substitutions rest conservative substitutions Ala Ser Leu Ile; Val bad Lys Lys Arg; gin Asn Gln; His mead Leu; Ile Asp Glu Phe Met; Leu; Tyr Gln Asn Ser Thr; Gly Cys Ser Thr Ser; Val Glu Asp Trp Tyr Gly Per Tyr Trp; Phe His Asn; Gln Val Ile; Leu Ile Leu, Val

Aminosäuresubstitutionen, -deletionen und/oder -insertionen lassen sich leicht mit Hilfe von dem Fachmann bekannten Peptidsynthese-Techniken, wie Festphasen-Peptidsynthese und dergleichen, oder durch rekombinante DNA-Manipulation, herstellen. Verfahren für die Manipulation von DNA-Sequenzen zur Herstellung von Substitutions-, Insertions- oder Deletionsvarianten eines Proteins sind im Stand der Technik bestens bekannt. So kennt der Fachmann zum Beispiel Techniken zur Herstellung von Substitutionsmutationen an vorbestimmten Stellen in DNA; wozu M13-Mutagenese, T7-Gen-in-vitro-Mutagenese (USB, Cleveland, OH), QuickChange ortsgerichtete Mutagenese (Stratagene, San Diego, CA), PCR-vermittelte ortsgerichtete Mutagenese oder andere Protokolle für die ortsgerichtete Mutagenese gehören.Amino acid substitutions, deletions, and / or insertions are readily prepared by peptide synthesis techniques known to those skilled in the art, such as solid phase peptide synthesis and the like, or by recombinant DNA manipulation. Methods for the manipulation of DNA sequences for the production of substitution, insertion or deletion variants of a protein are well known in the art. For example, those skilled in the art will recognize techniques for making substitution mutations at predetermined sites in DNA; including M13 mutagenesis, T7 gene in vitro mutagenesis (USB, Cleveland, OH), QuickChange site-directed mutagenesis (Stratagene, San Diego, CA), PCR-mediated site-directed mutagenesis, or other site-directed mutagenesis protocols.

Derivatederivatives

”Derivate” beinhalten Peptide, Oligopeptide, Polypeptide, die im Vergleich zu der Aminosäuresequenz der natürlich vorkommenden Form des Proteins, wie das interessierende Protein, Substitutionen von Aminosäuren durch nicht natürlich vorkommende Aminosäurereste oder Additionen von nicht natürlich vorkommenden Aminosäureresten umfassen. ”Derivate” eines Proteins umfassen auch Peptide, Oligopeptide, Polypeptide, die natürlich vorkommende veränderte (glykosylierte, acylierte, prenylierte, phosphorylierte, myristoylierte, sulfatierte usw.) oder nicht natürlich veränderte Aminosäurereste im Vergleich zu der Aminosäuresequenz einer natürlich vorkommenden Form des Polypeptids umfassen. Ein Derivat kann auch eine(n) oder mehrere Nicht-Aminosäure-Substituenten oder Additionen im Vergleich zu der Aminosäuresequenz, von der es abstammt, umfassen, zum Beispiel ein Reportermolekül oder einen anderen Liganden, das bzw. der kovalent oder nichtkovalent an die Aminosäuresequenz gebunden ist, wie ein Reportermolekül, das gebunden ist, damit es leichter nachgewiesen werden kann, und nicht natürlich vorkommende Aminosäurereste im Vergleich zu der Aminosäuresequenz eines natürlich vorkommenden Proteins. ”Derivate” umfassen darüber hinaus auch Fusionen der natürlich vorkommenden Form des Proteins mit Tagging-Peptiden, wie FLAG, HIS6 oder Thioredoxin (für einen Überblick über Tagging-Peptide, siehe Terpe, Appl. Microbiol. Biotechnol. 60, 523–533, 2003 )."Derivatives" include peptides, oligopeptides, polypeptides that comprise substitutions of amino acids by non-naturally occurring amino acid residues or additions of non-naturally occurring amino acid residues as compared to the amino acid sequence of the naturally occurring form of the protein, such as the protein of interest. "Derivatives" of a protein also include peptides, oligopeptides, polypeptides that include naturally occurring altered (glycosylated, acylated, prenylated, phosphorylated, myristoylated, sulfated, etc.) or unnaturally altered amino acid residues as compared to the amino acid sequence of a naturally occurring form of the polypeptide. A derivative may also comprise one or more non-amino acid substituents or additions relative to the amino acid sequence from which it is derived, for example, a reporter molecule or other ligand which is covalently or non-covalently linked to the amino acid sequence such as a reporter molecule that is bound to be more easily detected and non-naturally occurring amino acid residues compared to the amino acid sequence of a naturally occurring protein. "Derivatives" also include fusions of the naturally occurring form of the protein with tagging peptides such as FLAG, HIS6 or thioredoxin (for a review of tagging peptides, see Terpe, Appl. Microbiol. Biotechnol. 60, 523-533, 2003 ).

Ortholog(a)/Paralog(a) Ortholog (a) / paralogue (a)

Orthologa und Paraloga umfassen Evolutionskonzepte, mit denen die Stammbeziehungen von Genen beschrieben werden. Paraloga sind Gene innerhalb derselben Art, die durch Duplikation eines Urgens entstanden sind, und Orthologa sind Gene von unterschiedlichen Organismen, die durch Artbildung entstanden sind, und die auch von einem gemeinsamen Urgen abstammen.Orthologa and paralogues include evolutionary concepts that describe the lineage relationships of genes. Paralogues are genes within the same species that have arisen through duplication of a primordial gene, and orthologues are genes of distinct organisms that have arisen through speciation and that are also descended from a common ancestor.

Domäne, Motiv/Konsensussequenz/SinaturDomain, motif / consensus sequence / Sinatur

Der Begriff ”Domäne” steht für einen Satz von Aminosäuren, die an spezifischen Positionen entlang eines Alignments von Sequenzen von evolutionsmäßig verwandten Proteinen konserviert sind. Während Aminosäuren an anderen Positionen zwischen Homologa variieren können, zeigen Aminosäuren, die an spezifischen Positionen stark konserviert sind, Aminosäuren an, die wahrscheinlich für die Struktur, Stabilität oder Funktion eines Proteins essentiell sind. Sie werden durch ihren hohen Konservierungsgrad in als Alignment dargestellten Sequenzen einer Familie von Proteinhomologa identifiziert und können als identifikatoren verwendet werden, um zu bestimmen, ob ein bestimmtes Polypeptid zu einer bereits identifizierten Polypeptidfamilie gehört.The term "domain" means a set of amino acids conserved at specific positions along an alignment of sequences of evolutionarily related proteins. While amino acids may vary at other positions between homologs, amino acids that are highly conserved at specific positions indicate amino acids that are likely to be essential for the structure, stability or function of a protein. They are identified by their high degree of conservation in aligned sequences of a family of protein homologs and can be used as identifiers to determine if a particular polypeptide belongs to an already identified polypeptide family.

Der Begriff ”Motiv” oder ”Konsensussequenz” oder ”Signatur” steht für eine kurze konservierte Region in der Sequenz von evolutionsmäßig verwandten Proteinen. Bei Motiven handelt es sich häufig um hochkonservierte Teile von Domänen, sie können jedoch auch nur einen Teil der Domäne beinhalten oder außerhalb einer konservierten Domäne lokalisiert sein (wenn alle Aminosäuren des Motivs außerhalb einer definierten Domäne liegen).The term "motif" or "consensus sequence" or "signature" stands for a short conserved region in the sequence of evolutionarily related proteins. Motifs are often highly conserved parts of domains, but they can also contain only part of the domain or be located outside a conserved domain (if all amino acids of the motif are outside a defined domain).

Für die Identifikation von Domänen gibt es Spezialdatenbanken, zum Beispiel SMART ( Schultz et al. (1998), Proc. Natl. Acad. Sci. USA 95, 5857–5864 ; Letunic et al., (2002), Nucleic Acids Res. 30, 242–244 , InterPro ( Mulder et al., (2003), Nucl. Acids Res. 31, 315–318 , Prosite ( Bucher und Bairoch (1994), A generalized profile syntax for biomolecular sequences Motivs und its function in automatic sequence interpretation. (In) ISMB-94 ; Proceedings 2nd International Conference on Intelligent Systems for Molecular Biology. Altman R., Brutlag D., Karp P., Lathrop R., Searls D., Hrsg., S. 53–61, AAAIPress, Menlo Park ; Hub et al., Nucl. Acids Res. 32: D134–D137, (2004) , oder Pfam ( Bateman et al., Nucleic Acids Research 30(1): 276–280 (2002) . Ein Satz Werkzeuge für die In-silico-Analyse von Proteinsequenzen findet sich auf dem ExPASY-Proteomics-Server (Swiss Institute of Bioinformatics ( Gasteiger et al., ExPASy: the proteomics server for in-depth protein knowledge and analysis, Nucleic Acids Res. 31: 3784–3788 (2003) ). Domänen oder Motive können auch unter Verwendung von Routinetechniken, wie Sequenz-Alignment, identifiziert werden.For the identification of domains there are special databases, for example SMART ( Schultz et al. (1998), Proc. Natl. Acad. Sci. USA 95, 5857-5864 ; Letunic et al., (2002) Nucleic Acids Res. 30, 242-244 , InterPro ( Mulder et al., (2003), Nucl. Acids Res. 31, 315-318 , Prosite ( Bucher and Bairoch (1994), A generalized profile syntax for biomolecular sequences motifs and their function in automatic sequence interpretation. (In) ISMB-94 ; Proceedings 2nd International Conference on Intelligent Systems for Molecular Biology. Altman R., Brutlag D., Karp P., Lathrop R., Searls D., eds, pp. 53-61, AAAIPress, Menlo Park ; Hub et al., Nucl. Acids Res. 32: D134-D137, (2004) , or Pfam ( Bateman et al., Nucleic Acids Research 30 (1): 276-280 (2002) , A set of tools for in silico analysis of protein sequences can be found on the ExPASY Proteomics server (Swiss Institute of Bioinformatics ( Gasteiger et al., ExPASy: the proteomics server for in-depth protein knowledge and analysis, Nucleic Acids Res. 31: 3784-3788 (2003) ). Domains or motifs can also be identified using routine techniques such as sequence alignment.

Verfahren für das Alignment von Sequenzen für Vergleichszwecke sind in der Fachwelt gut bekannt, dazu zählen GAP, BESTFIT, BLAST, FASTA und TFASTA. Bei GAP wird der Algorithmus von Needleman und Wunsch ((1970), J. Mol. Biol. 48: 443–453) verwendet, um das globale Alignment (d. h. das Alignment, das sich über die vollständigen Sequenzen erstreckt) von zwei Sequenzen zu finden, das die Anzahl der ”matches” maximiert und die Anzahl der ”gaps” minimiert. Beim BLAST-Algorithmus ( Altschul et al., (1990), J. Mol. Biol. 215: 403–10 ) wird die Sequenzidentität in Prozent berechnet, und es wird eine statistische Analyse der Ähnlichkeit zwischen den beiden Sequenzen durchgeführt. Die Software für die Durchführung einer BLAST-Analyse ist der Öffentlichkeit über das National Centre for Biotechnology Information (NCBI) zugänglich. Homologa können leicht unter Verwendung von zum Beispiel dem multiplen Sequenz-Alignment-Algorithmus ClustalW (Version 1.83) identifiziert werden, und zwar mit den Default-Parametern für paarweises Alignment und einer Scoring-Methode in Prozent. Die Gesamtprozentsätze der Ähnlichkeit und der Identität können auch unter Verwendung von einer der in dem MatGAT-Software-Paket verfügbaren Methoden bestimmt werden ( Campanella et al., BMC Bioinformatics. 2003, Juli, 10;4: 29. MatGAT: an application that generates similarity/identity matrices using protein or DNA sequences ). Für eine Optimierung des Alignments zwischen konservierten Motiven können, wie es dem Fachmann ersichtlich wird, kleine manuelle Veränderungen vorgenommen werden. Darüber hinaus können statt Volllängensequenzen für die Identifikation von Homologa auch spezifische Domänen verwendet werden. Die Sequenzidentitätswerte können mit den oben erwähnten Programmen unter Einstellung der Default-Parameter über die gesamte Nukleinsäure- oder Aminosäuresequenz oder über ausgewählte Domänen oder konservierte Motiv(e) bestimmt werden. Für lokale Alignments ist der Smith-Waterman-Algorithmus besonders geeignet ( Smith TF, Waterman MS (1981) J. Mol. Biol 147(1); 195–7 ).Methods for aligning sequences for comparison purposes are well known in the art, including GAP, BESTFIT, BLAST, FASTA, and TFASTA. For GAP, the algorithm of Needleman and Wunsch ((1970), J. Mol. Biol. 48: 443-453) is used to find the global alignment (ie, the alignment that spans the complete sequences) of two sequences that maximizes the number of matches and minimizes the number of gaps. In the BLAST algorithm ( Altschul et al., (1990), J. Mol. Biol. 215: 403-10 ) the sequence identity is calculated in percent and a statistical analysis of the similarity between the two sequences is made. The software for performing a BLAST analysis is available to the public via the National Center for Biotechnology Information (NCBI). Homologs can be easily identified using, for example, the multiple sequence alignment algorithm ClustalW (version 1.83), with the default parameters for pairwise alignment and a scoring method in percent. The total percentages of similarity and identity may also be determined using one of the methods available in the MatGAT software package ( Campanella et al., BMC Bioinformatics. 2003, July, 10; 4: 29. MatGAT: an application that generates similarity / identity matrices using protein or DNA sequences ). As will be apparent to those skilled in the art, small manual changes can be made to optimize alignment between preserved subjects. In addition, specific domains can be used instead of full-length sequences for the identification of homologs. The sequence identity values can be determined with the above-mentioned programs setting the default parameters throughout the nucleic acid or amino acid sequence or over selected domains or conserved motif (s). For local alignments, the Smith-Waterman algorithm is particularly suitable ( Smith TF, Waterman MS (1981) J. Mol. Biol. 147 (1); 195-7 ).

Reziproker BLASTReciprocal BLAST

Dies beinhaltet üblicherweise einen ersten BLAST, bei der mit einer Abfragesequenz ein ”Blasting” gegen eine beliebige Sequenzdatenbank (beispielsweise. mit irgend einer der in Tabelle A des Beispielteils aufgeführten Sequenzen), wie die öffentlich zugängliche NCBI-Datenbank, durchgeführt wird. Man benutzt im Allgemeinen BLASTN oder TBLASTX (unter Verwendung standardmäßiger Vorgabewerte), wenn von einer Nukleotidsequenz aus begonnen wird, und BLASTP oder TBLASTN (unter Verwendung standardmäßiger Vorgabewerte), wenn von einer Proteinsequenz aus begonnen wird. Die BLAST-Ergebnisse können gegebenenfalls gefiltert werden. Die Volllängensequenzen entweder der gefilterten Ergebnisse oder der nicht-gefilterten Ergebnisse werden dann (zweiter BLAST) gegen Sequenzen aus dem Organismus, aus dem die Suchsequenz abgeleitet ist, zurück geBLASTet. Die Ergebnisse der ersten und zweiten BLASTs werden dann verglichen. Ein Paralogon wird identifiziert, wenn ein hoch eingestufter Hit aus dem ersten Blast von derselben Spezies stammt, wie jene, aus der die Suchsequenz abgeleitet ist, wobei ein zurückgerichteter BLAST danach idealerweise dazu führt, dass die Suchsequenz zu den höchsten Hits zählt; ein Orthologon wird identifiziert, wenn ein hoch eingestufter Treffer im ersten BLAST nicht aus derselben Spezies stammt, wie jene, aus der die Suchsequenz abgeleitet ist, und bei zurückgerichtetem BLAST vorzugsweise dazu führt, dass die Suchsequenz zu den höchsten Treffern zählt.This usually involves a first BLAST in which a query sequence "blasts" against any sequence database (for example, any of the ones in Table A of the Examples section listed sequences), such as the publicly accessible NCBI database. Generally, BLASTN or TBLASTX (using standard default values) is used when starting from a nucleotide sequence, and BLASTP or TBLASTN (using standard default values) when starting from a protein sequence. If necessary, the BLAST results can be filtered. The full length sequences of either the filtered results or the unfiltered results are then BLADED back (second BLAST) against sequences from the organism from which the search sequence is derived. The results of the first and second BLASTs are then compared. A paralogue is identified when a high ranking hit from the first blast originates from the same species as that from which the search sequence is derived, with a returned BLAST thereafter ideally resulting in the search sequence being among the highest hits; an orthologon is identified when a high ranking hit in the first BLAST does not come from the same species as that from which the search sequence is derived, and when BLAST is returned, preferably results in the search sequence counting to the highest hits.

Hoch eingestufte Hits sind diejenigen mit einem niedrigen E-Wert. Je niedriger der E-Wert, umso signifikanter die Wertung (oder in anderen Worten, umso niedriger die Wahrscheinlichkeit, dass der Treffer durch Zufall gefunden wurde). Wie man den E-Wert berechnet, ist im Stand der Technik bekannt. Zusätzlich zu E-Werten werden Vergleiche auch durch den Prozentsatz der Identität bewertet. Der Prozentsatz der Identität bezieht sich auf die Zahl an identischen Nukleotiden (oder Aminosäuren) zwischen den zwei verglichenen Nukleinsäure-(oder Polypeptid-)Sequenzen über eine bestimmte Länge hinweg. Im Fall von großen Familien kann ClustalW eingesetzt werden, gefolgt von einem Nachbarkopplungs- bzw. ”Neighbour joining”-Baum, um bei der Visualisierung der Einordnung bzw. Clusterung verwandter Gene zu helfen und Orthologa und Paraloga zu identifizieren.High rated hits are those with a low E value. The lower the E value, the more significant the score (or in other words, the lower the probability that the hit was found by chance). How to calculate the E value is known in the art. In addition to e-values, comparisons are also evaluated by the percentage of identity. Percent identity refers to the number of identical nucleotides (or amino acids) between the two compared nucleic acid (or polypeptide) sequences over a particular length. In the case of large families, ClustalW can be used, followed by a neighbor-joining tree to help visualize the clustering of related genes and to identify orthologs and paralogues.

Hybridisierunghybridization

Der Begriff ”Hybridisierung” ist wie hier definiert ein Vorgang, bei dem im Wesentlichen homologe komplementäre Nukleotidsequenzen aneinander annealen. Der Hybridisierungsvorgang kann vollständig in Lösung stattfinden, d. h. beide komplementären Nukleinsäuren liegen in Lösung vor. Der Hybridisierungsvorgang kann auch stattfinden, wenn eine der komplementären Nukleinsäuren auf einer Matrix, wie magnetischen Kügelchen, Sepharose-Kügelchen oder einem anderen Harz immobilisiert ist. Der Hybridisierungsvorgang kann außerdem stattfinden, wenn eine der komplementären Nukleinsäuren an einen festen Träger, wie eine Nitrozellulose- oder Nylonmembran; immobilisiert ist oder mittels z. B. Photolithographie auf z. B. einen Quarzglasträger immobilisiert ist (wobei letzteres als Nukleinsäure-Arrays oder ”micorarrays” oder Nukleinsäure-Chips bekannt ist). Die Nukleinsäuremoleküle werden im Allgemeinen thermisch oder chemisch denaturiert, um einen Doppelstrang zu zwei Einzelsträngen aufzuschmelzen und/oder um ”hairpins” oder andere Sekundärstrukturen aus einzelsträngigen Nukleinsäuren zu entfernen, so dass die Hybridisierung stattfinden kann.The term "hybridization" as defined herein is a process in which substantially homologous complementary nucleotide sequences anneal to each other. The hybridization process can take place completely in solution, i. H. both complementary nucleic acids are in solution. The hybridization process may also take place when one of the complementary nucleic acids is immobilized on a matrix such as magnetic beads, Sepharose beads, or another resin. The hybridization process may also take place when one of the complementary nucleic acids binds to a solid support, such as a nitrocellulose or nylon membrane; is immobilized or by means of z. B. photolithography on z. B. a silica glass carrier is immobilized (the latter is known as nucleic acid arrays or "micorarrays" or nucleic acid chips). The nucleic acid molecules are generally thermally or chemically denatured to fuse a duplex into two single strands and / or to remove hairpins or other secondary structures from single-stranded nucleic acids so that hybridization can occur.

Der Begriff ”Stringenz” steht für diejenigen Bedingungen, unter denen eine Hybridisierung stattfindet. Die Stringenz der Hybridisierung wird durch Bedingungen, wie Temperatur, Salzkonzentration, Ilonenstärke und Zusammensetzung des Hybridisierungspuffers beeinflusst. Im Allgemeinen werden niedrige Stringenzbedingungen so gewählt, dass sie ungefähr 30°C niedriger sind als die Schmelztemperatur (T_m) für die spezifische Sequenz bei einer definierten Ionenstärke und einem definierten pH-Wert. Mittlere Stringenzbedingungen liegen dann vor, wenn die Temperatur 20°C unter T_m liegt, und hohe Stringenzbedingungen dann, wenn die Temperatur 10°C unter T_m liegt. Hochstringente Hybridisierungsbedingungen werden gewöhnlich zur Isolation von hybridisierenden Sequenzen, die eine hohe Sequenzähnlichkeit zur Zielnukleinsäuresequenz aufweisen, eingesetzt. Die Sequenzen der Nukleinsäuren können jedoch aufgrund der Degeneration des genetischen Codes voneinander abweichen, und dennoch kodieren die Nukleinsäuren ein im Wesentlichen identisches Polypeptid. Zum Identifizieren von solchen Nukleinsäuremolekülen können daher manchmal Hybridisierungsbedingungen mit mittlerer Stringenz erforderlich sein.The term "stringency" refers to those conditions under which hybridization occurs. The stringency of hybridization is affected by conditions such as temperature, salt concentration, ionic strength, and composition of the hybridization buffer. Generally, low stringency conditions are chosen to be about 30 ° C lower than the melting temperature (T _m ) for the specific sequence at a defined ionic strength and pH. Medium stringency conditions are when the temperature is 20 ° C below T _m and high stringency conditions when the temperature is 10 ° C below T _m . High stringency hybridization conditions are commonly used to isolate hybridizing sequences that have high sequence similarity to the target nucleic acid sequence. However, the sequences of the nucleic acids may differ due to the degeneracy of the genetic code, and yet the nucleic acids encode a substantially identical polypeptide. Therefore, hybridization conditions of intermediate stringency may sometimes be required to identify such nucleic acid molecules.

Bei dem T_m-Wert handelt es sich um diejenige Temperatur bei definierter Ionenstärke und definiertem pH-Wert, bei der 50% der Zielsequenz mit einer perfekt passenden Sonde hybridisiert. Der T_m-Wert hängt von den Lösungsbedingungen und der Rasenzusammensetzung und der Länge der Sonde ab. Längere Sequenzen hybridisieren zum Beispiel spezifisch bei höheren Temperaturen. Die maximale Hybridisierungsrate wird bei 16°C bis 32°C unter dem T_m-Wert erzielt Das Vorliegen von einwertigen Kationen in der Hybridisierungslösung reduziert die elektrostatische Abstoßung zwischen den beiden Nukleinsäuresträngen und fördert so die Hybridbildung; dieser Effekt wird für Natriumkonzentrationen von bis zu 0,4 M beobachtet (bei höheren Konzentrationen kann dieser Effekt außer Acht gelassen werden). Formamid verringert die Schmelztemperatur von DNA-DNA- und DNA-RNA-Doppelsträngen mit 0,6 bis 0,7°C pro Prozent Formamid, und die Zugabe von 50% Formamid ermöglicht eine Hybridisierung bei 30 bis 45°C, obwohl die Hybridisierungsrate gesenkt wird. Basenpaar-Fehlpaarungen verringern die Hybridisierungsrate und die Hitzestabilität der Doppelstränge. Durchschnittlich, und für lange Sonden sinkt der T_m-Wert um ungefähr 1°C pro Prozent Basen-Fehlpaarung. Der T_m-Wert kann je nach der Art der Hybride mit den folgenden Gleichungen berechnet werden:

• 1) DNA-DNA-Hybride ( Meinkoth und Wahl, Anal. Biochem., 138: 267–284, 1984 ): T_m = 81,5°C + 16,6 × log₁₀[Na⁺]^a + 0,41 × %[G/C^b] – 500 × [L^c]^–1 – 0,61 × % Formamid
• 2) DNA-RNA- oder RNA-RNA-Hybride: Tm = 79,8 + 18,5 (log₁₀[Na⁺]^a) + 0,58 (%G/C^b) + 11,8 (%G/C^b)² – 820/L^c
• 3) oligo-DNA- oder oligo-RNA^d-Hybride: Für < 20 Nukleotide: T_m = 2 (l_n) Für 20–35 Nukleotide: T_m = 22 + 1,46 (l_n) ^a oder für ein anderes einwertiges Kation, jedoch nur im Bereich von 0,01–0,4 M genau. ^b nur für %GC im Bereich von 30% bis 75% genau. ^c L = Länge des Doppelstrangs in Basenpaaren. ^d oligo, Oligonukleotid; l_n, effektive Länge des Primers = 2 × (Anz. G/C) + (Anz. A/T).

• 1) DNA-DNA hybrids ( Meinkoth and Wahl, anal. Biochem., 138: 267-284, 1984 ): T _m = 81.5 ° C + 16.6 × log ₁₀ [Na ⁺ ] ^a + 0.41 ×% [G / C ^b ] - 500 × [L ^c ] ^-1 - 0.61 ×% formamide
• 2) DNA-RNA or RNA-RNA hybrids: Tm = 79.8 + 18.5 (log ₁₀ [Na ⁺ ] ^a ) + 0.58 (% G / C ^b ) + 11.8 (% G / ^Cb ) ² - 820 / L ^c
• 3) oligo-DNA or oligo RNA ^d hybrids: For <20 nucleotides: T _m = 2 (l _n ) For 20-35 nucleotides: T _m = 22 + 1.46 (l _n ) ^a or for another monovalent cation, but only in the range of 0.01-0.4 M. ^b only for% GC in the range of 30% to 75% accurate. ^c L = length of the double strand in base pairs. ^d oligo, oligonucleotide; l _n , effective length of the primer = 2 × (number G / C) + (number A / T).

Eine unspezifische Bindung kann dadurch bekämpft werden, dass man eine von mehreren bekannten Techniken einsetzt, wie zum Beispiel Blockieren der Membran mit proteinhaltigen Lösungen, Zusätze von heterologer RNA, DNA und SDS zum Hybridisierungspuffer und Behandlung mit RNase. Für nichthomologe Sonden können eine Reihe von Hybridisierungen durchgeführt werden, und zwar dadurch, dass man entweder (i) die Anlagerungstemperatur nach und nach senkt (zum Beispiel von 68°C auf 42°C) oder (ii) dass man die Formamidkonzentration nach und nach senkt (zum Beispiel von 50% auf 0%). Der Fachmann ist mit verschiedenen Parametern vertraut, die während der Hybridisierung verändert werden können und die die Stringenzbedingungen entweder aufrechterhalten oder verändern.Non-specific binding can be controlled by employing one of several known techniques, such as blocking the membrane with proteinaceous solutions, adding heterologous RNA, DNA and SDS to the hybridization buffer, and treating with RNase. For non-homologous probes, a series of hybridizations can be performed by either (i) gradually lowering the annealing temperature (for example, from 68 ° C to 42 ° C) or (ii) gradually increasing the formamide concentration lowers (for example from 50% to 0%). Those skilled in the art will be familiar with various parameters that can be changed during hybridization and that either maintain or alter stringency conditions.

Neben den Hybridisierungsbedingungen hängt die Spezifität der Hybridisierung gewöhnlich auch von der Funktion der Waschvorgänge nach der Hybridisierung ab. Um einen Hintergrund, der durch unspezifische Hybridisierung entsteht, zu entfernen, werden die Proben mit verdünnten Salzlösungen gewaschen. Zu entscheidenden Faktoren solcher Waschvorgänge gehören die Ionenstärke und Temperatur der letzten Waschlösung: Je niedriger die Salzkonzentration und je höher die Waschtemperatur ist, desto höher ist die Stringenz des Waschvorgangs. Die Waschbedingungen werden gewöhnlich bei oder unter Hybridisierungsstringenz durchgeführt. Eine positive Hybridisierung ergibt ein Signal, das mindestens zweimal so stark wie der Hintergrund ist. Im Allgemeinen sind geeignete Stringenzbedingungen für Nukleinsäurehybridisierungs-Assays oder Genamplifizierungsnachweisverfahren wie oben dargestellt. Es können auch Bedingungen höherer oder niedrigerer Stringenz ausgewählt werden. Dem Fachmann sind die verschiedenen Parameter geläufig, die während des Waschens verändert werden können und die die Stringenzbedingungen entweder aufrechterhalten oder verändern.In addition to the hybridization conditions, the specificity of hybridization usually also depends on the function of the washes after hybridization. To remove a background caused by nonspecific hybridization, the samples are washed with dilute saline solutions. Key factors in such washes include the ionic strength and temperature of the final wash solution: the lower the salt concentration and the higher the wash temperature, the higher the stringency of the wash. The washing conditions are usually performed at or below hybridization stringency. Positive hybridization gives a signal that is at least twice as strong as the background. In general, suitable stringency conditions for nucleic acid hybridization assays or gene amplification detection methods are as set forth above. It is also possible to select conditions of higher or lower stringency. Those skilled in the art will appreciate the various parameters that can be changed during washing and that either maintain or alter the stringency conditions.

Übliche hochstringente Hybridisierungsbedingungen für DNA-Hybride, die länger als 50 Nukleotide sind, umfassen zum Beispiel die Hybridisierung bei 65°C in 1 × SSC oder bei 42°C in 1 × SSC und 50% Formamid, wonach Waschen bei 65°C in 0,3 × SSC erfolgt. Beispiele für Hybridisierungsbedingungen mittlerer Stringenz für DNA-Hybride, die länger als 50 Nukleotide sind, umfassen Hybridisierung bei 50°C in 4 × SSC oder bei 40°C in 6 × SSC und 50% Formamid, und anschließendes Waschen bei 50°C in 2 × SSC. Die Länge des Hybrids ist die erwartete Länge für die hybridisierende Nukleinsäure. Werden Nukleinsäuren mit einer bekannten Sequenz hybridisiert, kann die Hybridlänge dadurch bestimmt werden, dass man mit den Sequenzen ein Alignment durchführt und die darin beschriebenen konservierten Regionen identifiziert. 1 × SSC ist 0,15 M NaCl und 15 mM Natriumcitrat; die Hybridisierungslösung und die Waschlösungen können zusätzlich 5 × Denhardt-Reagens, 0,5–1,0% SDS, 100 μg/ml denaturierte, fragmentierte Lachssperma-DNA und 0,5% Natriumpyrophosphat beinhalten.Common high stringency hybridization conditions for DNA hybrids longer than 50 nucleotides include, for example, hybridization at 65 ° C in 1 x SSC or at 42 ° C in 1 x SSC and 50% formamide, followed by washing at 0 ° C at 65 ° C , 3 × SSC is done. Examples of intermediate stringency hybridization conditions for DNA hybrids longer than 50 nucleotides include hybridization at 50 ° C in 4 x SSC or at 40 ° C in 6 x SSC and 50% formamide followed by washing at 50 ° C in Figure 2 × SSC. The length of the hybrid is the expected length for the hybridizing nucleic acid. If nucleic acids are hybridized with a known sequence, the hybrid length can be determined by aligning with the sequences and identifying the conserved regions described therein. 1 × SSC is 0.15 M NaCl and 15 mM sodium citrate; the hybridization solution and washings may additionally contain 5x Denhardt's reagent, 0.5-1.0% SDS, 100 μg / ml denatured, fragmented salmon sperm DNA and 0.5% sodium pyrophosphate.

Zur Bestimmung des Stringenzausmaßes kann Sambrook et al., (2001), Molecular Cloning: a laboratary manual, 3. Ausgabe, Cold Spring Harbor Laboratory Press, CSH, New York , oder Current Protocols in Molecular Biology, John Wiley & Sons, N.Y. (1989 und jährliche Neufassungen) herangezogen werden.To determine the Stringenenzausmaßes can Sambrook et al., (2001), Molecular Cloning: a Laboratory Manual, 3rd Edition, Cold Spring Harbor Laboratory Press, CSH, New York , or Current Protocols in Molecular Biology, John Wiley & Sons, NY (1989 and Annual Recasts) be used.

Spleißvariantesplice variant

Der Begriff ”Spleißvariante”, wie er hier verwendet wird, umfasst Varianten einer Nukleinsäuresequenz, in der ausgewählte Introns und/oder Exons ausgeschnitten, ersetzt, versetzt oder zugefügt wurden, oder in der Introns verkürzt oder verlängert wurden. Bei solchen Varianten bleibt die biologische Aktivität des Proteins im Wesentlichen erhalten; dies lässt sich erzielen, indem man funktionelle Segmente des Proteins selektiv beibehält. Solche Spleißvarianten findet man in der Natur oder können künstlich hergestellt werden. Verfahren zur Vorhersage und Isolation dieser Spleißvarianten sind im Fachgebiet bestens bekannt (siehe beispielsweise Foissac und Schiex (2005) BMC Bioinformatics 6: 25 ).As used herein, the term "splice variant" encompasses variants of a nucleic acid sequence in which selected introns and / or exons have been excised, replaced, spiked or added, or truncated or extended in the intron. In such variants, the biological activity of the protein is essentially preserved; This can be achieved by selecting functional segments of the protein selectively maintains. Such splice variants are found in nature or can be artificially produced. Methods for predicting and isolating these splice variants are well known in the art (see, for example Foissac and Schiex (2005) BMC Bioinformatics 6: 25 ).

Allelvarianteallelic variant

Allele oder Allelvarianten sind alternative Formen eines bestimmten Gens, die sich an der gleichen Chromosomenposition befinden. Allelvarianten umfassen Einzelnukleotid-Polymorphismus (Single Nucleotide Polymorphisms (SNPs)), sowie Kleine Insertions/Deletions-Polymorphismen (Small Insertion/Deletion Polymorphisms (INDELs)). Die Größe der INDELs ist gewöhnlich kleiner als 100 bp. SNPs und INDELs bilden den größten Satz an Sequenzvarianten in natürlich vorkommenden polymorphen Stämmen der meisten Organismen.Allelic or allelic variants are alternative forms of a particular gene that are at the same chromosome position. Allelic variants include single nucleotide polymorphisms (SNPs) as well as small insertion / deletion polymorphisms (INDELs). The size of the INDELs is usually less than 100 bp. SNPs and INDELs constitute the largest set of sequence variants in naturally occurring polymorphic strains of most organisms.

Endogenes GenEndogenous gene

Eine Bezugnahme im vorliegenden Text auf ein ”endogenes” Gen betrifft nicht nur das fragliche Gen, wie es in einer Pflanze in seiner natürlichen Form gefunden wird (d. h. ohne dass ein menschlicher Eingriff vorliegt), sondern betrifft auch das gleiche Gen, (oder eine im Wesentlichen homologe Nukleinsäure bzw. Gen) in einer isolierten Form, das anschließend in eine Pflanze (wieder) eingebracht wird (ein Transgen). Eine transgene Pflanze, die ein solches Transgen enthält, kann eine wesentliche Reduktion der Transgenexpression und/oder eine wesentliche Reduktion der Expression des endogenen Gens erfahren. Das isolierte Gen kann aus einem Organismus isoliert werden oder von Menschenhand hergestellt werden, beispielsweise durch chemische Synthese.As used herein, an "endogenous" gene not only refers to the gene in question, as found in a plant in its natural form (ie, without human intervention), but also relates to the same gene (or a gene in the art) Substantially homologous nucleic acid or gene) in an isolated form which is subsequently (re) introduced into a plant (a transgene). A transgenic plant containing such a transgene may experience a substantial reduction in transgene expression and / or a substantial reduction in expression of the endogenous gene. The isolated gene can be isolated from an organism or made by human hand, for example by chemical synthesis.

Genshuffling/gerichtete EvolutionGene shuffling / directed evolution

Genshuffling oder gerichtete Evolution besteht aus iterativem DNA-Shuffling und anschließendem geeigneten Screening und/oder Selektieren, um Varianten von Nukleinsäuren oder Teilen davon zu erzeugen, die Proteine mit modifizierter biologischer Aktivität kodieren ( Castle et al., (2004), Science 304(5674): 1151–4 ; US-Patente 5,811,238 und 6,395,547 ).Gene shuffling or directed evolution consists of iterative DNA shuffling followed by appropriate screening and / or selection to produce variants of nucleic acids or portions thereof that encode proteins having modified biological activity ( Castle et al., (2004), Science 304 (5674): 1151-4 ; U.S. Patents 5,811,238 and 6,395,547 ).

Konstruktconstruct

Zusätzliche regulatorische Elemente können Transkriptions- und Translations-Enhancer umfassen. Der Fachmann kennt Terminator- und Enhancer-Sequenzen, die sich zur Durchführung der Erfindung eignen. Eine Intronsequenz kann ebenfalls zu der 5'-untranslatierten Region (UTR) oder in der kodierenden Sequenz hinzugefügt werden, damit die Menge der reifen Botschaft gesteigert wird, die sich im Cytosol anreichert, wie es im Abschnitt Definitionen beschrieben ist. Andere Kontrollsequenzen (neben Promotor, Enhancer, Silencer, Intronsequenzen, 3'UTR-und/oder 5'UTR-Regionen) können protein- und/oder RNA-stabilisierende Elemente sein. Solche Sequenzen sind dem Fachmann bekannt oder können leicht von ihm erhalten werden.Additional regulatory elements may include transcriptional and translational enhancers. The person skilled in the art knows terminator and enhancer sequences which are suitable for carrying out the invention. An intron sequence can also be added to the 5 'untranslated region (UTR) or in the coding sequence to increase the amount of mature message that accumulates in the cytosol, as described in the Definitions section. Other control sequences (besides promoter, enhancer, silencer, intron sequences, 3'UTR and / or 5'UTR regions) may be protein and / or RNA stabilizing elements. Such sequences are known to the person skilled in the art or can easily be obtained from him.

Die erfindungsgemäßen Genkonstrukte können weiterhin eine Replikationsursprungssequenz beinhalten, die zur Aufrechterhaltung und/oder Replikation in einem bestimmten Zelltyp erforderlich ist. Bei einem Beispiel muss ein Genkonstrukt in einer Bakterienzelle als episomales genetisches Element aufrechterhalten werden (z. B. Plasmid- oder Cosmidmolekül). Bevorzugte Replikationsursprünge umfassen f1-ori und colE1, sind jedoch nicht darauf beschränkt.The gene constructs of the invention may further include an origin of replication necessary for maintenance and / or replication in a particular cell type. In one example, a gene construct must be maintained in a bacterial cell as an episomal genetic element (eg, plasmid or cosmid molecule). Preferred origins of replication include, but are not limited to, f1-ori and colE1.

Für den Nachweis des erfolgreichen Transfers der Nukleinsäuresequenzen, wie sie bei den erfindungsgemäßen Verfahren verwendet wurden, und/oder für die Selektion der transgenen Pflanzen, die diese Nukleinsäuren umfassen, werden vorteilhafterweise Markergene (oder Reportergene) verwendet. Das Genkonstrukt kann daher gegebenenfalls ein Selektionsmarkergen umfassen. Selektionsmarker sind hier eingehender im Abschnitt ”Definitionen” beschrieben. Die Markergene können aus der transgenen Zelle entfernt oder gespalten werden, sobald sie nicht mehr vonnöten sind. Techniken zur Markerentfernung sind Stand der Technik, geeignete Techniken sind oben im Abschnitt Definitionen beschrieben.For the detection of the successful transfer of the nucleic acid sequences as used in the methods of the invention and / or for the selection of the transgenic plants comprising these nucleic acids, it is advantageous to use marker genes (or reporter genes). The gene construct may therefore optionally comprise a selection marker gene. Selection markers are described in more detail in the section "Definitions". The marker genes can be removed from the transgenic cell or cleaved as soon as they are no longer needed. Techniques for marker removal are known in the art, suitable techniques are described above in the Definitions section.

Regulationselement/Kontrollsequenz/PromotorRegulatory element / Control sequence / Promoter

Die Begriffe ”Regulationselement”, ”Kontrollsequenz” und ”Promotor” werden im vorliegenden Text jeweils austauschbar verwendet und sollen dahingehend breit interpretiert werden, dass sie regulatorische Nukleinsäuresequenzen bedeuten, die diejenigen Sequenzen, mit denen sie ligiert sind, exprimieren können. Der Begriff ”Promotor” bezieht sich gewöhnlich auf eine Nukleinsäurekontrollsequenz, die sich stromaufwärts vom Transkriptionsstart eines Gens befindet und die an der Erkennung und an der Bindung der RNA-Polymerase und anderer Proteine beteiligt ist, wodurch die Transkription einer funktionsfähig verknüpften Nukleinsäure gesteuert wird. Die oben genannten Begriffe umfassen auch Transkriptionsregulationssequenzen, die sich von einem klassischen eukaryontischen genomischen Gen ableiten (darunter auch die TATA-Box, die für eine präzise Initiation der Transkription erforderlich ist, mit oder ohne CCAAT-Box-Sequenz) sowie zusätzliche Regulationselemente (d. h. stromaufwärts aktivierende Sequenzen, Enhancer und Silencer), die die Genexpression auf Umweltreize und/oder von außen wirkende Reize hin oder auf gewebespezifische Art und Weise verändern. Der Begriff beinhaltet auch eine Transkriptionsregulationssequenz eines klassischen prokaryontischen Gens, der in diesem Fall eine -35-Box-Sequenz und/oder -10-Box-Transkriptionsregulationssequenzen beinhaltet. Der Begriff ”Regulationselement” umfasst auch ein synthetisches Fusionsmolekül oder Derivat, das die Expression eines Nukleinsäuremoleküls in einer Zelle, einem Gewebe oder einem Organ vermittelt, aktiviert oder verbessert.The terms "regulatory element", "control sequence" and "promoter" are used interchangeably herein and are to be broadly interpreted to mean regulatory nucleic acid sequences capable of expressing those sequences to which they are ligated. Of the The term "promoter" usually refers to a nucleic acid control sequence that is upstream of the transcriptional start of a gene and that participates in the recognition and binding of the RNA polymerase and other proteins, thereby controlling the transcription of a functionally linked nucleic acid. The above terms also include transcriptional regulatory sequences derived from a classical eukaryotic genomic gene (including the TATA box, which is required for precise initiation of transcription, with or without the CCAAT box sequence), as well as additional regulatory elements (ie, upstream activating sequences, enhancers and silencers) that alter gene expression to environmental stimuli and / or external stimuli, or in a tissue-specific manner. The term also includes a transcriptional regulatory sequence of a classical prokaryotic gene, in this case including a -35-box sequence and / or -10-box transcriptional regulatory sequences. The term "regulatory element" also includes a synthetic fusion molecule or derivative that mediates, activates or enhances the expression of a nucleic acid molecule in a cell, tissue or organ.

Ein ”pflanzlicher Promotor” umfasst Regulationselemente, die die Expression eines kodierenden Sequenzabschnitts in pflanzlichen Zellen vermitteln. Ein pflanzlicher Promotor muss daher nicht pflanzlichen Ursprungs sein, sondern kann von Viren oder Mikroorganismen, zum Beispiel von Viren, die Pflanzenzellen angreifen, abstammen. Der ”pflanzliche Promotor” kann auch von einer Pflanzenzelle abstammen, z. B. von der Pflanze, die mit der bei dem erfindungsgemäßen Verfahren zu exprimierenden und hier beschriebenen Nukleinsäuresequenz transformiert wird. Dies trifft auch auf andere ”pflanzliche” Regulationssignale, wie ”pflanzliche” Terminatoren zu. Die stromaufwärts der bei den Verfahren der vorliegenden Erfindung geeigneten Nukleotidsequenzen gelegenen Promotor können durch eine oder mehrere Nukleotidsubstitution(en), -insertion(en) und/oder -deletion(en) modifiziert werden, ohne dass die Funktionsfähigkeit oder Aktivität der Promotoren, des offenen Leserasters (ORF) oder der 3'-Regulationsregion wie Terminatoren oder anderen 3'-Regulationsregionen, die vom ORF beabstandet liegen, gestört wird. Weiterhin kann man auch die Aktivität der Promotoren durch Modifizieren ihrer Sequenz steigern oder sie vollständig durch aktivere Promotoren ersetzen, sogar durch Promotoren von heterologen Organismen. Für die Expression in Pflanzen muss das Nukleinsäuremolekül wie oben beschrieben funktionsfähig mit einem geeigneten Promotor verbunden sein oder einen geeigneten Promotor umfassen, der das Gen zum richtigen Zeitpunkt und mit dem erforderlichen räumlichen Expressionsmuster exprimiert.A "plant promoter" includes regulatory elements that mediate the expression of a coding sequence segment in plant cells. Therefore, a plant promoter need not be of plant origin but can be derived from viruses or microorganisms, for example from viruses that attack plant cells. The "plant promoter" may also be derived from a plant cell, e.g. From the plant which is transformed with the nucleic acid sequence to be expressed in the method of the invention and described herein. This also applies to other "plant" regulatory signals, such as "plant" terminators. The promoter located upstream of the nucleotide sequences useful in the methods of the present invention may be modified by one or more nucleotide substitution (s), insertion (s) and / or deletion (s) without affecting the operability or activity of the promoters of the open Reading frame (ORF) or the 3 'regulatory region such as terminators or other 3' regulatory regions, which are spaced from the ORF, is disturbed. Furthermore, one can also increase the activity of the promoters by modifying their sequence or replace them completely with more active promoters, even promoters of heterologous organisms. For expression in plants, the nucleic acid molecule as described above must be operably linked to a suitable promoter or comprise a suitable promoter which expresses the gene at the right time and with the required spatial expression pattern.

Zur Identifikation funktionell äquivalenter Promotoren kann die Promotorstärke und/oder das Expressionsmuster eines Kandidaten-Promotors analysiert werden, indem man den Promotor funktionsfähig mit einem Reporter-Gen verknüpft und das Expressionsausmaß und/oder das Muster des Reportergens in verschiedenen Geweben der Pflanze untersucht. Geeignete bestens bekannte Reportergene umfassen beispielsweise Betaglucuronidase oder Betagalactosidase. Die Promotor-Aktivität wird untersucht, indem man die Enzymaktivität der Betaglucuronidase oder Betagalactosidase misst. Die Promotorstärke und/oder das Expressionsmuster können dann mit der- bzw. demjenigen eines Referenz-Promotors verglichen werden (wie er beispielsweise in den erfindungsgemäßen Verfahren verwendet wird). Alternativ kann die Promotorstärke durch Quantifizieren der mRNA-Spiegel oder durch Vergleich der mRNA-Spiegel der in den erfindungsgemäßen Verfahren verwendeten Nukleinsäure mit mRNA-Spiegeln von Housekeeping-Genen, wie 18S rRNA, untersucht werden, wobei Verfahren des Standes der Technik, wie Northern-Blotting mit densitometrischer Analyse der Autoradiogramme, quantitative Echtzeit-PCR oder RT-PCR verwendet werden ( Held et al., 1996 Genome Methods 6: 986–994 ). Ein ”schwacher Promotor” ist im Allgemeinen ein Promotor, der die Expression einer kodierenden Sequenz auf einem niedrigen Spiegel steuert. ”Niedrige Spiegel” sind Spiegel von etwa 1110000 Transkripten bis zu etwa 1/100000 Transkripte, bis etwa 1/500000 Transkripte pro Zelle. Ein ”starker Promotor” steuert die Expression einer kodierenden Sequenz dagegen auf hohem Spiegel, oder bei etwa 1/10 Transkripten bis etwa 11100 Transkripten bis etwa 1/1000 Transkripten pro Zelle. Ein ”mittelstarker Promotor” ist im Allgemeinen ein Promotor, der die Expression einer kodierenden Sequenz bei einem niedrigeren Spiegel als ein starker Promotor steuert, insbesondere auf einem Spiegel, der in allen Fällen unter demjenigen Spiegel liegt, der sich unter der Kontrolle eines 35S CaMV-Promotors ergibt.To identify functionally equivalent promoters, the promoter strength and / or expression pattern of a candidate promoter can be analyzed by operably linking the promoter to a reporter gene and examining the expression level and / or pattern of the reporter gene in various tissues of the plant. Suitable well known reporter genes include, for example, beta glucuronidase or beta galactosidase. Promoter activity is assayed by measuring the enzyme activity of beta glucuronidase or beta galactosidase. The promoter strength and / or the expression pattern can then be compared with that or a reference promoter (as used for example in the method according to the invention). Alternatively, the promoter strength may be assayed by quantifying mRNA levels or by comparing the mRNA levels of the nucleic acid used in the methods of the invention with mRNA levels of housekeeping genes such as 18S rRNA, using prior art techniques such as Northern, Blotting can be used with densitometric analysis of autoradiograms, quantitative real-time PCR or RT-PCR ( Held et al., 1996, Genome Methods 6: 986-994 ). A "weak promoter" is generally a promoter that directs the expression of a coding sequence at a low level. "Low levels" are levels of about 1110000 transcripts up to about 1/100000 transcripts, up to about 1/500000 transcripts per cell. By contrast, a "strong promoter" controls expression of a coding sequence at high levels, or from about 1/10 transcripts to about 11,100 transcripts to about 1/1000 transcripts per cell. A "moderate promoter" is generally a promoter which directs the expression of a coding sequence at a lower level than a strong promoter, in particular on a level which in all cases is below that level which is under the control of a 35S CaMV. Promoter results.

Funktionsfähig verknüpftFunctionally linked

Der Begriff ”funktionsfähig verknüpft” wie er hier verwendet wird bedeutet eine funktionelle Verknüpfung zwischen der Promotorsequenz und dem interessierenden Gen, so dass die Promotorsequenz die Transkription des interessierenden Gens einleiten kann.The term "operably linked" as used herein means a functional linkage between the promoter sequence and the gene of interest so that the promoter sequence can initiate transcription of the gene of interest.

Konstitutiver Promotor Constitutive promoter

Ein ”konstitutiver Promotor” steht für einen Promotor, der während der meisten, jedoch nicht unbedingt allen, Wachstums- und Entwicklungsphasen und unter den meisten Umweltbedingungen in mindestens einer Zelle, einem Gewebe oder einem Organ transkriptionell aktiv ist. Beispiele für konstitutive Promotoren finden sich in Tabelle 2a unten. Tabelle 2a: Beispiele für konstitutive Promotoren Herkunftsgen Literaturangabe Actin McElroy et al., Plant Cell, 2: 163–171, 1990 HMGP WO 2004/070039 CAMV 35S Odell et al., Nature, 313: 810–812, 1985 CaMV 19S Nilsson et al., Physiol. Plant. 100: 456–462, 1997 GOS2 de Pater et al., Plant J. Nou.; 2(6): 837–44, 1992 , WO 2004/065596 Ubiquitin Christensen et al., Plant Mol. Biol. 18: 675–689, 1992 Reis-Cyclophilin Buchholz et al., Plant Mol. Biol. 25(5): 837–43, 1994 Mais-H3-Histon Lepetit et al., Mol. Gen. Genet. 231: 276–285, 1992 Luzerne-H3-Histon Wu et al., Plant Mol. Biol. 11: 641–649, 1988 Actin 2 An et al., Plant J. 10(1); 107–121, 1996 34S FMV Sanger et al., Plant. Mol. Biol., 14, 1990: 433–443 Kleine Rubisco-Untereinheit US 4,962,028 OCS Leisner (1988), Proc. Natl. Acad. Sci. USA 85(5): 2553 SAD1 Jain et al., Crop Science, 39 (6), 1999: 1696 SAD2 Jain et al., Crop Science, 39 (6), 1999: 1696 Nos Shaw et al., (1984), Nucleic Acids Res. 12(20): 7831–7846 V-ATPase WO 01/14572 Superpromotor WO 95/14098 G-Box-Proteine WO 94/12015 A "constitutive promoter" means a promoter that is transcriptionally active during most, but not necessarily all, stages of growth and development and under most environmental conditions in at least one cell, tissue or organ. Examples of constitutive promoters are found in Table 2a below. Table 2a: Examples of constitutive promoters Herkunftsgen citation actin McElroy et al., Plant Cell, 2: 163-171, 1990 HMGP WO 2004/070039 CAMV 35S Odell et al., Nature, 313: 810-812, 1985 CaMV 19S Nilsson et al., Physiol. Plant. 100: 456-462, 1997 GOS2 de Pater et al., Plant J. Nou .; 2 (6): 837-44, 1992 . WO 2004/065596 ubiquitin Christensen et al., Plant Mol. Biol. 18: 675-689, 1992 Rice cyclophilin Buchholz et al., Plant Mol. Biol. 25 (5): 837-43, 1994 Maize H3 histone Lepetit et al., Mol. Genet. 231: 276-285, 1992 Luzerne H3 histone Wu et al., Plant Mol. Biol. 11: 641-649, 1988 Actin 2 An et al., Plant J. 10 (1); 107-121, 1996 34S FMV Sanger et al., Plant. Mol. Biol., 14, 1990: 433-443 Small rubisco subunit US 4,962,028 OCS Leisner (1988), Proc. Natl. Acad. Sci. USA 85 (5): 2553 SAD1 Jain et al., Crop Science, 39 (6), 1999: 1696 SAD2 Jain et al., Crop Science, 39 (6), 1999: 1696 nos Shaw et al. (1984) Nucleic Acids Res. 12 (20): 7831-7846 V-ATPase WO 01/14572 Super promoter WO 95/14098 G-box proteins WO 94/12015

Ubiquitärer PromotorUbiquitous promoter

Ein ubiquitärer Promotor ist in im Wesentlichen allen Geweben oder Zellen eines Organismus aktiv.A ubiquitous promoter is active in essentially all tissues or cells of an organism.

Entwicklungsregulierter PromotorDevelopmentally regulated promoter

Ein entwicklungsregulierter Promotor ist während gewisser Entwicklungsstadien oder in Teilen der Pflanze, bei denen entwicklungsrelevante Veränderungen auftreten, aktiv.A developmentally regulated promoter is active during certain stages of development or in parts of the plant where developmentally relevant changes occur.

Induzierbarer PromotorInducible promoter

Ein induzierbarer Promotor weist eine induzierte oder erhöhte Transkriptionsinitiation auf einen chemischen Reiz (siehe Übersichtsartikel von Gatz 1997, Annu. Rev. Plant Physiol. Plant Mol. Biol., 48: 89–108 ), einen Umweltreiz oder einen physikalischen Reiz hin auf, oder kann ”stressinduzierbar” sein, d. h. dann aktiviert werden, wenn eine Pflanze verschiedenen Stressbedingungen ausgesetzt ist, oder ”pathogen induzierbar”, d. h. wird dann aktiviert, wenn eine Pflanze verschiedenen Pathogenen ausgesetzt ist.An inducible promoter has an induced or increased transcription initiation on a chemical stimulus (see reviews of Gatz 1997, Annu. Rev. Plant Physiol. Plant Mol. Biol., 48: 89-108 ), or may be "stress-inducible", ie activated when a plant is exposed to various stress conditions, or "pathogen inducible", ie activated when a plant is exposed to various pathogens.

Organspezifischer/gewebespezifischer PromotorOrgan specific / tissue specific promoter

Ein organspezifischer oder gewebespezifischer Promotor ist ein Promotor, der die Transkription bevorzugt in bestimmten Organen oder Geweben, wie den Blättern, Wurzeln, dem Samengewebe usw. initiieren kann. Ein ”wurzelspezifischer Promotor” ist beispielsweise ein Promotor, der in erster Linie in Pflanzenwurzeln transkriptionell aktiv ist, und zwar im Wesentlichen unter Ausschluss von jeglichen anderen Teilen einer Pflanze, obwohl trotzdem noch Leck-Expression in diesen anderen Pflanzenteilen möglich ist. Promotoren, die die Transkription nur in bestimmten Zellen initiieren können, werden im vorliegenden Text als ”zellspezifisch” bezeichnet.An organ-specific or tissue-specific promoter is a promoter that preferentially initiates transcription in certain organs or tissues, such as the leaves, roots, seminal tissue, and the like can. For example, a "root-specific promoter" is a promoter that is transcriptionally active primarily in plant roots, essentially excluding any other parts of a plant, although leak expression is still possible in these other plant parts. Promoters that can initiate transcription only in certain cells are referred to herein as "cell-specific."

Beispiele für wurzelspezifische Promotoren sind in Tabelle 2b unten angeführt: Tabelle 2b: Beispiele für wurzelspezifische Promotoren Herkunftsgen Literaturangabe RCc3 Plant Mol. Biol. 1995 Jan; 27(2): 237–48 Arabidopsis-PHT1 Kovama et al., 2005; Mudge et al. (2002, Plant J. 31: 341) Phosphattransporter aus Medicago Xiao et al., 2006 Arabidopsis-Pyk10 Nitz et al. (2001) Plant Sci. 161(2): 337–346 in Wurzeln exprimierbare Gene Tingey et al., EMBO J. 6: 1, 1987 auxininduzierbares Gen des Tabaks Van der Zaal et al, Plant Mol. Biol. 16, 983, 1991 β-Tubulin Oppenheimer et al., Gene 63: 87, 1988 wurzelspezifische Gene aus Tabak Conkling et al., Plant Physiol. 93: 1203, 1990 G1-3b-Gen aus B. napus United States Patent No. 5,401,836 SbPRP1 Suzuki et al., Plant Mol. Biol. 21: 109–119, 1993 LRX1 Baumberger et al., 2001, Genes & Dev. 15: 1128 BTG-26 aus Brassica napus US 20050044585 LeAMT1 (Tomate) Lauter et al. (1996, PNAS 3: 8139) Das LeNRT1-1 (Tomate) Lauter et al. (1996, PNAS 3: 8139) Klasse-I-Patatingen (Kartoffel) Liu et al., Plant Mol. Biol. 153: 386–395, 1991 KDC1 (Daucus carota) Downey et al. (2000, J. Biol. Chem. 275: 39420) TobRB7-Gen W Song (1997) PhD Thesis, North Carolina State University, Raleigh, NC USA OSRAB5a (Reis) Wang et al., 2002, Plant Sci. 163: 273 ALF5 (Arabidopsis) Diener et al. (2001, Plant Cell 13: 1625) NRT2;1 Np (N. plumbaginifolia) Quesada et al. (1997, Plant Mol. Biol. 34: 265) Examples of root specific promoters are listed in Table 2b below: TABLE 2b Examples of root specific promoters Herkunftsgen citation RCc3 Plant Mol. Biol. 1995 Jan; 27 (2): 237-48 Arabidopsis PHT1 Kovama et al., 2005; Mudge et al. (2002, Plant J. 31: 341) Phosphate transporter from Medicago Xiao et al., 2006 Arabidopsis Pyk10 Nitz et al. (2001) Plant Sci. 161 (2): 337-346 Roots expressible genes Tingey et al., EMBO J. 6: 1, 1987 auxin-inducible gene of tobacco Van der Zaal et al, Plant Mol. Biol. 16, 983, 1991 β-tubulin Oppenheimer et al., Gene 63: 87, 1988 root-specific genes from tobacco Conkling et al., Plant Physiol. 93: 1203, 1990 G1-3b gene from B. napus United States Patent. 5,401,836 SbPRP1 Suzuki et al., Plant Mol. Biol. 21: 109-119, 1993 LRX1 Baumberger et al., 2001, Genes & Dev. 15: 1128 BTG-26 from Brassica napus US 20050044585 LeAMT1 (tomato) Lauter et al. (1996, PNAS 3: 8139) The LeNRT1-1 (tomato) Lauter et al. (1996, PNAS 3: 8139) Class I Patatingen (Potato) Liu et al., Plant Mol. Biol. 153: 386-395, 1991 KDC1 (Daucus carota) Downey et al. (2000, J. Biol. Chem. 275: 39420) TobRB7 gene W Song (1997) PhD Thesis, North Carolina State University, Raleigh, NC USA OSRAB5a (rice) Wang et al., 2002, Plant Sci. 163: 273 ALF5 (Arabidopsis) Diener et al. (2001, Plant Cell 13: 1625) NRT2; 1 Np (N. plumbaginifolia) Quesada et al. (1997, Plant Mol. Biol. 34: 265)

Ein samenspezifischer Promotor ist in erster Linie in Samengewebe, jedoch nicht unbedingt ausschließlich in Samengewebe (bei Leck-Expression) transkriptionell aktiv. Der samenspezifische Promotor kann während der Samenentwicklung und/oder während der Keimung aktiv sein. Der samenspezifische Promotor kann endosperm- und/oder aleuron- und/oder embryospezifisch sein. Beispiele für samenspezifische Promotoren (endosperm-/aleuron- /embryospezifisch) sind in Tabelle 2c bis Tabelle 2f unten angegeben. Weitere Beispiele für samenspezifische Promotoren sind bei Qing Qu und Takaiwa (Plant Biotechnol. J. 2, 113–125, 2004) angegeben, und diese Offenbarung ist hiermit durch Bezugnahme aufgenommen als wäre sie hier vollständig beschrieben. Tabelle 2c: Beispiele für samenspezifische Promotoren Herkunftsgen Literaturangabe Samenspezifische Gene Simon et al., Plant Mol. Biol. 5: 191, 1985 ; Scofield et al., J. Biol. Chem. 262: 12202, 1987 ; Baszczynski et al., Plant Mol. Biol. 14: 633, 1990 Paranuss-Albumin Pearson et al., Plant Mol. Biol. 18: 235–245, 1992 Legumin Ellis et al., Plant Mol. Biol. 10: 203–214, 1988 Glutelin (Reis) Takaiwa et al., Mol. Gen. Genet. 208: 15–22, 1986 ; Takaiwa et al., FEBS Letts. 221: 43–47, 1987 Zein Matzke et al., Plant Mal. Biol., 14(3): 323–32, 1990 napA Stalberg et al., Planta 199: 515–519, 1996 LMW- und HMW-Glutenin-1 aus Weizen Mol. Gen. Genet. 216: 81–90, 1989; NAR 17: 461–2, 1989 Weizen-SPA Albani et al., Plant Cell, 9: 171–184, 1997 α-, β-, γ-Gliadine aus Weizen EMBO J. 3: 1409–15, 1984 Itr1-Promotor aus Gerste Diaz et al., (1995), Mol. Gen. Genet. 248(5): 592–8 B1, C, D, Hordein aus Gerste Theor. Appl. Gen. 98: 1253–62, 1999 ; Plant J. 4: 343–55, 1993 ; Mol. Gen. Genet. 250: 750–60, 1996 Gerste-DOF Mena et al., The Plant Journal, 116(1): 53–62, 1998 blz2 EP 99106056.7 synthetischer Promotor Vicente-Carbajosa et al., Plant J. 13: 629–640, 1998 Reis-Prolamin NRP33 Wu et al., Plant Cell Physiology 39(8) 885–889, 1998 a-Globulin Glb-1 aus Reis Wu et al., Plant Cell Physiology 39(8) 885–889, 1998 Reis-OSH1 Sato et al., Proc. Natl. Acad. Sci. USA, 93: 8117–8122, 1996 α-Globulin REB/OHP-1 aus Reis Nakase et al., Plant Mol. Biol. 33: 513–522, 1997 Reis-ADP-Glukosepyrophosphorylase Trans. Res. 6: 157–68, 1997 Mais-ESR-Genfamilie Plant J. 12: 235–46, 1997 α-Kafirin aus Sorghumhirse DeRose et al., Plant Mol. Biol. 32: 1029–35, 1996 KNOX Postma-Haarsma et al., Plant Mol. Biol. 39: 257–71, 1999 Reis-Oleosin Wu et al., J. Biochem. 123: 386, 1998 Sonnenblumen-Oleosin Cummins et al., Plant Mol. Biol. 19: 873–876, 1992 PRO0117, mutmaßliches 40S-Ribosomenprotein aus Reis WO 2004/070039 PRO0136, Reis-Alaninaminotransferase unveröffentlicht PRO0147, Trypsinhemmer ITR1 (Gerste) unveröffentlicht PRO0151, Reis-WSI18 WO 2004/070039 PRO0175, Reis-RAB21 WO 2004/070039 PRO005 WO 2004/070039 PRO0095 WO 2004/070039 α-Amylase (Amy32b) Lanahan et al., Plant Cell 4: 203–211, 1992 ; Skriver et al., Proc. Natl. Acad. Sci., USA 88: 7266–7270, 1991 Cathepsin β-artiges Gen Cejudo et al., Plant Mol. Biol. 20: 849–856, 1992 Gerste-Ltp2 Kalla et al., Plant J. 6: 849–60, 1994 Chi26 Leah et al., Plant J. 4: 579–89, 1994 Mais B-Peru Selinger et al., Genetics 149; 1125–38, 1998 Tabelle 2d: Beispiele für endospermspezifische Promotoren Herkunftsgen Literaturangabe Glutelin (Reis) Takaiwa et al., (1986), Mol. Gen. Genet. 208: 15–22 ; Takaiwa et al., (1987), FEBS Letts. 221: 43–47 Zein Matzke et al., (1990), Plant Mol. Biol. 14(3): 323–32 LMW- und HMW-Glutenin-1 aus Weizen Colot et al., (1989), Mol. Gen. Genet. 216: 81–90 , Anderson et al., (1989), NAR 17: 461–2 Weizen-SPA Albani et al., (1997), Plant Cell 9: 171–184 Weizen-Gliadine Rafalski et al., (1984), EMBO 3: 1409–15 Itr1-Promotor aus der Gerste Diaz et al., (1995), Mol. Gen. Genet. 248(5): 592–8 B1, C, D, Hordein aus der Gerste Cho et al., (1999), Theor. Appl. Genet. 98: 1253–62 ; Muller et al., (1993), Plant J. 4: 343–55 ; Sorenson et al., (1996), Mol. Gen. Genet. 250: 750–60 Gersten-DOF Mena et al., (1998), Plant J. 116(1): 53–62 blz2 Onate et al., (1999), J. Biol. Chem. 274(14): 9175–82 Synthetischer Promotor Vicente-Carbajosa et al., (1998), Plant J. 13: 629–640 Reis-Prolamin NRP33 Wu et al., (1998), Plant Cell Physiol. 39(8) 885–889 Reis-Globulin Glb-1 Wu et al., (1998), Plant Cell Physiol. 39(8) 885–889 Reis-Globulin REB/OHP-1 Nakase et al., (1997), Plant Molec. Biol. 33: 513–522 Reis-ADP-Glukosepyrophosphorylase Russell et al., (1997), Trans. Res. 6: 157–68 Mais-ESR-Genfamilie Opsahl-Ferstad et al., (1997), Plant J. 12: 235–46 Sorghumhirse-Kafirin DeRose et al., (1996), Plant Mol. Biol. 32: 1029–35 Tabelle 2e: Beispiele für embryospezifische Promotoren: Herkunftsgen Literaturangabe Reis-OSH1 Sato et al., Proc. Natl. Acad. Sci. USA, 93: 8117–8122, 1996 KNOX Postma-Haarsma et al., Plant Mol. Biol. 39: 257–71, 1999 PRO0151 WO 2004/070039 PRO0175 WO 2004/070039 PRO005 WO 2004/070039 PRO0095 WO 2004/070039 Tabelle 2f: Beispiele für aleuronspezifische Promotoren: Herkunftsgen Literaturangabe α-Amylase (Amy32b) Lanahan et al., Plant Cell 4: 203–211, 1992 ; Skriver et al., Proc. Natl. Acad. Sci. USA 88: 7266–7270, 1991 Cathepsin-β-artiges Gen Cejudo et al., Plant Mol. Biol. 20: 849–856, 1992 Gersten-Ltp2 Kalla et al., Plant J. 6: 849–60, 1994 Chi26 Leah et al., Plant J. 4: 579–89, 1994 Mais B-Peru Selinger et al., Genetics 149; 1125–38, 1998 A seed-specific promoter is transcriptionally active primarily in seed tissue but not necessarily exclusively in seed tissue (in case of leak expression). The seed specific promoter may be active during seed development and / or germination. The seed-specific promoter may be endosperm and / or aleuron and / or embryo specific. Examples of seed-specific promoters (endosperm / aleuron / embryo-specific) are given in Table 2c to Table 2f below. Further examples of seed-specific promoters are in Qing Qu and Takaiwa (Plant Biotechnol., J. 2, 113-125, 2004) and this disclosure is hereby incorporated by reference as if fully set forth herein. Table 2c: Examples of seed-specific promoters Herkunftsgen citation Semen-specific genes Simon et al., Plant Mol. Biol. 5: 191, 1985 ; Scofield et al., J. Biol. Chem. 262: 12202, 1987 ; Baszczynski et al., Plant Mol. Biol. 14: 633, 1990 Brazil nut albumin Biol. 18: 235-245, 1992 legumin Ellis et al., Plant Mol. Biol. 10: 203-214, 1988 Glutelin (rice) Takaiwa et al., Mol. Gen. Genet. 208: 15-22, 1986 ; Takaiwa et al., FEBS Letts. 221: 43-47, 1987 zein Matzke et al., Plant Mal. Biol., 14 (3): 323-32, 1990 napA Stalberg et al., Planta 199: 515-519, 1996 LMW and HMW glutenin-1 from wheat Mol. Gen. Genet. 216: 81-90, 1989; NAR 17: 461-2, 1989 Wheat SPA Albani et al., Plant Cell, 9: 171-184, 1997 α-, β-, γ-gliadins from wheat EMBO J. 3: 1409-15, 1984 Itr1 promoter from barley Diaz et al., (1995) Mol. Genet. 248 (5): 592-8 B1, C, D, Hordein from barley Theor. Appl. Gene. 98: 1253-62, 1999 ; Plant J. 4: 343-55, 1993 ; Mol. Gen. Genet. 250: 750-60, 1996 Barley DOF Mena et al., The Plant Journal, 116 (1): 53-62, 1998 blz2 EP 99106056.7 synthetic promoter Vicente-Carbajosa et al., Plant J. 13: 629-640, 1998 Rice prolamin NRP33 Wu et al., Plant Cell Physiology 39 (8) 885-889, 1998 a-globulin Glb-1 from rice Wu et al., Plant Cell Physiology 39 (8) 885-889, 1998 Rice OSH1 Sato et al., Proc. Natl. Acad. Sci. USA, 93: 8117-8122, 1996 α-globulin REB / OHP-1 from rice Nakase et al., Plant Mol. Biol. 33: 513-522, 1997 Rice ADP Glukosepyrophosphorylase Trans. Res. 6: 157-68, 1997 Corn ESR gene family Plant J. 12: 235-46, 1997 Sorghum sorghum α-kafirin DeRose et al., Plant Mol. Biol. 32: 1029-35, 1996 KNOX Postma-Haarsma et al., Plant Mol. Biol. 39: 257-71, 1999 Rice oleosin Wu et al., J. Biochem. 123: 386, 1998 Sunflower oleosin Cummins et al., Plant Mol. Biol. 19: 873-876, 1992 PRO0117, putative rice 40S ribosome protein WO 2004/070039 PRO0136, rice alanine aminotransferase unpublished PRO0147, trypsin inhibitor ITR1 (barley) unpublished PRO0151, Rice WSI18 WO 2004/070039 PRO0175, rice RAB21 WO 2004/070039 PRO005 WO 2004/070039 PRO0095 WO 2004/070039 α-amylase (Amy32b) Lanahan et al., Plant Cell 4: 203-211, 1992 ; Skriver et al., Proc. Natl. Acad. Sci., USA 88: 7266-7270, 1991 Cathepsin β-like gene Biol. 20: 849-856, 1992 Barley Ltp2 Kalla et al., Plant J. 6: 849-60, 1994 Chi26 Leah et al., Plant J. 4: 579-89, 1994 Corn B-Peru Selinger et al., Genetics 149; 1125-38, 1998 Table 2d: Examples of endosperm-specific promoters Herkunftsgen citation Glutelin (rice) Takaiwa et al., (1986) Mol. Gen. Genet. 208: 15-22 ; Takaiwa et al., (1987), FEBS Letts. 221: 43-47 zein Matzke et al., (1990), Plant Mol. Biol. 14 (3): 323-32 LMW and HMW glutenin-1 from wheat Colot et al., (1989) Mol. Genet. 216: 81-90 . Anderson et al., (1989), NAR 17: 461-2 Wheat SPA Albani et al., (1997), Plant Cell 9: 171-184 Wheat gliadins Rafalski et al. (1984) EMBO 3: 1409-15 Itr1 promoter from the barley Diaz et al., (1995) Mol. Genet. 248 (5): 592-8 B1, C, D, Hordein from the barley Cho et al., (1999), Theor. Appl. Genet. 98: 1253-62 ; Muller et al., (1993), Plant J. 4: 343-55 ; Sorenson et al., (1996) Mol. Genet. 250: 750-60 Barley DOF Mena et al., (1998), Plant J. 116 (1): 53-62 blz2 Onate et al., (1999) J. Biol. Chem. 274 (14): 9175-82 Synthetic promoter Vicente-Carbajosa et al., (1998) Plant J. 13: 629-640 Rice prolamin NRP33 Wu et al., (1998), Plant Cell Physiol. 39 (8) 885-889 Rice Globulin Glb-1 Wu et al., (1998), Plant Cell Physiol. 39 (8) 885-889 Rice globulin REB / OHP-1 Nakase et al., (1997) Plant Molec. Biol. 33: 513-522 Rice ADP Glukosepyrophosphorylase Russell et al., (1997), Trans. Res. 6: 157-68 Corn ESR gene family Opsahl-Ferstad et al., (1997), Plant J. 12: 235-46 Sorghum-kafirin DeRose et al., (1996), Plant Mol. Biol. 32: 1029-35 Table 2e: Examples of embryo-specific promoters: Herkunftsgen citation Rice OSH1 Sato et al., Proc. Natl. Acad. Sci. USA, 93: 8117-8122, 1996 KNOX Postma-Haarsma et al., Plant Mol. Biol. 39: 257-71, 1999 PRO0151 WO 2004/070039 PRO0175 WO 2004/070039 PRO005 WO 2004/070039 PRO0095 WO 2004/070039 Table 2f: Examples of aleurone-specific promoters: Herkunftsgen citation α-amylase (Amy32b) Lanahan et al., Plant Cell 4: 203-211, 1992 ; Skriver et al., Proc. Natl. Acad. Sci. USA 88: 7266-7270, 1991 Cathepsin β-like gene Biol. 20: 849-856, 1992 Barley Ltp2 Kalla et al., Plant J. 6: 849-60, 1994 Chi26 Leah et al., Plant J. 4: 579-89, 1994 Corn B-Peru Selinger et al., Genetics 149; 1125-38, 1998

Ein für grünes Gewebe spezifischer Promotor wie im vorliegenden Text definiert ist ein Promotor, der vorwiegend in grünem Gewebe transkriptionell aktiv ist, und zwar im Wesentlichen unter Ausschluss von jeglichen anderen Teilen einer Pflanze, obwohl trotzdem noch Leck-Expression in diesen anderen Pflanzenteilen möglich ist.A green tissue-specific promoter, as defined herein, is a promoter that is predominantly transcriptionally active in green tissue, essentially excluding any other parts of a plant, although still leak expression in these other parts of the plant is possible.

Beispiele für Promotoren, die für das grüne Gewebe spezifisch sind und die zur Durchführung der erfindungsgemäßen Verfahren verwendet werden können, sind in der Tabelle 2g unten dargestellt. Tabelle 2g: Beispiele für Promotoren, die für das grüne Gewebe spezifisch sind Gen Expression Literaturangabe Orthophosphatdikinase aus Mais Blattspezifisch Fukavama et al., 2001 Phosphoenolpyruvatcarboxylase aus Mais Blattspezifisch Kausch et al., 2001 Phosphoenolpyruvatcarboxylase aus Reis Blattspezifisch Liu et al., 2003 Kleine Rubisco-Untereinheit aus Reis Blattspezifisch Nomura et al., 2000 Beta-Expansin EXBP9 aus Reis Sprossspezifisch WO 2004/070039 Kleine Rubisco-Untereinheit aus Straucherbse Blattspezifisch Panguluri et al., 2005 RBCS3A aus Erbse Blattspezifisch Examples of green tissue-specific promoters that can be used to practice the methods of this invention are shown in Table 2g below. Table 2g: Examples of promoters specific for the green tissue gene expression citation Orthophosphate dikinase from maize Specifically Journal Fukavama et al., 2001 Phosphoenolpyruvate carboxylase from maize Specifically Journal Kausch et al., 2001 Phosphoenolpyruvate carboxylase from rice Specifically Journal Liu et al., 2003 Small rubisco subunit of rice Specifically Journal Nomura et al., 2000 Beta-expansin EXBP9 from rice Specifically sprout WO 2004/070039 Small rubisco subunit from pigeon pea Specifically Journal Panguluri et al., 2005 Pea RBCS3A Specifically Journal

Ein weiteres Beispiel für einen gewebespezifischen Promotor ist ein meristemspezifischer Promotor, der in erster Linie in Meristemgewebe transkriptionell aktiv ist, und zwar im Wesentlichen unter Ausschluss von jeglichen anderen Teilen einer Pflanze, obwohl trotzdem noch Leck-Expression in diesen anderen Pflanzenteilen möglich ist. Beispiele für Promotoren, die für das grüne Meristem spezifisch sind und die für die Durchführung der erfindungsgemäßen Verfahren verwendet werden können, sind in Tabelle 2h unten dargestellt. Tabelle 2h: Beispiele für meristemspezfische Promotoren Herkunftsgen Expressionsmuster Literaturangabe Reis-OSH1 Sprossapikalmeristem, von globulärem Embryostadium bis zum Keimlingsstadium Sato et al. (1996) Proc. Natl. Acad. Sci. USA, 93: 8117–8122 Reis-Metallothionein Meristemspezifisch BAD87835.1 WAK1 & WAK2 Spross- und Wurzelapikalmeristeme, sowie in sich ausbreitenden Blättern und Kelchblättern Wagner & Kohorn (2001) Plant Cell 13(2): 303–318 Another example of a tissue-specific promoter is a meristem-specific promoter that is transcriptionally active primarily in meristem tissue, essentially excluding any other parts of a plant, although leak expression is still possible in these other plant parts. Examples of promoters specific for the green meristem and which can be used to carry out the methods of the invention are shown in Table 2h below. Table 2h: Examples of meristemspefische promoters Herkunftsgen expression patterns citation Rice OSH1 Sprout apical meristem, from globular embryonic stage to seedling stage Sato et al. (1996) Proc. Natl. Acad. Sci. USA, 93: 8117-8122 Rice metallothionein Meristemspezifisch BAD87835.1 WAK1 & WAK2 Shoot and root apical meristems, as well as in spreading leaves and sepals Wagner & Kohorn (2001) Plant Cell 13 (2): 303-318

Terminatorterminator

Der Begriff ”Terminator” umfasst eine Kontrollsequenz, bei der es sich um eine DNA-Sequenz am Ende einer Transkriptionseinheit handelt, die die 3'-Prozessierung und Polyadenylierung eines primäres Transkripts und die Transkriptionstermination signalisiert. Der Terminator kann von dem natürlichen Gen, von verschiedenen anderen pflanzlichen Genen oder von T-DNA abstammen. Der hinzuzufügende Terminator kann zum Beispiel vom Nopalinsynthasegen oder vom Octopinsynthasegen oder alternativ von einem anderen pflanzlichen Gen oder, was weniger bevorzugt ist, von einem beliebigen anderen eukaryontischen Gen abstammen.The term "terminator" includes a control sequence that is a DNA sequence at the end of a transcription unit that signals the 3 'processing and polyadenylation of a primary transcript and the transcription termination. The terminator may be derived from the natural gene, various other plant genes, or T-DNA. The terminator to be added may be derived, for example, from the nopaline synthase gene or from the octopine synthase gene or alternatively from another plant gene or, less preferably, from any other eukaryotic gene.

Selektionsmarker(gen)/ReportergenSelection markers (gen) / reporter

”Selektionsmarker”, ”Selektionsmarkergen” oder ”Reportergen” beinhaltet jegliches Gen, das einer Zelle, in der es exprimiert wird, um die Identifikation und/oder Selektion von Zellen, die mit einem erfindungsgemäßen Nukleinsäurekonstrukt transfiziert sind oder transformiert sind, zu erleichtern, einen Phänotyp verleiht. Mit diesen Markergenen kann ein erfolgreicher Transfer der Nukleinsäuremoleküle mittels einer Reihe von unterschiedlichen Prinzipien identifiziert werden. Geeignete Marker können aus Markern ausgewählt werden, die Antibiotika- oder Herbizidresistenz verleihen, die ein neues Stoffwechselmerkmal einführen oder die eine visuelle Selektion gestatten. Zu Selektionsmarkergenen gehören zum Beispiel Gene, die Resistenz gegen Antibiotika (wie nptlI, das Neomycin und Kanamycin phosphoryliert, oder hpt, das Hygromycin phosphoryliert, oder Gene, die Resistenz gegen zum Beispiel Bleomycin, Streptomycin, Tetracyclin, Chloramphenicol, Ampicillin, Gentamycin, Geneticin (G418), Spectinomycin oder Blasticidin verleihen), gegen Herbizide (zum Beispiel bar, das Resistenz gegen Basta^® vermittelt; aroA oder gox, die Resistenz gegen Glyphosat vermitteln, oder die Gene, die Resistenz gegen z. B. Imidazolinon, Phosphinothricin oder Sulfonylharnstoff verleihen), oder Gene, die ein Stoffwechselmerkmal bereitstellen (wie manA, des es Pflanzen ermöglicht, Mannose als einzige Kohlenstoffquelle zu verwerten, oder Xyloseisomerase für die Verwertung von Xylose, oder Antinährstoffmarker, wie Resistenz gegen 2-Desoxyglucose), vermitteln. Die Expression visueller Markergene führt zur Bildung von Farbe (zum Beispiel β-Glucuronidase, GUS oder β-Galactosidase mit ihren gefärbten Substraten, zum Beispiel X-Gal), Lumineszenz (wie das Luziferin/Luziferase-System) oder Fluoreszenz (Green Fluorescent Protein, GFP, und seine Derivate). Diese Aufzählung stellt nur eine kleine Anzahl von möglichen Markern dar. Der Fachmann ist mit solchen Markern vertraut. Je nach dem Organismus und dem Selektionsverfahren werden unterschiedliche Marker bevorzugt."Selection marker", "selection marker gene" or "reporter gene" includes any gene that is a cell in which it is expressed to facilitate the identification and / or selection of cells that are transfected or transformed with a nucleic acid construct according to the invention Confers phenotype. With these marker genes, successful transfer of the nucleic acid molecules can be identified by a number of different principles. Suitable markers may be selected from markers conferring antibiotic or herbicide resistance, introducing a novel metabolic trait or allowing for visual selection. Selection marker genes include, for example, genes that are resistant to antibiotics (such as nptlI, which phosphorylates neomycin and kanamycin, or hpt that phosphorylates hygromycin, or genes that are resistant to, for example, bleomycin, streptomycin, tetracycline, chloramphenicol, ampicillin, gentamycin, geneticin ( G418), spectinomycin or blasticidin), herbicides (for example bar, the resistance to Basta ^® mediates; aroA or gox, which confer resistance to glyphosate, or the genes that resist z. Imidazolinone, phosphinothricin or sulfonylurea), or genes that provide a metabolic trait (such as that which allows plants to utilize mannose as their sole carbon source, or xylose isomerase for the utilization of xylose, or anti-nutrient markers such as resistance to 2-deoxyglucose ), convey. The expression of visual marker genes leads to the formation of color (for example β-glucuronidase, GUS or β-galactosidase with their colored substrates, for example X-Gal), luminescence (such as the luciferin / luciferase system) or fluorescence (Green Fluorescent Protein, GFP, and its derivatives). This list represents only a small number of possible markers. The person skilled in the art is familiar with such markers. Depending on the organism and the selection method, different markers are preferred.

Bei stabiler oder transienter Integration von Nukleinsäuren in Pflanzenzellen nimmt bekanntlich nur ein kleiner Teil der Zellen die fremde DNA auf, und integriert sie wenn gewünscht je nach dem verwendeten Expressionsvektor und der verwendeten Transfektionstechnik in ihr Genom. Zur Identifikation und Selektion dieser Integranten wird gewöhnlich ein Gen, das einen selektierbaren Marker kodiert (wie diejenigen, die oben beschrieben sind) in die Wirtszelle zusammen mit dem interessierenden Gen eingesetzt. Diese Marker können beispielsweise in Mutanten verwendet werden, in denen diese Gene nicht funktionell sind, beispielsweise durch Deletion durch herkömmliche Verfahren. Darüber hinaus können Nukleinsäuremoleküle, die einen Selektionsmarker kodiere, in eine Wirtszelle auf dem gleichen Vektor eingebracht werden, der die Sequenz umfasst, die die erfindungsgemäßen Polypeptide kodiert, oder in den erfindungsgemäßen Verfahren verwendet werden, oder ansonsten in einem gesonderten Vektor. Zellen, die stabil mit der eingebrachten Nukleinsäure transfiziert wurden, können beispielsweise durch Selektion identifiziert werden (beispielsweise Zellen, die den Selektionsmarker integriert haben, überleben, wohingegen andere Zellen sterben).In the case of stable or transient integration of nucleic acids in plant cells, it is known that only a small part of the cells absorb the foreign DNA and, if desired, integrate it into their genome depending on the expression vector used and the transfection technique used. For identification and selection of these integrants, a gene encoding a selectable marker (such as those described above) is usually inserted into the host cell along with the gene of interest. These markers can be used, for example, in mutants in which these genes are not functional, for example by deletion by conventional methods. In addition, nucleic acid molecules encoding a selection marker may be introduced into a host cell on the same vector comprising the sequence encoding the polypeptides of the invention or used in the methods of the invention, or otherwise in a separate vector. For example, cells stably transfected with the incorporated nucleic acid can be identified by selection (for example, cells that have integrated the selection marker survive, whereas other cells die).

Da die Markergene, insbesondere Gene für die Resistenz gegen Antibiotika und Herbizide, in der transgenen Wirtszelle nicht länger erforderlich sind oder ungewünscht sind, sobald die Nukleinsäuren erfolgreich eingebracht worden sind, setzt das erfindungsgemäße Verfahren zum Einbringen von Nukleinsäuren vorteilhafterweise Techniken ein, die die Entfernung oder Abspaltung dieser Markergene ermöglichen. Ein solches Verfahren wird als Cotransformation bezeichnet. Die Cotransformation setzt 2 Vektoren ein, die simultan zur Transformation eingesetzt werden, wobei ein Vektor die erfindungsgemäße Nukleinsäure trägt und der zweite das oder die Markergene trägt. Ein großer Anteil der Transformanten erhält, oder umfasst bei Pflanzen (bis zu 40% oder mehr Transformanten) beide Vektoren. Bei der Transformation mit Agrobakterien erhalten die Transformanten gewöhnlich nur einen Teil des Vektors, d. h. die Sequenz, die von der T-DNA flankiert wird, die gewöhnlich die Expressions-Kassette veranschaulicht. Die Markergene können anschließend aus der transformierten Pflanze durch Kreuzungen entfernt werden. Bei einem anderen Verfahren werden die in ein Transposon integrierten Markergene zur Transformation zusammen mit der gewünschten Nukleinsäure verwendet (was als Ac/Ds-Technologie bekannt ist). Die Transformanten können mit einer Quelle für Transposase gekreuzt werden, oder die Transformanten werden mit einem Nukleinsäure-Konstrukt transformiert, das die transiente oder stabile Expression einer Transposase vermittelt. In einigen Fällen (etwa 10%) springt das Transposon aus dem Genom der Wirtszelle, sobald die Transformation erfolgreich stattgefunden hat und verloren geht. Bei einer weiteren Anzahl von Fällen springt das Transposon an eine andere Stelle. In diesen Fällen muss das Markergen mit Hilfe von Kreuzungen eliminiert werden. In der Mikrobiologie wurden Techniken entwickelt, die den Nachweis solcher Ereignisse ermöglichen oder erleichtern. Ein weiteres vorteilhaftes Verfahren beruht auf sogenannten Rekombinationssystemen, deren Vorteil ist, dass auf die Eliminierung durch Kreuzung verzichtet werden kann. Das am besten bekannte System dieser Art ist als Cre/Iox-System bekannt. Cre1 ist eine Rekombinase, die die zwischen den IoxP-Sequenzen befindlichen Sequenzen entfernt. Ist der Marker zwischen den IoxP-Sequenzen integriert, wird er entfernt, sobald die Transformation erfolgreich stattgefunden hat, durch Expression der Rekombinase. Weitere Rekombinationssysteme sind das HIN/HIX-, FLP/FRT- und REP/STB-System ( Tribble et al., J. Biol. Chem., 275, 2000: 22255–22267 ; Velmurugan et al., J. Cell Biol., 149, 2000: 553–566 ). Die erfindungsgemäßen Nukleinsäuresequenzen können ortsspezifisch in das Pflanzengenom integriert werden. Natürlich können diese Verfahren auch auf Mikroorganismen angewendet werden, wie Hefe, Pilze oder Bakterien.Since the marker genes, in particular genes for antibiotic resistance and herbicides, are no longer required or undesirable in the transgenic host cell once the nucleic acids have been successfully introduced, the nucleic acid delivery method of the present invention advantageously employs techniques involving removal or Allow cleavage of these marker genes. Such a process is called cotransformation. The co-transformation uses 2 vectors, which are used simultaneously for the transformation, wherein one vector carries the nucleic acid according to the invention and the second carries the marker gene (s). A large proportion of the transformants receives, or in the case of plants (up to 40% or more transformants) both vectors. In transformation with Agrobacterium, the transformants usually receive only a portion of the vector, ie, the sequence flanked by the T-DNA, which usually illustrates the expression cassette. The marker genes can then be removed from the transformed plant by crossbreeding. In another method, the marker genes integrated into a transposon are used to transform together with the desired nucleic acid (known as Ac / Ds technology). The transformants can be crossed with a source of transposase, or the transformants are transformed with a nucleic acid construct that mediates the transient or stable expression of a transposase. In some cases (about 10%), the transposon jumps out of the genome of the host cell as soon as the transformation is successful and lost. In a further number of cases, the transposon jumps to another location. In these cases, the marker gene must be eliminated by means of crossbreeding. In microbiology, techniques have been developed that facilitate or facilitate the detection of such events. Another advantageous method is based on so-called recombination systems, the advantage of which is that elimination by crossing can be dispensed with. The best known system of this type is known as the Cre / Iox system. Cre1 is a recombinase that removes the sequences located between the IoxP sequences. If the marker is integrated between the IoxP sequences, it will be removed once the transformation has been successful by expression of the recombinase. Further recombination systems are the HIN / HIX, FLP / FRT and REP / STB systems ( Tribble et al., J. Biol. Chem., 275, 2000: 22255-22267 ; Velmurugan et al., J. Cell Biol., 149, 2000: 553-566 ). The nucleic acid sequences according to the invention can be integrated site-specifically into the plant genome. Of course, these methods can also be applied to microorganisms, such as yeast, fungi or bacteria.

Transgen/transgen/rekombinantTransgenic / transgenic / recombinant

Im Zusammenhang mit der vorliegenden Erfindung bedeutet ”transgen”, ”Transgen” oder ”rekombinant” eine Nukleinsäuresequenz, eine Expressionskassette, ein Genkonstrukt oder einen Vektor, umfassend die Nukleinsäuresequenz oder einen Organismus, der mit den erfindungsgemäßen Nukleinsäuresequenzen, Expressionskassetten oder Vektoren transformiert ist, wobei alle diese Konstrukte mittels rekombinanter Verfahren entstehen, in denen entweder

• (a) die Nukleinsäuresequenzen, die Proteine kodieren, die bei den erfindungsgemäßen Verfahren geeignet sind, oder
• (b) genetische Kontrollsequenz(en) in funktionsfähiger Verknüpfung mit der erfindungsgemäßen Nukleinsäuresequenz, zum Beispiel einem Promotor, oder
• (c) a) und b)

• (a) the nucleic acid sequences encoding proteins useful in the methods of the invention, or
• (B) genetic control sequence (s) in operable linkage with the nucleic acid sequence of the invention, for example a promoter, or
• (c) a) and b)

Unter einen transgenen Pflanze versteht man für erfindungsgemäße Zwecke wie oben, dass die bei dem erfindungsgemäßen Verfahren verwendeten Nukleinsäuren nicht an ihrem natürlichen Locus im Genom dieser Pflanze vorliegen, wobei die Nukleinsäuren homolog oder heterolog exprimiert werden können. Wie erwähnt bedeutet transgen jedoch auch, dass die erfindungsgemäßen Nukleinsäuren oder die Nukleinsäuren, die in dem erfindungsgemäßen Verfahren verwendet werden, zwar in ihrer natürlichen Position im Genom einer Pflanze vorliegen, die Sequenz jedoch in Bezug auf die natürliche Sequenz modifiziert worden ist und/oder dass die Regulationssequenzen der natürlichen Sequenzen modifiziert worden sind. Transgen bedeutet vorzugsweise die Expression der erfindungsgemäßen Nukleinsäuren an einem unnatürlichen Locus in dem Genom, d. h. dass eine homologe, oder vorzugsweise, heterologe Expression der Nukleinsäuren stattfindet. Bevorzugte transgene Pflanzen werden im vorliegenden Text erwähnt.A transgenic plant is understood for purposes according to the invention as above, that the nucleic acids used in the method according to the invention are not present at their natural locus in the genome of this plant, wherein the nucleic acids can be expressed homologously or heterologously. However, as mentioned above, transgene also means that the nucleic acids of the invention or the nucleic acids used in the method of the invention, while in their natural position in the genome of a plant, have been modified in relation to the natural sequence and / or the regulatory sequences of the natural sequences have been modified. Transgene preferably means the expression of the nucleic acids of the invention at an unnatural locus in the genome, i. H. that a homologous, or preferably, heterologous expression of the nucleic acids takes place. Preferred transgenic plants are mentioned herein.

Modulationmodulation

Der Begriff ”Modulation” steht in Bezug auf die Expression oder Genexpression für ein Verfahren, bei dem das Expressionsausmaß durch die Genexpression im Vergleich zu der Kontrollpflanze dahingehend geändert ist, dass das Expressionsausmaß erhöht oder gesenkt ist. Die ursprüngliche unmodulierte Expression kann eine Art Expression einer strukturellen RNA (rRNA, tRNA) oder mRNA mit nachfolgender Translation sein. Der Begriff ”Modulation der Aktivität” bedeutet eine Änderung der Expression der erfindungsgemäßen Nukleinsäuresequenzen oder der kodierten Proteine, die einen verbesserten Ertrag und/oder ein gesteigertes Wachstum der Pflanzen ergibt.The term "modulation" in terms of expression or gene expression refers to a method in which the level of expression by gene expression is altered as compared to the control plant such that the level of expression is increased or decreased. The original unmodulated expression may be a type of expression of a structural RNA (rRNA, tRNA) or mRNA with subsequent translation. The term "modulation of activity" means a change in the expression of the nucleic acid sequences or encoded proteins of the invention which results in improved yield and / or increased plant growth.

Expressionexpression

Der Begriff ”Expression” oder ”Genexpression” steht für die Transkription eines spezifischen Gens oder spezifischer Gene oder eines spezifischen genetischen Konstrukts. Der Begriff ”Expression” oder ”Genexpression” steht insbesondere für die Transkription eines Gens oder mehrerer Gene oder eines genetischen Konstrukts in strukturelle RNA (rRNA, tRNA) oder mRNA mit oder ohne darauffolgende Translation des letzteren in ein Protein. Der Prozess beinhaltet die Transkription der DNA und die Prozessierung des resultierenden mRNA-Produkts.The term "expression" or "gene expression" means the transcription of a specific gene or specific genes or a specific genetic construct. The term "expression" or "gene expression" refers in particular to the transcription of one or more genes or a genetic construct into structural RNA (rRNA, tRNA) or mRNA with or without subsequent translation of the latter into a protein. The process involves transcription of the DNA and processing of the resulting mRNA product.

Erhöhte Expression/ÜberexpressionIncreased expression / overexpression

Der Begriff ”erhöhte Expression” oder ”Überexpression”, wie es hier verwendet wird steht für eine beliebige Form von Expression, die über den Spiegel des ursprünglichen Wildtyp-Spiegel hinaus geht.As used herein, the term "increased expression" or "overexpression" refers to any form of expression that exceeds the level of the original wild-type level.

Verfahren zur Erhöhung der Expression von Genen oder Genprodukten sind im Stand der Technik gut dokumentiert und beinhalten beispielsweise die Überexpression, die durch geeignete Promotoren, die Verwendung von Transkriptions-Enhancern oder Translations-Enhancern getrieben wird. Isolierte Nukleinsäuren, die als Promotor- oder Enhancer-Elemente dienen, können in einer geeigneten Position (gewöhnlich stromaufwärts) einer nicht-heterologen Form eines Polynukleotids eingebracht werden, so dass die Expression einer Nukleinsäure, die das interessierende Polypeptid kodiert, aufwärtsreguliert wird. Endogene Promotoren können beispielsweise in vivo durch Mutation, Deletion und/oder Substitution verändert werden (siehe Kmiec, US 5,565,350 ; Zarling et al., WO 9322443 ), oder isolierte Promotoren können in der korrekten Orientierung und im korrekten Abstand von einem erfindungsgemäßen Gen in eine Pflanzenzelle eingebracht werden, so dass die Expression des Gens gesteuert wird.Methods for increasing the expression of genes or gene products are well documented in the art and include, for example, overexpression driven by suitable promoters, the use of transcriptional enhancers or translation enhancers. Isolated nucleic acids that serve as promoter or enhancer elements may be in a suitable position (usually upstream) of a non-heterologous form of polynucleotide such that expression of a nucleic acid encoding the polypeptide of interest is up-regulated. Endogenous promoters can be altered, for example, in vivo by mutation, deletion and / or substitution (see Kmiec, US 5,565,350 ; Zarling et al. WO 9322443 ), or isolated promoters can be introduced into a plant cell in the correct orientation and at the correct distance from a gene according to the invention, so that the expression of the gene is controlled.

Ist eine Polypeptidexpression gewünscht, wird wünschenswerterweise eine Polyadenylierungsregion am 3'-Ende einer Polynukleotid-kodierenden Region aufgenommen. Die Polyadenylierungsregion kann von dem natürlichen Gen, von einer Anzahl anderer Pflanzengene oder von T-DNA hergeleitet sein. Die hinzuzufügende 3'-Endsequenz kann beispielsweise hergeleitet sein von Nopalinsynthase- oder Octopinsynthase-Genen oder alternativ von einem anderen Pflanzengen oder weniger bevorzugt von einem anderen eukaryotischen Gen.If polypeptide expression is desired, it is desirable to include a polyadenylation region at the 3 'end of a polynucleotide coding region. The polyadenylation region may be derived from the natural gene, from a number of other plant genes, or from T-DNA. The 3 'end sequence to be added may be derived, for example, from nopaline synthase or octopine synthase genes or alternatively from another plant gene or less preferably from another eukaryotic gene.

Eine Intronsequenz kann ebenfalls an der 5'-untranslatierten Region (UTR) oder der kodierenden Sequenz der partiellen kodierenden Sequenz zugegeben werden, um die Menge der reifen Botschaft zu steigern, die sich im Cytosol ansammelt. Die Aufnahme eines spleißbaren Introns in die Transkriptionseinheit in Pflanzen- und Tier-Expressionskonstrukten steigert Befunden zufolge die Genexpression auf mRNA- und Protein-Ebenen bis zu 1000fach ( Buchman and Berg (1988) Mol. Cell biol. 8: 4395–4405 ; Callis et al. (1987) Genes Dev 1: 1183–1200 ). Eine solche Intron-Steigerung der Genexpression ist gewöhnlich am größten, wenn es sich nahe der Transkriptionseinheit befindet. Die Verwendung der Mais-Introns Adh1-S-Intron 1, 2 und 6, das Bronze-1-Intron, sind im Stand der Technik bekannt. Für eine allgemeine Information siehe: The Maize Handbook, Chapter 116, Freeling and Walbot, Eds., Springer, N.Y. (1994) .An intron sequence may also be added at the 5 'untranslated region (UTR) or the coding sequence of the partial coding sequence to increase the amount of mature message that accumulates in the cytosol. The inclusion of a spliceable intron in the transcriptional unit in plant and animal expression constructs has been shown to increase gene expression at mRNA and protein levels up to 1000 fold ( Buchman and Berg (1988) Mol. Cell biol. 8: 4395-4405 ; Callis et al. (1987) Genes Dev 1: 1183-1200 ). Such intron enhancement of gene expression is usually greatest when near the transcription unit. The use of the maize introns Adh1-S intron 1, 2 and 6, the bronze 1 intron, are well known in the art. For general information see: The Maize Handbook, Chapter 116, Freeling and Walbot, Eds., Springer, NY (1994) ,

Verringerte ExpressionDecreased expression

Eine Bezugnahme im vorliegenden Text auf ”verringerte Expression” oder ”Reduktion oder wesentliche Eliminierung” der Expression soll eine Abnahme der endogenen Genexpression und/oder der Polypeptid-Spiegel und/oder Polypeptid-Aktivität im Vergleich zu Kontrollpflanzen bedeuten. Die Reduktion oder wesentliche Eliminierung ist in steigender Reihenfolge der Bevorzugung mindestens 10%, 20%, 30%, 40% oder 50%, 60%, 70%, 80%, 85%, 90%, oder 95%, 96%, 97%, 98%, 99% oder noch mehr im Vergleich zu Kontrollpflanzen.Reference herein to "reduced expression" or "reduction or substantial elimination" of expression is intended to mean a decrease in endogenous gene expression and / or polypeptide levels and / or polypeptide activity relative to control plants. The reduction or substantial elimination is in increasing order of preference at least 10%, 20%, 30%, 40% or 50%, 60%, 70%, 80%, 85%, 90%, or 95%, 96%, 97 %, 98%, 99% or even more compared to control plants.

Für die Reduktion oder wesentliche Eliminierung der Expression eines endogenen Gens in einer Pflanze ist eine hinreichende Länge der im Wesentlichen durchgehenden Nukleotide einer Nukleinsäuresequenz erforderlich. Zur Durchführung von Gensilencing können diese nur 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10 oder weniger Nukleotide betragen, alternativ kann dies sogar das ganze Gen sein (u. a. mit der 5'- und/oder 3'-UTR, und zwar entweder teilweise oder ganz). Der Bereich der im Wesentlichen zusammenhängenden Nukleotide kann von der Nukleinsäure, die das interessierende Protein (Zielgen) kodiert, oder von einer Nukleinsäure hergeleitet werden, die ein Orthologon, Paralogon oder Homologon des interessierenden Proteins kodieren kann. Der Bereich der im Wesentlichen zusammenhängenden Nukleotide kann vorzugsweise mit dem Zielgen Wasserstoffbrückenbindungen eingehen (und zwar entweder mit dem Sense- oder Antisense-Strang), starker bevorzugt hat der Bereich der im Wesentlichen zusammenhängenden Nukleotide in steigender Reihenfolge der Bevorzugung 50%, 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 100% Sequenzidentität zu dem Zielgen (entweder Sense- oder Antisense-Strang). Eine Nukleinsäuresequenz, die ein (funktionelles) Polypeptid kodiert, ist keine Anforderung für die verschiedenen hier erörterten Verfahren für die Reduktion oder wesentliche Eliminierung der Expression eines endogenen Gens.For the reduction or substantial elimination of the expression of an endogenous gene in a plant, a sufficient length of the substantially continuous nucleotides of a nucleic acid sequence is required. To perform gene silencing, these may be only 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10 or less nucleotides, alternatively this may even be the whole gene (inter alia with the 5 'and / or or 3'-UTR, either partially or entirely). The region of substantially contiguous nucleotides may be derived from the nucleic acid encoding the protein of interest (target gene) or from a nucleic acid capable of encoding an orthologue, paralogue or homologue of the protein of interest. The region of substantially contiguous nucleotides may preferably hydrogen bond with the target gene (either with the sense or antisense strand), more preferably, the region of substantially contiguous nucleotides in increasing order of preference has 50%, 60%, 70 %, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 100% sequence identity to the target gene (either sense or antisense strand). A nucleic acid sequence encoding a (functional) polypeptide is not a requirement for the various methods discussed herein for the reduction or substantial elimination of the expression of an endogenous gene.

Diese Reduktion oder wesentliche Eliminierung der Expression kann mit Routine-Werkzeugen und -Techniken erzielt werden. Ein bevorzugtes Verfahren zur Reduktion oder wesentlichen Eliminierung der endogenen Genexpression erfolgt durch Einbringen und Exprimieren eines Genkonstruktes, in das die Nukleinsäure (in diesem Fall ein Bereich von im Wesentlichen zusammenhängenden Nukleotiden, die von dem interessierenden Gen abstammen, oder von einer beliebigen Nukleinsäure, die ein Orthologon, Paralogon oder Homologon von einem der interessierenden Proteine kodieren kann) als inverted Repeat (teilweise oder ganz), getrennt durch einen Spacer (nicht-kodierende DNA) kloniert wird, in einer Pflanze.This reduction or substantial elimination of expression can be achieved with routine tools and techniques. A preferred method of reducing or substantially eliminating endogenous gene expression is by introducing and expressing a gene construct into which the nucleic acid (in this case, a region of substantially contiguous nucleotides derived from the gene of interest, or any nucleic acid encoding a nucleic acid) Orthologue, paralogue or homologue of one of the proteins of interest) as an inverted repeat (partially or wholly), cloned separately by a spacer (non-coding DNA) in a plant.

In einem solchen bevorzugten Verfahren wird die Expression des endogenen Gens reduziert oder im Wesentlichen eliminiert durch RNA-vermitteltes Silencing mit einem inverted Repeat einer Nukleinsäure oder einem Teil davon (in diesem Fall einem Bereich von im Wesentlichen zusammenhängenden Nukleotiden, die von dem interessierenden Gen hergeleitet sind, oder von einer beliebigen Nukleinsäure, die ein Orthologon, Paralogon oder Homologon des interessierenden Proteins kodieren kann), der eine Hairpin-Struktur bilden kann. Der inverted repeat wird in einen Expressionsvektor kloniert, der Kontrollsequenzen umfasst. Eine nichtkodierende DNA-Nukleinsäuresequenz (ein Spacer, beispielsweise ein Fragment der Matrixbindungsregion (matrix attachment region fagment (MAR)), ein Intron, ein Polylinker, etc.) befindet sich zwischen den beiden invertierten Nukleinsäuren, die den inverted Repeat bilden. Nach der Transkription des inverted repeats wird eine chimäre RNA mit einer selbstkomplementären Struktur gebildet (teilweise oder vollständig). Diese doppelsträngige RNA-Struktur wird als Hairpin-RNA (hpRNA) bezeichnet. Die hpRNA wird durch die Pflanze in siRNAs prozessiert, die in einen RNA-induzierten Silencing-Komplex eingebracht sind (RISC). Der RISC spaltet zudem die mRNA-Transkripte, wodurch im Wesentlichen die Anzahl der mRNA-Transkripte, die in Polypeptide translatiert werden sollen, reduziert wird. Für weitere allgemeine Einzelheiten können beispielsweise Grierson et al. (1998) WO 98/53083 ; Waterhouse et al. (1999) WO 99/53050 ) herangezogen werden.In such a preferred method, expression of the endogenous gene is reduced or substantially eliminated by RNA-mediated silencing with an inverted repeat of a nucleic acid or part thereof (in this case, a region of substantially contiguous nucleotides derived from the gene of interest , or any nucleic acid capable of encoding an orthologue, paralogue or homologue of the protein of interest) that form a hairpin structure can. The inverted repeat is cloned into an expression vector comprising control sequences. A non-coding DNA nucleic acid sequence (a spacer, such as a matrix attachment region fragment (MAR) fragment, an intron, a polylinker, etc.) is located between the two inverted nucleic acids that form the inverted repeat. After transcription of the inverted repeats, a chimeric RNA having a self-complementary structure is formed (partially or completely). This double-stranded RNA structure is called hairpin RNA (hpRNA). The hpRNA is processed by the plant into siRNAs introduced into an RNA-induced silencing complex (RISC). The RISC also cleaves the mRNA transcripts, thereby substantially reducing the number of mRNA transcripts to be translated into polypeptides. For further general details, for example, Grierson et al. (1998) WO 98/53083 ; Waterhouse et al. (1999) WO 99/53050 ) are used.

Die Leistungsfähigkeit der erfindungsgemäßen Verfahren beruht nicht auf der Einbringung und Expression eines Genkonstrukts, in das die Nukleinsäure als inverted Repeat kloniert wurde, in eine bzw. einer Pflanze, aber eine oder mehrere einiger bekannter ”Gen-Silencing”-Verfahren kann bzw. können zur Erzielung der gleichen Effekte verwendet werden.The performance of the methods of the invention is not due to the introduction and expression of a gene construct into which the nucleic acid has been cloned as an inverted repeat into a plant, but one or more of some known gene silencing methods may be used Achieving the same effects can be used.

Ein solches Verfahren zur Reduktion der endogenen Genexpression ist das RNA-vermittelte Silencing der Genexpression (Abwärtsregulation). Das Silencing wird in diesem Fall in einer Pflanze durch eine doppelsträngige RNA-Sequenz (dsRNA) getriggert, die dem endogenen Zielgen im Wesentlichen ähnelt. Diese dsRNA wird weiter durch die Pflanze in etwa 20 bis etwa 26 Nukleotide prozessiert, die als kurze interferierende RNAs (short interfering RNAs (siRNAs)) bezeichnet werden. Die siRNAs werden in einen RNA-induzierten Silencing-Komplex (RISC) eingebracht, der das mRNA-Transkript des endogenen Zielgens spaltet, wodurch die Anzahl der zu einem Polypeptid zu translatierenden mRNA-Transkripte verringert wird. Die doppelsträngige RNA-Sequenz entspricht einem Zielgen.One such method of reducing endogenous gene expression is RNA-mediated silencing of gene expression (downregulation). Silencing in this case is triggered in a plant by a double-stranded RNA sequence (dsRNA) that is substantially similar to the endogenous target gene. This dsRNA is further processed by the plant in about 20 to about 26 nucleotides, referred to as short interfering RNAs (siRNAs). The siRNAs are introduced into an RNA-induced silencing complex (RISC) which cleaves the mRNA transcript of the endogenous target gene, thereby reducing the number of mRNA transcripts to be translated into a polypeptide. The double-stranded RNA sequence corresponds to a target gene.

Ein weiteres Beispiel für ein RNA-Silencing-Verfahren beinhaltet die Einbringung von Nukleinsäure-Sequenzen oder Teilen davon (in diesem Fall ein Bereich von im Wesentlichen zusammenhängenden Nukleotiden, die von dem interessierenden Gen hergeleitet sind, oder von einer beliebigen Nukleinsäure, die ein Orthologon, Paralogon oder Homologon des interessierenden Proteins kodieren kann) in einer Sense-Orientierung in eine Pflanze. ”Sense-Orientierung” betrifft eine DNA-Sequenz, die zu einem mRNA-Transkript davon homolog ist. In eine Pflanze wird daher mindestens eine Kopie der Nukleinsäuresequenz eingebracht. Die zusätzliche Nukleinsäure verringert die Expression des endogenen Gens, was ein Phänomen erzeugt, das als Co-Suppression bezeichnet wird. Die Reduktion der Genexpression wird ausgeprägter, wenn mehrere zusätzliche Kopien einer Nukleinsäuresequenz in die Pflanze eingebracht werden, da es eine positive Korrelation zwischen hohen Transkriptspiegeln und dem Triggern der Co-Suppression gibt.Another example of an RNA silencing method involves the introduction of nucleic acid sequences or parts thereof (in this case, a region of substantially contiguous nucleotides derived from the gene of interest, or any nucleic acid containing an orthologue, Paralogon or homologue of the protein of interest) in a sense orientation into a plant. "Sense orientation" refers to a DNA sequence that is homologous to a mRNA transcript thereof. Therefore, at least one copy of the nucleic acid sequence is introduced into a plant. The additional nucleic acid decreases the expression of the endogenous gene, creating a phenomenon called co-suppression. The reduction in gene expression becomes more pronounced when several additional copies of a nucleic acid sequence are introduced into the plant, as there is a positive correlation between high transcript levels and the triggering of co-suppression.

Ein weiteres Beispiel für ein RNA-Silencing-Verfahren beinhaltet die Verwendung von Antisense-Nukleinsäuresequenzen. Eine ”Antisense”-Nukleinsäuresequenz umfasst eine Nukleotid-Sequenz, die zu einer ”Sense”-Nukleinsäuresequenz, die ein Protein kodiert, komplementär ist, d. h. komplementär zum kodierenden Strang eines doppelsträng gen cDNA-Moleküls oder komplementär zu einer mRNA-Transkriptsequenz. Die Antisense-Nukleinsäuresequenz ist vorzugsweise komplementär zu dem zu silencenden endogenen Gen. Die Komplementarität kann sich in der ”kodierenden Region” und/oder in der ”nicht-kodierenden Region” eines Gens befinden. Der Begriff ”kodierende Region” betrifft eine Region der Nukleotidsequenz, die Codons umfasst, die zu Aminosäureresten translatiert werden. Der Begriff ”nicht kodierende Region” betrifft 5'- und 3'-Sequenzen, die die kodierende Region flankieren, die transkribiert, aber nicht zu Aminosäuren translatiert werden (und die auch als 5'- und 3'-untranslatierte Regionen bezeichnet werden).Another example of an RNA silencing method involves the use of antisense nucleic acid sequences. An "antisense" nucleic acid sequence comprises a nucleotide sequence that is complementary to a "sense" nucleic acid sequence encoding a protein, d. H. complementary to the coding strand of a double-stranded gene cDNA molecule or complementary to an mRNA transcript sequence. The antisense nucleic acid sequence is preferably complementary to the endogenous gene to be silenced. The complementarity may be in the "coding region" and / or in the "noncoding region" of a gene. The term "coding region" refers to a region of the nucleotide sequence that includes codons that are translated to amino acid residues. The term "non-coding region" refers to 5 'and 3' sequences flanking the coding region that are transcribed but not translated into amino acids (and also referred to as 5 'and 3' untranslated regions).

Antisense-Nukleinsäuresequenzen können gemäß der Basenpaarungsregeln von Watson und Crick entwickelt werden. Die Antisense-Nukleinsäuresequenz kann komplementär zur gesamten Nukleinsäuresequenz sein (in diesem Fall ein Bereich von im Wesentlichen zusammenhängenden Nukleotiden, die von dem interessierenden Gen hergeleitet sind, oder von einer beliebigen Nukleinsäure, die ein Orthologon, Paralogon oder Homologon des interessierenden Proteins kodieren kann), kann aber auch ein Oligonukleotid sein, das nur zu einem Teil der Nukleinsäuresequenz Antisense-Orientierung aufweist (wie auch mRNA 5' und 3' UTR). Die Antisense-Oligonukleotidsequenz kann beispielsweise komplementär zu der Region sein, die die Translationsstartstelle eines mRNA-Transkripts umgibt, das ein Polypeptid kodiert. Die Länge einer geeigneten Antisense-Oligonukleotid-Sequenz ist im Stand der Technik bekannt und kann bei etwa 50, 45, 40, 35, 30, 25, 20, 15 oder 10 Nukleotiden Länge oder weniger beginnen. Eine erfindungsgemäße Antisense-Nukleinsäuresequenz kann durch chemische Synthese und enzymatische Ligationsreaktionen mit Verfahren des Standes der Technik konstruiert werden. Eine Antisense-Nukleinsäuresequenz (beispielsweise eine Antisense-Oligonukleotid-Sequenz) kann beispielsweise chemisch synthetisiert werden, wobei natürlich vorkommende Nukloeotide oder verschiedene modifizierte Nukleotide verwendet werden, die dazu ausgelegt sind, dass die biologische Stabilität der Moleküle oder die physikalische Stabilität des Doppelstrangs erhöht wird, der zwischen den Antisense- und den Sense-Nukleinsäuresequenzen gebildet wird, beispielsweise können Phosphorthioat-Derivate und acridinsubstituierte Nukleotide verwendet werden. Beispiele für modifizierte Nukleotide, die sich zur Erzeugung von Antisense-Nukleinsäuresequenzen verwenden lassen, sind im Stand der Technik bestens bekannt. Bekannte Nukleotid-Modifikationen umfassen, Methylierung, Cyclisierung und 'Caps' sowie die Substitution von einer oder mehreren der natürlich vorkommenden Nukleotide mit einem Analogon, wie Inosin. Andere Modifikationen von Nukleotiden sind im Stand der Technik bekannt.Antisense nucleic acid sequences can be developed according to the base pairing rules of Watson and Crick. The antisense nucleic acid sequence may be complementary to the entire nucleic acid sequence (in this case, a region of substantially contiguous nucleotides derived from the gene of interest, or any nucleic acid capable of encoding an orthologue, paralogue, or homologue of the protein of interest), However, it can also be an oligonucleotide which has antisense orientation only to a part of the nucleic acid sequence (as well as mRNA 5 'and 3' UTR). For example, the antisense oligonucleotide sequence may be complementary to the region surrounding the translation start site of an mRNA transcript encoding a polypeptide. The length of a suitable antisense oligonucleotide sequence is known in the art and may begin at about 50, 45, 40, 35, 30, 25, 20, 15 or 10 nucleotides in length or less. An antisense nucleic acid sequence of the present invention may be constructed by chemical synthesis and enzymatic ligation reactions using methods known in the art. For example, an antisense nucleic acid sequence (for example, an antisense oligonucleotide sequence) can be chemically synthesized, with naturally occurring ones Nucloeotides or various modified nucleotides designed to enhance the biological stability of the molecules or the physical stability of the duplex formed between the antisense and sense nucleic acid sequences, for example, phosphorothioate derivatives and acridine-substituted nucleotides may be used become. Examples of modified nucleotides that can be used to generate antisense nucleic acid sequences are well known in the art. Known nucleotide modifications include, methylation, cyclization and 'caps', and the substitution of one or more of the naturally occurring nucleotides with an analog, such as inosine. Other modifications of nucleotides are known in the art.

Die Antisense-Nukleinsäuresequenz kann biologisch produziert werden mit einem Expressionsvektor, in den eine Nukleinsäuresequenz in Antisense-Orientierung subkloniert wurde (d. h. RNA, die aus der eingefügten Nukleinsäure transkribiert wurde, ist zu einer interessierenden Ziel-Nukleinsäure in Antisense-Orientierung). Die Produktion der Antisense-Nukleinsäuresequenzen in Pflanzen erfolgt vorzugsweise durch ein stabil integriertes Nukleinsäure-Konstrukt, das einen Promotor, ein funktionsfähig verknüpftes Antisense-Oligonukleotid und einen Terminator umfasst.The antisense nucleic acid sequence can be produced biologically with an expression vector into which a nucleic acid sequence has been subcloned in antisense orientation (i.e., RNA transcribed from the inserted nucleic acid is in antisense orientation to a target nucleic acid of interest). The production of antisense nucleic acid sequences in plants is preferably carried out by a stably integrated nucleic acid construct comprising a promoter, a functionally linked antisense oligonucleotide and a terminator.

Die Nukleinsäuremoleküle, die in den erfindungsgemäßen Verfahren zum Silencen verwendet werden (unabhängig davon, ob sie in eine Pflanze eingebracht wurden, oder in situ erzeugt wurden), hybridisieren mit oder binden an mRNA-Transkripte und/oder genomische DNA, die ein Polypeptid kodiert, wodurch die Expression des Proteins gehemmt wird, beispielsweise durch Hemmen der Transkription und/oder Translation. Die Hybridisierung kann durch konventionelle Nukleotid-Komplementarität erfolgen, so dass man einen stabilen Doppelstrang erhält, oder beispielsweise im Falle einer Antisense-Nukleinsäuresequenz, die an DNA-Doppelstränge bindet, über spezifische Wechselwirkungen in der großen Furche der Doppelhelix. Antisense-Nukleinsäuresequenzen können durch Transformation oder direkte Injektion an einer bestimmten Gewebestelle in eine Pflanze eingebracht werden. Alternativ können die Antisense-Nukleinsäuresequenzen zum Anzielen ausgewählter Zellen modifiziert werden und dann systemisch verabreicht werden. Zur systemischen Verabreichung können die Antisense-Nukleinsäuresequenzen derart modifiziert werden, dass sie spezifisch an Rezeptoren oder Antigene binden, die auf einer ausgewählten Zelloberfläche exprimiert werden, beispielsweise durch Verknüpfen der Antisense-Nukleinsäuresequenz an Peptide oder Antikörper, die an Zelloberflächenrezeptoren oder Antigene binden. Die Antisense-Nukleinsäuresequenzen können auch auf Zellen übertragen werden, und zwar mit den hier beschriebenen Vektoren.The nucleic acid molecules used in the methods of the invention for silencing (whether introduced into a plant or generated in situ) hybridize with or bind to mRNA transcripts and / or genomic DNA encoding a polypeptide, whereby the expression of the protein is inhibited, for example by inhibiting transcription and / or translation. Hybridization may be by conventional nucleotide complementarity to give a stable duplex or, for example, in the case of an antisense nucleic acid sequence that binds to DNA duplexes via specific interactions in the major groove of the double helix. Antisense nucleic acid sequences can be introduced into a plant by transformation or direct injection at a particular tissue site. Alternatively, the antisense nucleic acid sequences for targeting selected cells can be modified and then administered systemically. For systemic administration, the antisense nucleic acid sequences may be modified to specifically bind to receptors or antigens expressed on a selected cell surface, for example by linking the antisense nucleic acid sequence to peptides or antibodies that bind to cell surface receptors or antigens. The antisense nucleic acid sequences can also be transferred to cells with the vectors described herein.

Gemäß einem weiteren Aspekt ist die Antisense-Nukleinsäuresequenz eine a-anomere Nukleinsäuresequenz. Eine a-anomere Nukleinsäuresequenz bildet spezifische doppelständige Hybride mit komplementärer RNA, in der im Gegensatz zu den üblichen b-Einheiten die Stränge parallel zueinander verlaufen ( Gaultier et al. (1987) Nucl Ac Res 15: 6625–6641 ). Die Antisense-Nukleinsäuresequenz kann auch ein 2'-o-Methylribonukleotid ( Inoue et al. (1987) Nucl Ac Res 15, 6131–6148 ) oder ein chimäres RNA-DNA-Analogon umfassen ( Inoue et al. (1987) FEBS Lett. 215, 327–330 ).In another aspect, the antisense nucleic acid sequence is an a-anomeric nucleic acid sequence. An a-anomeric nucleic acid sequence forms specific double-ended hybrids with complementary RNA, in which the strands run parallel to one another in contrast to the customary b-units ( Gaultier et al. (1987) Nucl Ac Res 15: 6625-6641 ). The antisense nucleic acid sequence can also be a 2'-o-methylribonucleotide ( Inoue et al. (1987) Nucl. Ac. Res. 15, 6131-6148 ) or a chimeric RNA-DNA analogue ( Inoue et al. (1987) FEBS Lett. 215, 327-330 ).

Die Reduktion oder wesentliche Eliminierung der endogenen Genexpression kann auch mit Ribozymen durchgeführt werden. Die Ribozyme sind katalytische RNA-Moleküle mit Ribonuklease-Aktivität, die eine einzelsträngige Nukleinsäuresequenz spalten können, wie eine mRNA, zu der sie eine komplementäre Region aufweisen. Somit können Ribozyme (beispielsweise Hammerkopf-Ribozyme (beschrieben in Haselhoff and Gerlach (1988) Nature 334, 585–591 ) zur katalytischen Spaltung von mRNA-Transkripter verwendet werden, die ein Polypeptid kodieren, wodurch die Anzahl der mRNA-Transkripte, die in ein Polypeptid translatiert werden sollen, erheblich verringert wird. Ein Ribozym mit Spezifität für eine Nukleinsäuresequenz kann entwickelt werden (siehe beispielsweise: Cech et al. U.S. Patent No. 4,987,071 ; und Cech et al. U.S. Patent No. 5,116,742 ). Alternativ können mRNA-Transkripte, die einer Nukleinsäuresequenz entsprechen, zur Auswahl einer katalytischen mRNA mit einer spezifischen Ribonukleaseaktivität aus einem Pool von RNA-Molekülen ausgewählt werden ( Bartel and Szostak (1993) Science 261, 1411–1418 ). Die Verwendung von Ribozymen zum Gen-Silencing ist im Stand der Technik bekannt (beispielsweise Atkins et al. (1994) WO 94/00012 ; Lenne et al. (1995) WO 95/03404 ; Lutziger et al. (2000) WO 00/00619 ; Prinsen et al. (1997) WO 97/13865 und Scott et al. (1997) WO 97/38116 ).The reduction or substantial elimination of endogenous gene expression can also be carried out with ribozymes. The ribozymes are catalytic RNA molecules with ribonuclease activity that can cleave a single-stranded nucleic acid sequence, such as an mRNA, to which they have a complementary region. Thus, ribozymes (for example, hammerhead ribozymes (described in U.S. Pat Haselhoff and Gerlach (1988) Nature 334, 585-591 ) are used for the catalytic cleavage of mRNA transcripts encoding a polypeptide, thereby significantly reducing the number of mRNA transcripts to be translated into a polypeptide. A ribozyme with specificity for a nucleic acid sequence can be developed (see, for example: Cech et al. US Pat. 4,987,071 ; and Cech et al. US Pat. 5,116,742 ). Alternatively, mRNA transcripts corresponding to a nucleic acid sequence may be selected for selection of a catalytic mRNA having a specific ribonuclease activity from a pool of RNA molecules ( Bartel and Szostak (1993) Science 261, 1411-1418 ). The use of ribozymes for gene silencing is known in the art (e.g., Atkins et al., 1994). WO 94/00012 ; Lenne et al. (1995) WO 95/03404 ; Lutziger et al. (2000) WO 00/00619 ; Prinsen et al. (1997) WO 97/13865 and Scott et al. (1997) WO 97/38116 ).

Das Gensilencing kann ebenfalls durch Insertionsmutagenese erzielt (beispielsweise T-DNA-Insertion oder Transposon-Insertion) oder durch Strategien, wie sie u. a. von Angell and Baulcombe ((1999) Plant J 20(3): 357–62 ), (Amplicon VIGS WO 98/36083 ), oder Baulcombe ( WO 99/15682 ) beschrieben wurden.Gene silencing can also be achieved by insertion mutagenesis (for example, T-DNA insertion or transposon insertion) or by strategies such as those described in US Pat Angell and Baulcombe ((1999) Plant J 20 (3): 357-62 ), (Amplicon VIGS WO 98/36083 ), or Baulcombe ( WO 99/15682 ).

Das Gensilencing kann auch erfolgen, wenn eine Mutation an einem endogenem Gen und/oder eine Mutation an einem isolierten Gen bzw. einer isolierten Nukleinsäure vorliegt, die anschließend in eine Pflanze eingeführt wird. Die Reduktion oder wesentliche Eliminierung kann durch ein nicht-funktionelles Polypeptid verursacht werden. Das Polypeptid kann beispielsweise an verschiedene wechselwirkende Proteine binden; eine oder mehrere Mutationen und/oder Verkürzungen können daher ein Polypeptid bereitstellen, das noch an wechselwirkende Proteine binden kann (wie Rezeptorproteine), die aber ihre normale Funktion nicht ausüben können (beispielsweise als signalgebender Ligand).Gene silencing may also be performed if there is a mutation on an endogenous gene and / or a mutation on an isolated gene or nucleic acid, which is subsequently transformed into a plant is introduced. The reduction or substantial elimination may be caused by a non-functional polypeptide. For example, the polypeptide can bind to various interacting proteins; therefore, one or more mutations and / or truncations may provide a polypeptide that can still bind to interacting proteins (such as receptor proteins) but that can not perform their normal function (for example, as a signaling ligand).

Ein weiterer Ansatz zum Gensilencing ist durch Anzielen von Nukleinsäuresequenzen, die zur regulatorischen Region des Gens komplementär sind (beispielsweise Promotor und/oder Enhancer), so dass dreifach helikale Strukturen erzeugt werden, die die Transkription des Gens in Zielzellen verhindern. Siehe Helene, C., Anticancer Drug Res. 6, 569–84, 1991 ; Helene et al., Ann. N.Y. Acad. Sci. 660, 27–36 1992 ; und Maher, L.J. Bioassays 14, 807–15, 1992 .Another approach to gene silencing is by targeting nucleic acid sequences that are complementary to the regulatory region of the gene (eg, promoter and / or enhancer) to generate triply helical structures that prevent transcription of the gene into target cells. Please refer Helene, C., Anticancer Drug Res. 6, 569-84, 1991 ; Helene et al., Ann. NY Acad. Sci. 660, 27-36 1992 ; and Maher, LJ Bioassays 14, 807-15, 1992 ,

Andere Verfahren, wie die Verwendung von Antikörpern gegen ein endogenes Polypeptid zur Hemmung seiner Funktion in Pflanzen oder die Interferenz in dem Signalweg, an dem ein Polypeptid beteiligt ist, sind dem Fachmann bestens bekannt. Es kann insbesondere angestrebt werden, dass sich von Menschenhand gemachte Moleküle zur Hemmung der biologischen Funktion eines Ziel-Polypeptids oder zum Eingreifen in den Signalweg, an dem das Ziel-Polypeptid beteiligt ist, eignen.Other methods, such as the use of antibodies to an endogenous polypeptide to inhibit its function in plants or the interference in the pathway in which a polypeptide participates, are well known to those skilled in the art. In particular, it may be desirable for man-made molecules to be useful for inhibiting the biological function of a target polypeptide or interfering with the signaling pathway involving the target polypeptide.

Alternativ kann ein Screening-Programm aufgestellt werden, mit dem man in einer Pflanze die natürlichen Genvarianten identifiziert, wobei die Varianten Polypeptide mit reduzierter Aktivität kodieren. Solche natürlichen Varianten können auch beispielsweise zur Durchführung einer homologen Rekombination verwendet werden.Alternatively, a screening program can be set up to identify the natural gene variants in a plant, the variants encoding polypeptides with reduced activity. Such natural variants can also be used, for example, to carry out homologous recombination.

Künstliche und/oder natürliche mikroRNAs (miRNAs) können zum Knockout der Genexpression und/oder mRNA-Translation verwendet werden. Endogene miRNAs sind einzelsträngige kleine RNAs mit gewöhnlich 19 bis 24 Nukleotiden Länge. In erster Linie regulieren sie die Genexpression und/oder mRNA-Translation. Die meisten Pflanzen-mikroRNAs (miRNAs) haben eine perfekte oder nahezu perfekte Komplementarität zu ihren Zielsequenzen. Es gibt jedoch natürliche Ziele mit bis zu 5 Mismatches. Sie werden aus längeren nicht-kodierenden RNAs mit charakteristischen Rückfaltungsstrukturen durch doppelstrangspezifische RNAsen der Dicer-Familie prozessiert. Bei der Prozessierung werden sie durch Bindung an ihre Hauptkomponente, ein Argonaut-Protein, in den RNA-induzierten Silencing-Komplex (RISC) eingebracht. MiRNAs wirken als Spezifitäts-Komponenten von RISC), da sie mit Ziel-Nukleinsäuren, meist mRNAs im Cytoplasma Basenpaare eingehen. Nachfolgende Regulationsereignisse umfassen Ziel-mRNA-Spaltung und die Zerstörung und/oder translationale Hemmung. Die Effekte der miRNA-Überexpression spiegeln sich somit oft in verringerten mRNA-Spiegeln der Zielgene wider.Artificial and / or natural microRNAs (miRNAs) can be used to knock out gene expression and / or mRNA translation. Endogenous miRNAs are single-stranded small RNAs, usually 19 to 24 nucleotides in length. First and foremost, they regulate gene expression and / or mRNA translation. Most plant microRNAs (miRNAs) have perfect or near-perfect complementarity to their target sequences. However, there are natural targets with up to 5 mismatches. They are processed from longer noncoding RNAs with characteristic refolding structures by double-strand-specific RNAs of the Dicer family. During processing, they are introduced into the RNA-induced silencing complex (RISC) by binding to their main component, an argonaut protein. MiRNAs act as specificity components of RISC) because they base pairs with target nucleic acids, mostly mRNAs in the cytoplasm. Subsequent regulatory events include target mRNA cleavage and destruction and / or translational inhibition. The effects of miRNA overexpression are thus often reflected in reduced mRNA levels of the target genes.

Künstliche mikroRNAs (amiRNAs), die gewöhnlich 21 Nukleotide lang sind, können genetisch modifiziert werden, so dass sie die Genexpression einzelner oder multipler interessierender Gene negativ regulieren. Determinanten der Pflanzen-mikroRNA-Zielselektion sind im Stand der Technik bestens bekannt. Empirische Parameter zur Zielerkennung wurden definiert und können zur Unterstützung der Aufmachung spezifischer amiRNAs verwendet werden ( Schwab et al., Dev. Cell 8, 517–527, 2005 ). Herkömmliche Werkzeuge zur Aufmachung und Erzeugung von amiRNAs und ihrer Vorstufen sind ebenfalls öffentlich zugänglich ( Schwab et al., Plant Cell 18, 1121–1133, 2006 ).Artificial microRNAs (amiRNAs), usually 21 nucleotides long, can be genetically modified to negatively regulate gene expression of single or multiple genes of interest. Determinants of plant microRNA target selection are well known in the art. Empirical parameters for targeting have been defined and may be used to support the presentation of specific amiRNAs ( Schwab et al., Dev. Cell 8, 517-527, 2005 ). Conventional tools for the presentation and generation of amiRNAs and their precursors are also publicly available ( Schwab et al., Plant Cell 18, 1121-1133, 2006 ).

Für eine optimale Leistung erfordern die Gensilencing-Techniken, die zur Reduktion der Expression in einer Pflanze eines endogenen Gens verwendet werden, die Verwendung von Nukleinsäuresequenzen aus monokotylen Pflanzen zur Transformation monokotyler Pflanzen und aus dikotylen Pflanzen zur Transformation dikotyler Pflanzen. Vorzugsweise wird eine Nukleinsäuresequenz aus einer gegebenen Pflanzenart in die gleiche Pflanzenart eingebracht. Beispielsweise wird eine Nukleinsäuresequenz aus Reis in eine Reispflanze transformiert. Es ist jedoch kein absolutes Erfordernis, dass die einzubringende Nukleinsäuresequenz aus der gleichen Pflanzenart stammt wie die Pflanze, in die sie eingebracht wird. Es reicht, wenn eine wesentliche Homologie zwischen endogenem Zielgen und der einzubringenden Nukleinsäure vorliegt.For optimal performance, gene silencing techniques used to reduce expression in a plant of an endogenous gene require the use of nucleic acid sequences from monocotyledonous plants to transform monocotyledonous plants and from dicotyledonous plants to transform dicotyledonous plants. Preferably, a nucleic acid sequence from a given plant species is introduced into the same plant species. For example, a nucleic acid sequence from rice is transformed into a rice plant. However, it is not an absolute requirement that the nucleic acid sequence to be introduced comes from the same plant species as the plant into which it is introduced. It is sufficient if there is a substantial homology between the endogenous target gene and the nucleic acid to be introduced.

Vorstehend sind Beispiele für verschiedene Verfahren zur Verringerung oder wesentlichen Eliminierung der Expression eines endogenen Gens in einer Pflanze beschrieben. Der Fachmann kann leicht die vorstehend genannten Verfahren zum Silencing so anpassen, dass die Reduktion der Expression eines endogenen Gens in einer vollständigen Pflanze oder in Teilen davon durch die Verwendung beispielsweise eines geeigneten Promotors erzielt wird.The foregoing describes examples of various methods for reducing or substantially eliminating the expression of an endogenous gene in a plant. One skilled in the art can readily adapt the above silencing methods to achieve the reduction of expression of an endogenous gene in a whole plant or in parts thereof through the use of, for example, a suitable promoter.

Transformation transformation

Der Begriff ”Einführung” oder ”Transformation” umfasst im vorliegenden Zusammenhang den Transfer eines Fremdpolynukleotids in eine Wirtszelle, und zwar unabhängig von dem für den Transfer eingesetzten Verfahren. Pflanzengewebe, das entweder durch Organogenese oder Embryogenese zu einer anschließenden klonalen Vermehrung befähigt ist, kann mit einem erfindungsgemäßen Genkonstrukt transformiert werden, und daraus kann eine ganze Pflanze regeneriert werden. Das jeweils ausgewählte Gewebe hängt von den jeweiligen klonalen Vermehrungssytemen ab, die für die jeweilige zu transformierende Art verfügbar und am besten geeignet sind. Zu Zielgeweben gehören zum Beispiel Blattscheiben, Pollen, Embryonen, Kotyledonen, Hypokotyle, Megagametophyten, Kallusgewebe, existierendes Meristemgewebe (z. B. Apikalmeristem, Achelknospen und Wurzelmeristeme) und induziertes Meristemgewebe (z. B. Kotyledonenmeristem und Hypokotylmeristem). Das Polynukleotid kann in eine Wirtszelle transient oder stabil eingeführt werden und kann in nichtintegrierter Form, zum Beispiel als Plasmid, aufrechterhalten werden. Es kann jedoch auch in das Wirtsgenom integriert werden. Mit den erhaltenen transformierten Pflanzenzellen kann man dann eine transformierte Pflanze auf dem Fachmann bekannte Art und Weise regenerieren.The term "introduction" or "transformation" as used herein includes the transfer of a foreign polynucleotide into a host cell, regardless of the method used for the transfer. Plant tissue, which is capable of subsequent clonal propagation either by organogenesis or embryogenesis, can be transformed with a gene construct of the invention, and from this an entire plant can be regenerated. The particular tissue selected will depend on the particular clonal propagation systems that are available and most suitable for the particular species to be transformed. Target tissues include, for example, leaf disks, pollen, embryos, cotyledons, hypocotyls, megagametophytes, callus tissue, existing meristem tissue (eg, apical meristems, achy buds, and root meristems), and induced meristem tissue (eg, cotyledon meristem and hypocotyl meristem). The polynucleotide may be transiently or stably introduced into a host cell and may be maintained in unintegrated form, for example as a plasmid. However, it can also be integrated into the host genome. The transformed plant cells obtained can then be used to regenerate a transformed plant in a manner known to the person skilled in the art.

Die Übertragung von Fremdgenen in das Genom einer Pflanze wird als Transformation bezeichnet. Die Transformation von Pflanzenarten ist eine Technik, die mittlerweile ziemlich routinemäßig erfolgt. Um das interessierende Gen in eine geeignete Vorfahrenzelle einzuführen, kann vorteilhafterweise irgendeine von verschiedenen Transformationsmethoden eingesetzt werden. Die für die Transformation und Regeneration von Pflanzen aus Pflanzengeweben oder Pflanzenzellen beschriebenen Methoden können für die transiente oder für die stabile Transformation eingesetzt werden. Zu Transformationsverfahren gehören die Verwendung von Liposomen, die Elektroporation, Chemikalien, die die freie DNA-Aufnahme verstärken, die Injektion der DNA direkt in die Pflanze, der Teilchenkanonenbeschuss, die Transformation mit Viren oder Pollen und die Mikroprojektion. Die Verfahren können ausgewählt werden aus: Calcium/Polyethylenglycol-Verfahren für Protoplasten ( Krens, F. A. et al., (1982). Nature 296, 72–74 ; Negrutiu I et al., (1987), Plant Mol. Biol. 8: 363–373 ); Elektroporation von Protoplasten ( Shillito R. D. et al., (1985), Bio/Technol. 3, 1099–1102 ); Mikroinjektion in Pflanzenmaterial ( Crossway A et al., (1986), Mol. Gen. Genet. 202: 179–185 ); Beschuss mit DNA- oder RNA-beschichteten Partikeln ( Klein TM et al., (1987), Nature 327: 70 ), Infektion mit (nichtintegrierenden) Viren und dergleichen. Transgene Pflanzen, darunter auch transgene Kulturpflanzen, werden vorzugsweise mittels Agrobacterium-vermittelter Transformation erzeugt. Ein vorteilhaftes Transformationsverfahren ist die Transformation in Pflanzen. Zu diesem Zweck kann man zum Beispiel die Agrobakterien auf Pflanzensamen einwirken lassen oder das Pflanzenmeristem mit Agrobakterien beimpfen. Erfindungsgemäß hat sich besonders günstig erwiesen, eine Suspension von transformierten Agrobakterien auf die intakte Pflanze oder zumindest die Blütenprimordien einwirken zu lassen. Die Pflanze wird anschließend weiter herangezogen, bis man die Semen der behandelten Pflanze erhält ( Clough und Bent, Plant J. (1998), 16, 735–743 ). Zu den Verfahren für die Agrobacterium-vermittelte Transformation des Reises gehören gut bekannte Verfahren für die Reistransformation, wie diejenigen, die in einer der folgenden Schriften beschrieben sind: Europäische Patentanmeldung EP 1198985 A1 , Aldemita und Hodges (Planta 199: 612–617, 1996) ; Chan et al., (Plant Mol. Biol. 22 (3): 491–506, 1993) , Hiei et al., (Plant J. 6 (2): 271–282, 1994) , die hiermit vollinhaltlich durch Bezugnahme aufgenommen sind. Bei der Transformation von Mais ist das bevorzugte Verfahren entweder wie bei Ishida et al., (Nat. Biotechnol. 14(6): 745–50, 1996) oder bei Frame et al. (Plant Physiol. 129(1): 13–22, 2002) beschrieben, die hiermit vollinhaltlich durch Bezugnahme aufgenommen sind. Diese Verfahren sind weiterhin zum Beispiel bei B. Jenes et al., Techniques for Gene Transfer, in: Transgenic Plants, Band 1, Engineering and Utilization, Hrsg. S. D. Kung und R. Wu, Academic Press (1993), 128–143 und in Potrykus Annu. Rev. Plant Physiol. Plant Molec. Biol. 42 (1991) 205–225) beschrieben. Die zu exprimierenden Nukleinsäuren bzw. das zu exprimierende Konstrukt werden/wird vorzugsweise in einen Vektor kloniert, der sich für die Transformation von Agrobacterium tumefaciens eignet, zum Beispiel pBin19 ( Bevan et al., Nucl. Acids Res. 12 (1984) 8711 ). Agrobakterien, die mit solch einem Vektor transformiert wurden, können dann auf bekannte Weise für die Transformation von Pflanzen eingesetzt werden, wie Pflanzen, die als Modell verwendet werden, wie Arabidopsis (Arabidopsis thaliana wird innerhalb des Schutzbereichs der vorliegenden Erfindung, nicht als Kulturpflanze angesehen), oder Kulturpflanzen, wie zum Beispiel Tabakpflanzen, und zwar zum Beispiel dadurch, dass man verletzte Blätter oder zerkleinerte Blätter in eine Agrobakterienlösung taucht und sie dann in geeigneten Medien kultiviert. Die Transformation von Pflanzen mittels Agrobacterium tumefaciens wird zum Beispiel bei Hofgen und Willmitzer in Nucl. Acid Res. (1988), 16, 9877 beschrieben oder ist unter anderem aus F. F. White, Vectors for Gene Transfer in Higher Plants ; in Transgenic Plants, Band 1, Engineering and Utilization, Hrsg. S. D. Kung und R. Wu, Academic Press, 1993, S. 15–38 bekannt.The transfer of foreign genes into the genome of a plant is called transformation. The transformation of plant species is a technique that is now quite routinely done. To introduce the gene of interest into a suitable ancestral cell, any of various transformation methods can be advantageously employed. The methods described for the transformation and regeneration of plants from plant tissues or plant cells can be used for transient or stable transformation. Transformation techniques include the use of liposomes, electroporation, chemicals that enhance free DNA uptake, injection of DNA directly into the plant, particle gun bombardment, virus or pollen transformation, and microprojection. The methods can be selected from: calcium / polyethylene glycol method for protoplasts ( Krens, FA et al., (1982). Nature 296, 72-74 ; Negrutiu I et al. (1987) Plant Mol. Biol. 8: 363-373 ); Electroporation of protoplasts ( Shillito RD et al., (1985), Bio / Technol. 3, 1099-1102 ); Microinjection in plant material ( Crossway A et al., (1986), Mol. Genet. 202: 179-185 ); Bombardment with DNA- or RNA-coated particles ( Klein TM et al., (1987), Nature 327: 70 ), Infection with (non-integrating) viruses and the like. Transgenic plants, including transgenic crops, are preferably produced by Agrobacterium-mediated transformation. An advantageous transformation method is transformation into plants. For this purpose, for example, let the Agrobakterien act on plant seeds or inoculate the Pflanzenmeristem with Agrobakterien. According to the invention, it has proved particularly favorable to allow a suspension of transformed agrobacteria to act on the intact plant or at least the flower primordia. The plant is then further grown until the semen of the treated plant is obtained ( Clow and Bent, Plant J. (1998), 16, 735-743 ). The methods for Agrobacterium-mediated transformation of rice include well-known rice transformation methods such as those described in any of the following references: European Patent Application EP 1198985 A1 . Aldemita and Hodges (Planta 199: 612-617, 1996) ; Chan et al., (Plant Mol. Biol. 22 (3): 491-506, 1993) . Hiei et al., (Plant J. 6 (2): 271-282, 1994) , which are hereby incorporated by reference in their entirety. In the transformation of maize, the preferred method is either as in Ishida et al., (Nat. Biotechnol. 14 (6): 745-50, 1996) or at Frame et al. (Plant Physiol. 129 (1): 13-22, 2002) described, which are hereby incorporated by reference in their entirety. These methods are still included, for example Techniques for Gene Transfer, Transgenic Plants, Vol. 1, Engineering and Utilization, eds. SD Kung and R. Wu, Academic Press (1993), 128-143 and in Potrykus Annu. Rev. Plant Physiol. Plant Molec. Biol. 42 (1991) 205-225) described. The nucleic acids to be expressed or the construct to be expressed are / is preferably cloned into a vector which is suitable for the transformation of Agrobacterium tumefaciens, for example pBin19 (FIG. Bevan et al., Nucl. Acids Res. 12 (1984) 8711 ). Agrobacteria transformed with such a vector can then be used in a known manner for the transformation of plants, such as plants used as a model, such as Arabidopsis (Arabidopsis thaliana is not considered a crop within the scope of the present invention). , or crops such as tobacco plants, for example by dipping injured leaves or crushed leaves in an agrobacteria solution and then cultivating them in suitable media. The transformation of plants by means of Agrobacterium tumefaciens is, for example, in Hofgen and Willmitzer in Nucl. Acid Res. (1988), 16, 9877 described or is among others FF White, Vectors for Gene Transfer to Higher Plants ; in Transgenic Plants, Vol. 1, Engineering and Utilization, Ed. SD Kung and R. Wu, Academic Press, 1993, pp. 15-38 known.

Zusätzlich zu der Transformation von somatischen Zellen, die dann zu intakten Pflanzen regeneriert werden müssen, kann man auch Zellen von pflanzlichen Meristemen transformieren, insbesondere solche Zellen, die sich zu Gameten entwickeln. In diesem Fall folgen die transformierten Gameten der natürlichen Pflanzenentwicklung und ergeben tansgene Pflanze. So werden zum Beispiel Samen von Arabidopsis mit Agrobakterien behandelt, und man erhält von den sich entwickelnden Pflanzen, von denen ein gewisser Teil transformiert und daher transgen ist, Samen [ Feldman, KA und Marks MD (1987). Mol. Gen. Genet. 208: 274–289 ; Feldmann K (1992). In: C Koncz, N-H Chua und J Shell, Hrsg., Methods in Arabidopsis Research. Word Scientific, Singapur, S. 274–289 ]. Alternative Verfahren beruhen auf der wiederholten Entfernung der Infloreszenzen und Inkubation der Exzisionsstelle in der Mitte der Rosette mit transformierten Agrobakterien, wodurch ebenfalls später transformierte Samen erhalten werden können ( Chang (1994). Plant J. 5: 551–558 ; Katavic (1994). Mol. Gen. Genet., 245: 363–370 ). Ein besonders wirksames Verfahren ist jedoch das Vakuuminfiltrationsverfahren mit seinen Modifikationen, wie der ”floral dip”-Methode. bei der Vakuuminfiltration von Arabidopsis werden intakte Pflanzen unter verringertem Druck mit einer Agrobakteriensuspension behandelt [ Bechthold, N (1993). C. R. Acad. Sci. Paris Life Sci., 316: 1194–1199 ], während bei der ”floral dip”-Methode das sich entwickelnde Blütengewebe kurz mit einer mit Tensid behandelten Agrobakteriensuspension inkubiert wird [ Clough, SJ und Bent AF (1998), The Plant J. 16, 735–743 ]. Ein gewisser Anteil transgener Samen wird in beiden Fällen geerntet, und diese Samen lassen sich von nichttransgenen Samen dadurch unterscheiden, dass man sie unter den oben beschriebenen Selektionsbedingungen heranzieht. Außerdem ist die stabile Transformation von Plastiden vorteilhaft, da Plastide bei den meisten Kulturpflanzen mütterlich vererbt werden, wodurch die Gefahr des Transgenflusses durch Pollen reduziert oder eliminiert wird. Die Transformation des Chloroplastengenoms erfolgt im Allgemeinen durch ein Verfahren, das schematisch bei Klaus et al., 2004, [Nature Biotechnology 22 (2), 225–229] gezeigt wurde. Kurz gesagt werden die zu transformierenden Sequenzen gemeinsam mit einem Selektionsmarkergen zwischen flankierende Sequenzen, die zu dem Chloroplastengenom homolog sind, kloniert. Diese homologen flankierenden Sequenzen steuern die ortsgerichtete Integration in das Plastom. Die Plastidentransformation ist für viele unterschiedliche Pflanzenarten beschrieben worden, und eine Übersicht findet sich bei Bock (2001) Transgenic plastids in basic research and plant biotechnology. J. Mol. Biol. 2001 Sept. 21; 312 (3): 425–38 oder Maliga, P (2003), Progress towards commercialization of plastid transformation technology. Trends Biotechnol. 21, 20–28 . Über einen weiteren Fortschritt in der Biotechnologie wurde in jüngster Zeit in Form von markerfreien Plastidentransformanten, die durch ein transientes cointegriertes Markergen erzeugt werden können, berichtet ( Klaus et al., 2004, Nature Biotechnology 22(2), 225–229 ).In addition to the transformation of somatic cells, which then have to be regenerated to intact plants, one can also transform cells of plant meristems, especially those Cells that develop into gametes. In this case, the transformed gametes follow the natural plant development and yield the transgenic plant. For example, seeds of Arabidopsis are treated with Agrobacteria, and seed of the developing plants, some of which are transformed and therefore transgenic, is obtained. Feldman, KA and Marks MD (1987). Mol. Gen. Genet. 208: 274-289 ; Feldmann K (1992). In: C Koncz, NH Chua and J Shell, eds., Methods in Arabidopsis Research. Word Scientific, Singapore, pp. 274-289 ]. Alternative methods are based on the repeated removal of the inflorescences and incubation of the excision site in the middle of the rosette with transformed agrobacteria, whereby subsequently later transformed seeds can be obtained ( Chang (1994). Plant J. 5: 551-558 ; Katavic (1994). Mol. Gen. Genet., 245: 363-370 ). However, a particularly effective method is the vacuum infiltration method with its modifications, such as the "floral dip" method. In the Arabidopsis vacuum infiltration, intact plants are treated under reduced pressure with an Agrobacterium suspension [ Bechthold, N (1993). CR Acad. Sci. Paris Life Sci., 316: 1194-1199 ], while in the "floral dip" method, the developing flower tissue is incubated briefly with a surfactant-treated Agrobacterium suspension [ Clow, SJ and Bent AF (1998), The Plant J. 16, 735-743 ]. A certain proportion of transgenic seeds are harvested in both cases, and these seeds can be differentiated from non-transgenic seeds by using them under the selection conditions described above. In addition, the stable transformation of plastids is advantageous because plastids are maternally inherited in most crops, thereby reducing or eliminating the danger of transgene flow through pollen. The transformation of the chloroplast genome is generally carried out by a method which is schematically in Klaus et al., 2004, [Nature Biotechnology 22 (2), 225-229] was shown. Briefly, the sequences to be transformed are cloned together with a selection marker gene between flanking sequences homologous to the chloroplast genome. These homologous flanking sequences direct site-directed integration into the plastome. Plastid transformation has been described for many different plant species, and an overview can be found Bock (2001) Transgenic plastids in basic research and plant biotechnology. J. Mol. Biol. 2001 Sept. 21; 312 (3): 425-38 or Maliga, P (2003), Progress towards commercialization of plastid transformation technology. Trends Biotechnol. 21, 20-28 , Further progress in biotechnology has recently been reported in the form of marker-free plastid transformants that can be generated by a transient cointegrate marker gene ( Klaus et al., 2004, Nature Biotechnology 22 (2), 225-229 ).

Die genetisch modifizierten Pflanzenzellen können durch alle Verfahren regeneriert werden, mit denen der Fachmann vertraut ist. Geeignete Verfahren finden sich in den vorstehend genannten Veröffentlichungen von S. D. Kung and R. Wu, Potrykus or Höfgen and Willmitzer.The genetically modified plant cells can be regenerated by any methods that are familiar to those skilled in the art. Suitable methods are found in the above-mentioned publications by S.D. Kung and R. Wu, Potrykus or Hofgen and Willmitzer.

Nach einer Transformation werden Pflanzenzellen oder Zellgruppierungen im Allgemeinen hinsichtlich der Gegenwart von einem oder mehreren Markern selektiert, welche von pflanzlich exprimierbaren Genen kodiert werden, die mit dem interessierenden Gen co-transferiert werden, wonach das transformierte Material zu einer ganzen Pflanze regeneriert wird. Um transformierte Pflanzen zu selektieren, wird das in der Transformation erhaltene Pflanzenmaterial in der Regel Selektionsbedingungen unterworfen, so dass transformierte Pflanzen von nicht-transformierten Pflanzen unterschieden werden können. Zum Beispiel können die in der oben beschriebenen Weise erhaltenen Samen eingepflanzt und nach einer anfänglichen Wachstumsperiode einer geeigneten Selektion durch Besprühen unterworfen werden. Eine weitere Möglichkeit besteht in der Anzucht der Samen, gegebenenfalls nach Sterilisation, auf Agarplatten unter Anwendung eines geeigneten Selektionsmittels, so dass nur die transformierten Samen zu Pflanzen heranwachsen können. Alternativ werden die transformierten Pflanzen auf die Anwesenheit eines Selektionsmarkers, wie denjenigen, die oben beschrieben sind, gescreent.After transformation, plant cells or cell groupings are generally selected for the presence of one or more markers encoded by plant-expressible genes that are co-transferred with the gene of interest, after which the transformed material is regenerated into an entire plant. In order to select transformed plants, the plant material obtained in the transformation is usually subjected to selection conditions, so that transformed plants can be distinguished from non-transformed plants. For example, the seeds obtained in the manner described above can be planted and subjected to appropriate selection by spraying after an initial growing period. Another possibility is to grow the seeds, optionally after sterilization, on agar plates using a suitable selection agent, so that only the transformed seeds can grow into plants. Alternatively, the transformed plants are screened for the presence of a selection marker, such as those described above.

Nach dem DNA-Transfer und der Regeneration können vermeintlich transformierte Pflanzen auch beispielsweise mittels Southern-Analyse, hinsichtlich der Gegenwart des interessierenden Gens, der Kopienzahl und/oder der genomischen Organisation untersucht werden. Alternativ oder zusätzlich können Expressionsspiegel der neu eingeführten DNA mittels Northern- und/oder Western-Analyse überwacht werden, wobei beide Techniken dem Durchschnittsfachmann auf dem Gebiet allgemein bekannt sind.After DNA transfer and regeneration, putatively transformed plants may also be screened, for example, by Southern analysis, for the presence of the gene of interest, copy number and / or genomic organization. Alternatively or additionally, expression levels of the newly introduced DNA can be monitored by Northern and / or Western analysis, both of which are well known to those of ordinary skill in the art.

Die erzeugten, transformierten Pflanzen können durch eine Vielzahl von Methoden vermehrt werden, wie etwa durch klonale Propagation oder klassische Züchtungstechniken. So kann zum Beispiel eine transformierte Pflanze der ersten Generation (oder T1) geselbstet, und homozygote Transformanten der zweiten Generation (oder T2) können selektiert werden, und die T2-Pflanzen können dann durch klassische Züchtungstechniken weiter vermehrt werden. Die erzeugten, transformierten Organismen können eine Vielzahl von Formen einnehmen. Zum Beispiel können sie Chimären von transformierten Zellen und nicht-transformierten Zellen; klonale Transformanten (wobei z. B. alle Zellen transformiert sind, um die Expressionskassette zu enthalten); Propfungen von transformierten und nicht-transformierten Geweben (z. B. in Pflanzen, in denen ein transformierter Wurzelstock an einen nicht-transformierten Spross gepropft wird) sein.The generated, transformed plants can be propagated by a variety of methods, such as clonal propagation or classical breeding techniques. For example, a first generation (or T1) transformed plant may be selfed, and second generation homozygous transformants (or T2) may be selected, and the T2 plants may then be further propagated by classical breeding techniques. The generated, transformed organisms can take a variety of forms. For example, they may be chimeras of transformed cells and untransformed cells; clonal transformants (where, for example, all cells are transformed to the expression cassette contain); Grafts of transformed and non-transformed tissues (e.g., in plants in which a transformed rootstock is grafted to a non-transformed shoot).

T-DNA-AktivierungstaggingT-DNA activation tagging

T-DNA-Aktivierungstagging ( Hayashi et al. Science (1992) 1350-1353 ) beinhaltet die Einführung von T-DNA, die gewöhnlich einen Promotor enthält (es kann auch ein Translations-Enhancer oder ein Intron sein) in der genomischen Region des interessierenden Gens von bis zu 10 kb stromaufwärts oder stromabwärts der kodierenden Region eines Gens in einer Konfiguration, so dass der Promotor die Expression des angezielten Gens steuert. Die Regulation der Expression des angezielten Gens durch seinen natürlichen Promotor wird gewöhnlich unterbrochen und das Gen gerät unter die Kontrolle des neu eingeführten Promotors. Der Promotor ist gewöhnlich in eine T-DNA eingebettet. Diese T-DNA wird statistisch in das Pflanzengenom eingeführt, beispielsweise durch Agrobacterium Infektion und führt zu modifizierter Expression der Gene nahe der eingeführten T-DNA. Die resultierenden transgenen Pflanzen zeigen dominante Phänotypen aufgrund der modifizierten Expression der Gene nahe dem eingeführten Promotor.T-DNA activation tagging ( Hayashi et al. Science (1992) 1350-1353 ) involves the introduction of T-DNA, which usually contains a promoter (it may also be a translation enhancer or an intron) in the genomic region of the gene of interest up to 10 kb upstream or downstream of the coding region of a gene in a configuration such that the promoter directs the expression of the targeted gene. The regulation of the expression of the targeted gene by its natural promoter is usually interrupted and the gene comes under the control of the newly introduced promoter. The promoter is usually embedded in a T-DNA. This T-DNA is randomly introduced into the plant genome, for example, by Agrobacterium infection and results in modified expression of the genes near the introduced T-DNA. The resulting transgenic plants show dominant phenotypes due to modified expression of the genes near the introduced promoter.

TILLINGTILLING

Der Begriff TILLING ist eine Abkürzung für ”Targeted Induced Local Lesions In Genomes” und steht für eine Mutagenesetechnologie, die sich dazu eignet, Nukleinsäuren, die Proteine mit modifizierter Expression und/oder Aktivität kodieren, zu erzeugen und/oder zu identifizieren. TILLING ermöglicht auch die Selektion von Pflanzen, die solche Mutantenvarianten tragen. Diese Mutantenvarianten können eine modifizierte Expression aufweisen, und zwar entweder bezüglich der Stärke oder der Lokalisierung oder des Zeitpunkts (wenn die Mutationen zum Beispiel den Promotor betreffen). Diese Mutantenvarianten können eine höhere Aktivität aufweisen als diejenige des Gens in seiner natürlichen Form. Beim TILLING wird Mutagenese in hoher Dichte mit Screening-Methoden mit hohem Durchsatz kombiniert. Die Schritte, die beim TILLING gewöhnlich erfolgen, sind: (a) EMS-Mutagenese ( Redei GP und Koncz C (1992), In Methods in Arabidopsis Research, Koncz C, Chua NH, Schell J, Hrsg. Singapur, World Scientific Publishing Co, S. 16–82 ; Feldmann et al., (1994) In Meyerowitz EM, Somerville CR, Hrsg, Arabidopsis. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, S. 137–172 ; Lightner J und Caspar T (1998), In J Martinez-Zapater, J Salinas, Hrsg., Methods an Molecular Biology, Band 82. Humana Press, Totowa, NJ, S. 91–104 ); (b) DNA-Herstellung und Poolen von Individuen; (c) PCR-Amplifikation einer interessierenden Region; (d) Denaturieren und Annealing, um die Bildung von Heteroduplices zu ermöglichen; (e) DHPLC, wo das Vorhandensein eines Heteroduplex in einem Pool als zusätzlicher Peak im Chromatogramm nachgewiesen wird; (f) Identifizieren des mutierten Individuums; und (g) Sequenzieren des PCR-Produkts der Mutante. TILLING-Methoden sind im Stand der Technik bestens bekannt ( McCallum et al., (2000), Nat. Biotechnol. 18: 455–457 ; in einem Übersichtsartikel von Stemple (2004), Nat. Rev. Genet. 5(2): 145–50 ) erwähnt.The term TILLING is an abbreviation for "Targeted Induced Local Lesions In Genomes" and stands for a mutagenesis technology that is suitable for generating and / or identifying nucleic acids that encode proteins with modified expression and / or activity. TILLING also allows the selection of plants bearing such mutant variants. These mutant variants may have modified expression, either in terms of potency or localization or timing (for example, when the mutations concern the promoter). These mutant variants may have higher activity than that of the gene in its natural form. TILLING combines high density mutagenesis with high throughput screening methods. The usual steps in TILLING are: (a) EMS mutagenesis ( Redei GP and Koncz C (1992), In Methods in Arabidopsis Research, Koncz C, Chua NH, Schell J, eds. Singapore, World Scientific Publishing Co, pp. 16-82 ; Feldmann et al., (1994) In Meyerowitz EM, Somerville CR, Eds, Arabidopsis. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, pp. 137-172 ; Lightner J and Caspar T (1998), In J Martinez-Zapater, J Salinas, eds., Methods on Molecular Biology, Vol. 82. Humana Press, Totowa, NJ, pp. 91-104 ); (b) DNA production and pooling of individuals; (c) PCR amplification of a region of interest; (d) denature and anneal to allow the formation of heteroduplexes; (e) DHPLC, where the presence of a heteroduplex in a pool is detected as an additional peak in the chromatogram; (f) identifying the mutated individual; and (g) sequencing the PCR product of the mutant. TILLING methods are well known in the art ( McCallum et al., (2000), Nat. Biotechnol. 18: 455-457 ; in a review article from Stemple (2004), Nat. Rev. Genet. 5 (2): 145-50 ) mentioned.

Homologe RekombinationHomologous recombination

Homologe Rekombination ermöglicht die Einführung einer ausgewählten Nukleinsäure in ein Genom, an einer definierten ausgewählten Position. Die homologe Rekombination ist eine Standard-Technik, die routinemäßig in den biologischen Wissenschaften für niedere Organismen verwendet wird, wie Hefe und das Moos Physcomitrella. Verfahren zur Durchführung der homologen Rekombination in Pflanzen wurden nicht nur für Pflanzenmodelle beschrieben ( Offringa et al. (1990) EMBO J 9(10): 3077–84 ) sondern auch für Kulturpflanzen, wie beispielsweise Reis ( Terada et al. (2002) Nat Biotech 20(10): 1030–4 ; Iida and Terada (2004) Curr Opin Biotech 15(2): 132–8 ), und es gibt Ansätze, die gewöhnlich anwendbar sind, ungeachtet des Zielorganismus ( Miller et al, Nature Biotechnol. 25, 778–785, 2007 ).Homologous recombination allows introduction of a selected nucleic acid into a genome at a defined selected position. Homologous recombination is a standard technique routinely used in the biological sciences for lower organisms, such as yeast and the moss Physcomitrella. Methods for carrying out homologous recombination in plants have not only been described for plant models ( Offringa et al. (1990) EMBO J 9 (10): 3077-84 ) but also for crops, such as rice ( Terada et al. (2002) Nat Biotech 20 (10): 1030-4 ; Iida and Terada (2004) Curr Opin Biotech 15 (2): 132-8 ), and there are approaches that are usually applicable, regardless of the target organism ( Miller et al, Nature Biotechnol. 25, 778-785, 2007 ).

Ertragsmerkmaleincome characteristics

Ertragsmerkmale umfassen eine oder mehrere aus Ertrag, Biomasse, Samenertrag, Jungpflanzenvitalität, Greenness Index, erhöhter Wachstumsrate, verbesserten agronomischen Eigenschaften (wie verbesserter Wasserausnutzungseffizienz (Water Use Efficiency, WUE, Stickstoffausnutzungseffizienz (Nitrogen Use Efficiency, NUE) usw. ausgewählte Eigenschaften.Yield characteristics include one or more of selected properties such as yield, biomass, seed yield, seedling vitality, Greenness Index, increased growth rate, improved agronomic properties (such as Water Use Efficiency, WUE, Nitrogen Use Efficiency, NUE).

Ertragearnings

Der Begriff ”Ertrag” bedeutet im Allgemeinen ein messbares Produkt von wirtschaftlichem Wert, das gewöhnlich mit einer bezeichneten Kulturpflanze, einem Ort und einem Zeitraum einher geht. Die einzelnen Pflanzenteile tragen direkt aufgrund ihrer Anzahl, Größe und/oder ihres Gewichts zum Ertrag bei, oder der tatsächliche Ertrag ist derjenige Ertrag pro m² für eine Kulturpflanze und ein Jahr, der dadurch bestimmt wird, dass man die Gesamtproduktion (was sowohl geerntete als auch geschätzte Produktion beinhaltet) durch die bewirtschafteten m² dividiert. Der Begriff ”Ertrag” einer Pflanze kann die vegetative Biomasse (Wurzel und/oder Spross-Biomasse), Fortpflanzungsorgane und/oder Verbreitungseinheiten (wie Samen) dieser Pflanze betreffen.The term "yield" generally means a measurable product of economic value, usually associated with a designated crop, place and period. The single ones Plant parts directly contribute to the yield by virtue of their number, size and / or weight, or the actual yield is that yield per m ² for a crop and year determined by the total production (which is both harvested and estimated Production includes) divided by the managed m ² . The term "yield" of a plant may refer to the vegetative biomass (root and / or shoot biomass), reproductive organs and / or propagules (such as seeds) of that plant.

Wählt man Mais als Beispiel, kann sich eine Ertragserhöhung unter anderem als eines oder mehrere der folgenden Merkmale äußern: Erhöhte Anzahl Pflanzen, die sich pro m² entwickeln, Erhöhung der Anzahl Ähren pro Pflanze, Erhöhung der Anzahl Reihen, der Anzahl Körner pro Reihe, des Korngewichts, Tausendkorngewichts, Ährenlänge/-durchmessers, Erhöhung der Samenfüllungsrate (d. h. die Anzahl gefüllter Samen dividiert durch die Gesamtzahl Samen und multipliziert mit Hundert). Wählt man Reis als Beispiel, kann sich eine Ertragserhöhung unter anderem als Erhöhung von einem oder mehreren der folgenden Merkmale ausdrücken: Anzahl Pflanzen pro m², Anzahl Rispen pro Pflanze, Rispenlänge, Anzahl Ährchen pro Rispe, Anzahl Blüten (Einzelblüten) pro Rispe, erhöhte Samenfüllungsrate (Anzahl gefüllter Samen dividiert durch die Gesamtzahl Samen und multipliziert mit Hundert), erhöhtes Tausendkorngewicht. Bei Reis kann auch eine Toleranz gegenüber Untertauchen zu einem verbesserten Ertrag führen.If one chooses corn as an example, an increase in yield may, among other things, be expressed as one or more of the following: increased numbers of plants developing per m ² , increasing the number of ears per plant, increasing the number of rows, the number of grains per row, grain weight, thousand kernel weight, ear length / diameter, increase in seed fill rate (ie, the number of filled seeds divided by the total number of seeds and multiplied by one hundred). By taking rice as an example, an increase in yield may inter alia be expressed as an increase of one or more of the following characteristics: number of plants per m ² , number of panicles per plant, panicle length, number of spikelets per panicle, number of flowers (single flowers) per panicle, increased Seed filling rate (number of filled seeds divided by the total number of seeds and multiplied by one hundred), increased thousand kernel weight. For rice, tolerance to submersion can also lead to improved yields.

JungpflanzenvitalitätEarly vigor

”Jungpflanzenvitalität” steht für das aktive gesunde gut balancierte Wachstum, insbesondere während früher Stadien des Pflanzenwachstums, und kann sich aus einer gesteigerten Pflanzen-Fitness ergeben, beispielsweise wenn die Pflanzen besser an ihre Umgebung angepasst sind (d. h. durch Optimierung der Verwendung von Energiequellen und der Verteilung zwischen Spross und Wurzel). Pflanzen mit einer Jungpflanzenvitalität zeigen auch ein gesteigertes Überleben des Keimlings und eine bessere Entwicklung der Kulturpflanze, was häufig zu sehr einheitlichen Feldern (wobei die Kulturpflanze einheitlich wächst, d. h. die Mehrheit der Pflanzen erreicht im Wesentlichen gleichzeitig die verschiedenen Entwicklungsstadien) und oft einer besseren und höheren Ertrag führt. Daher kann die Jungpflanzenvitalität durch Messen verschiedener Faktoren bestimmt werden, wie Tausendkorngewicht, Prozent Keimung, Prozent Auflaufen, Wachstum des Keimlings, Höhe des Keimlings, Wurzellänge, Biomasse von Wurzel und Spross und vielen anderen."Early vigor" stands for active healthy well-balanced growth, especially during early stages of plant growth, and may result from increased plant fitness, for example, when the plants are better adapted to their environment (ie, by optimizing the use of energy sources and Distribution between shoot and root). Plants with seedling vitality also show increased seedling survival and better crop development, often resulting in very uniform fields (with the crop growing at a uniform rate, ie, the majority of the plants reaching the different stages of development substantially simultaneously), and often better and higher Yield leads. Thus, early vigor can be determined by measuring various factors such as thousand kernel weight, percent germination, percent emergence, seedling growth, height of seedling, root length, biomass of root and shoot, and many others.

Erhöhte WachstumsrateIncreased growth rate

Die erhöhte Wachstumsrate kann für einen oder mehrere Teile einer Pflanze (darunter Samen) spezifisch sein oder kann im Wesentlichen in der ganzen Pflanze stattfinden. Pflanzen mit einer erhöhten Wachstumsrate können einen kürzeren Lebenszyklus aufweisen. Unter dem Lebenszyklus einer Pflanze kann man diejenige Zeit verstehen, die die Pflanze benötigt, um von einem trockenen reifen Samen bis zu dem Stadium heranzuwachsen, in dem die Pflanze trockene reife Samen ähnlich dem Ausgangsmaterial produziert hat. Dieser Lebenszyklus kann von Faktoren, wie Keimungsgeschwindigkeit, Jungpflanzenvitalität, Wachstumsrate, ”Greenness Index”, Blütezeit und Geschwindigkeit der Samenreifung, beeinflusst werden. Die Erhöhung der Wachstumsrate kann in einem Stadium oder in mehreren Stadien im Lebenszyklus einer Pflanze oder im Wesentlichen während des gesamten Lebenszyklus der Pflanze erfolgen. Eine erhöhte Wachstumsrate während der Frühstadien im Lebenszyklus einer Pflanze kann verbesserte Vitalität widerspiegeln. Die erhöhte Wachstumsrate kann den Erntezyklus einer Pflanze verändern, so dass die Pflanzen später gesät werden können und/oder früher geerntet werden können als dies sonst möglich wäre (ein ähnlicher Effekt lässt sich mit einer früheren Blütezeit erzielen). Ist die Wachstumsrate ausreichend erhöht, kann dies weiteres Aussäen von Samen derselben Pflanzenart ermöglichen (zum Beispiel Aussäen und Ernten von Reispflanzen und anschließendes Aussäen und Ernten von weiteren Reispflanzen sogar innerhalb einer herkömmlichen Wachstumsperiode). Wenn die Wachstumsrate ausreichend erhöht ist, kann dies ebenso das weitere Aussäen von Samen anderer Pflanzenarten ermöglichen (zum Beispiel das Aussäen und Ernten von Maispflanzen und anschließend zum Beispiel Aussäen und gegebenenfalls Ernten von Sojabohne, Kartoffel oder einer anderen geeigneten Pflanze). Auch mehrmalige zusätzliche Ernten von demselben Wurzelstock können bei einigen Kulturpflanzen möglich sein. Eine Veränderung des Erntezyklus einer Pflanze kann zu einer Erhöhung der jährlichen Biomasseproduktion pro m² führen (weil man eine bestimmte Pflanze öfter (z. B. pro Jahr) heranziehen und ernten kann). Eine erhöhte Wachstumsrate kann auch den Anbau transgener Pflanzen in einem breiteren geographischen Bereich als ihre Wildtyp-Gegenstücke ermöglichen, da die räumlichen Beschränkungen für den Anbau einer Kultur häufig von ungünstigen Umweltbedingungen entweder während der Pflanzzeit (früh in der Saison) oder während der Erntezeit (spät in der Saison) bestimmt werden. Solche ungünstigen Bedingungen können vermieden werden, wenn der Erntezyklus verkürzt ist. Die Wachstumsrate kann durch Ableiten verschiedener Parameter aus Wachstumskurven bestimmt werden, wobei die Parameter u. a. folgende sein können: T-Mid (Zeitdauer, die die Pflanzen benötigen, um 50% ihrer Maximalgröße zu erreichen) und T-90 (Zeitdauer, die die Pflanzen benötigen, um 90% ihrer Maximalgröße zu erreichen).The increased growth rate may be specific to one or more parts of a plant (including seeds) or may occur substantially throughout the plant. Plants with an increased growth rate may have a shorter life cycle. The life cycle of a plant can be understood as the time it takes for the plant to grow from a dry, ripe seed to the stage where the plant has produced dry mature seeds similar to the starting material. This life cycle can be influenced by factors such as germination rate, early vigor, growth rate, greenness index, flowering time, and rate of seed maturation. The increase in growth rate may occur at one stage or at several stages in the life cycle of a plant or substantially throughout the life cycle of the plant. An increased rate of growth during early stages of the life cycle of a plant may reflect improved vitality. The increased growth rate may change the harvest cycle of a plant so that the plants can later be sown and / or harvested earlier than would otherwise be possible (a similar effect can be achieved with an earlier flowering period). If the growth rate is sufficiently increased, this may allow further sowing of seeds of the same plant species (for example sowing and harvesting of rice plants and subsequent sowing and harvesting of further rice plants even within a conventional growth period). If the growth rate is sufficiently increased, it may also allow further sowing of seeds of other plant species (for example, sowing and harvesting corn plants, and then, for example, sowing and optionally harvesting soybean, potato, or other suitable plant). Several additional harvests of the same rootstock may also be possible on some crops. Changing the crop cycle of a crop can increase the annual biomass production per m ² (because you can grow and harvest a particular crop more often (eg, per year)). An increased growth rate may also allow for the cultivation of transgenic plants in a wider geographical area than their wild-type counterparts, since the spatial restrictions on growing a crop are often adverse environmental conditions either during planting (early in the season) or during the harvest (late in season). Such unfavorable conditions can be avoided if the harvest cycle is shortened. The growth rate can be determined by deriving various parameters from growth curves, where the parameters may include: T-Mid (The time the plants take to reach 50% of their maximum size) and T-90 (the time the plants take to reach 90% of their maximum size).

Stressresistenzstress resistance

Eine Erhöhung des Ertrags und/oder der Wachstumsrate tritt unabhängig davon auf, ob die Pflanze unter Nichtstressbedingungen steht oder ob die Pflanze im Vergleich zu Kontrollpflanzen verschiedenen Stressbedingungen unterworfen wird. Typischerweise reagieren Pflanzen auf Stress dadurch, dass sie langsamer wachsen. Unter starken Stressbedingungen kann die Pflanze sogar ihr Wachstum völlig einstellen. Leichter Stress ist dagegen hier als jeglicher Stress definiert, dem eine Pflanze ausgesetzt ist und der nicht dazu führt, dass die Pflanze völlig aufhört zu wachsen, ohne dass sie die Fähigkeit besitzt, ihr Wachstum wieder aufzunehmen. Leichter Stress im Sinne der Erfindung führt zu einer Verringerung des Wachstums der gestressten Pflanzen von weniger als 40%, 35%, 30% oder 25%, stärker bevorzugt weniger als 20% oder 15%, im Vergleich zu der Kontrollpflanze unter Nichtstressbedingungen. Aufgrund von Fortschritten bei den landwirtschaftlichen Praktiken (Bewässerung, Düngung, Pestizidbehandlungen) findet man bei angebauten Kulturpflanzen nicht oft starke Stressbedingungen. Daher ist das durch leichten Stress induzierte geschwächte Wachstum häufig ein unerwünschtes Merkmal in der Landwirtschaft. Leichte Stressbedingungen sind die alltäglichen biotischen und/oder abiotischen (Umwelt-)Stressbedingungen, denen eine Pflanze ausgesetzt ist. Abiotischer Stress kann durch Trockenheit oder Wasserüberschuss, anaeroben Stress, Salzstress, chemische Toxizität, oxidativen Stress und heiße, kalte oder Gefriertemperaturen verursacht werden. Bei dem abiotischen Stress kann es sich um einen osmotischen Stress handeln, der durch Wasserstress (insbesondere aufgrund von Trockenheit), Salzstress, oxidativen Stress oder ionenbedingten Stress verursacht wird. Unter biotischem Stress versteht man gewöhnlich Stressbedingungen, die durch Pathogene, wie Bakterien, Viren, Pilze, Nematoden und Insekten, verursacht werden.An increase in yield and / or growth rate occurs regardless of whether the plant is under non-stress conditions or whether the plant is subjected to different stress conditions compared to control plants. Typically, plants respond to stress by growing more slowly. Under severe stress conditions, the plant can even completely stop growing. Light stress, on the other hand, is defined here as any stress to which a plant is exposed and which does not cause the plant to completely stop growing without the ability to resume its growth. Light stress within the meaning of the invention results in a reduction in the growth of the stressed plants of less than 40%, 35%, 30% or 25%, more preferably less than 20% or 15%, compared to the control plant under non-stress conditions. Due to advances in agricultural practices (irrigation, fertilization, pesticide treatments) crops that are cultivated are not often subject to severe stress conditions. Therefore, the mild stress-induced debilitated growth is often an undesirable feature in agriculture. Light stress conditions are the everyday biotic and / or abiotic (environmental) stress conditions to which a plant is exposed. Abiotic stress can be caused by dryness or excess water, anaerobic stress, salt stress, chemical toxicity, oxidative stress and hot, cold or freezing temperatures. Abiotic stress can be an osmotic stress caused by water stress (especially dryness), salt stress, oxidative stress, or ion-related stress. Biotic stress is usually understood to mean stress conditions caused by pathogens such as bacteria, viruses, fungi, nematodes and insects.

Insbesondere können die erfindungsgemäßen Verfahren unter Nichtstressbedingungen oder unter leichten Trockenheitsbedingungen durchgeführt werden, wobei man Pflanzen erhält, deren Ertrag im Vergleich zu Kontrollpflanzen erhöht ist. Wie von Wang et al. (Planta (2003), 218: 1–14) beschrieben, führt abiotischer Stress zu einer Reihe von morphologischen, physiologischen, biochemischen und molekularen Veränderungen, die das Pflanzenwachstum und die Pflanzenproduktivität negativ beeinflussen. Es ist bekannt, dass Trockenheit, Salinität, extreme Temperaturen und oxidativer Stress miteinander in Verbindung stehen und über ähnliche Mechanismen Wachstums- und Zellschäden induzieren können. Rabbani et al. (Plant Physiol. (2003), 133: 1755–1767) beschreibt ein besonders hohes Ausmaß an gegenseitiger Beeinflussung (”Cross-Talk”) von Trockenheitsstress und durch hohe Salinität verursachtem Stress. Zum Beispiel äußern sich Trockenheit und/oder Versalzung in erster Linie als osmotischer Stress, was zur Störung der Homöostase und der Ionenverteilung in der Zelle führt. Oxidativer Stress, der häufig hohe oder niedrige Temperatur, Salinität oder Trockenheitsstress begleitet, kann zur Denaturierung funktioneller und struktureller Proteine führen. Infolgedessen aktivieren diese verschiedenen Umweltstressbedingungen häufig ähnliche Zellsignalwege und Zellreaktionen, wie die Produktion von Stressproteinen, die Hinaufregulation von Antioxidantien, die Akkumulation von kompatiblen gelösten Stoffen und ein Einstellen des Wachstums. Der Begriff ”Nichtstress”-Bedingungen, wie hier verwendet, steht für diejenigen Umweltbedingungen, die ein optimales Wachstum von Pflanzen gestatten. Der Fachmann ist mit normalen Bodenbedingungen und Klimabedingungen für einen bestimmten Standort vertraut. Pflanzen unter optimalen Wachstumsbedingungen (die unter Nichtstressbedingungen herangezogen werden) liefern oft einen Ertrag von, in der Reihenfolge der zunehmenden Präferenz, von mindestens 97%, 95%, 92%, 90%, 87%, 85%, 83%, 80%, 77% oder 75% der durchschnittlichen Produktion einer solchen Pflanze in einer gegebenen Umgebung. Die durchschnittliche Produktion kann bezogen auf die Ernte und/oder die Saison berechnet werden. Der Fachmann ist mit den durchschnittlichen Erträgen einer Kultur vertraut.In particular, the methods of the invention may be carried out under non-stress conditions or under mild drought conditions to yield plants whose yield is increased compared to control plants. Like Wang et al. (Planta (2003), 218: 1-14) Abiotic stress leads to a series of morphological, physiological, biochemical and molecular changes that adversely affect plant growth and productivity. It is known that dryness, salinity, extreme temperatures and oxidative stress are related and can induce growth and cell damage through similar mechanisms. Rabbani et al. (Plant Physiol. (2003), 133: 1755-1767) describes a particularly high degree of cross-talk of dryness stress and high salinity stress. For example, dryness and / or salinization primarily manifests as osmotic stress, resulting in disruption of homeostasis and ion distribution in the cell. Oxidative stress, which often accompanies high or low temperature, salinity, or drought stress, can lead to the denaturation of functional and structural proteins. As a result, these various environmental stress conditions often activate similar cell signaling pathways and cell responses, such as the production of stress proteins, the upregulation of antioxidants, the accumulation of compatible solutes and cessation of growth. The term "non-stress" conditions as used herein means those environmental conditions that allow optimal growth of plants. The skilled person is familiar with normal soil conditions and climatic conditions for a particular location. Plants under optimal growth conditions (used under non-stress conditions) often yield, in order of increasing preference, at least 97%, 95%, 92%, 90%, 87%, 85%, 83%, 80%, 77% or 75% of the average production of such a plant in a given environment. The average production can be calculated based on the harvest and / or the season. The skilled person is familiar with the average yields of a culture.

Nährstoffmangel kann sich unter anderem aus einem Fehlen von Nährstoffen, wie Stickstoff, Phosphaten und anderen phosphorhaltigen Verbindungen, Kalium, Calcium, Cadmium, Magnesium, Mangan, Eisen und Bor, ergeben.Nutrient deficiencies can result, among other things, from a lack of nutrients such as nitrogen, phosphates and other phosphorus compounds, potassium, calcium, cadmium, magnesium, manganese, iron and boron.

Der Begriff Salzstress ist nicht auf Natriumchlorid (NaCl) beschränkt, sondern es kann sich dabei unter anderem um eines der folgenden Salze handeln: NaCl, KCl, LiCl, MgCl₂, CaCl₂.The term salt stress is not limited to sodium chloride (NaCl), but may be, inter alia, one of the following salts: NaCl, KCl, LiCl, MgCl ₂ , CaCl ₂ .

Erhöhen/Verbessern/FördernIncrease / Improve / Enhance

Die Begriffe ”erhöhen”, ”verbessern” oder ”steigern” sind untereinander austauschbar und sollen im Rahmen der vorliegenden Erfindung mindestens 3%, 4%, 5%, 6%, 7%, 8%, 9% oder 10%, vorzugsweise mindestens 15% oder 20%, stärker bevorzugt 25%, 30%, 35% oder 40% mehr Ertrag und/oder Wachstum im Vergleich zu Kontrollpflanzen wie im vorliegenden Text definiert bedeuten.The terms "increase", "improve" or "enhance" are interchangeable and are intended in the context of the present invention at least 3%, 4%, 5%, 6%, 7%, 8%, 9% or 10%, preferably at least 15% or 20%, more preferably 25%, 30%, 35% or 40% more yield and / or growth compared to control plants as defined herein.

Samenertragseed yield

Ein verbesserter Samenertrag kann sich als eine oder mehrere der folgenden Erscheinungen äußern: a) Erhöhung der Samenbiomasse (Samengesamtgewicht), entweder auf Grundlage der einzelnen Samen und/oder pro Pflanze und/oder oder pro m²; b) erhöhte Anzahl Blüten pro Pflanze; c) erhöhte Anzahl (gefüllter) Semen; d) erhöhte Samenfüllungsrate (die als Verhältnis zwischen der Anzahl gefüllter Semen dividiert durch die Gesamtzahl Samen ausgedrückt wird); e) erhöhter Harvest Index, der als Verhältnis des Ertrags von Erntegut wie Samen dividiert durch die Gesamtbiomasse ausgedrückt wird; sowie f) erhöhtes Tausendkorngewicht (TKG), das aufgrund der Anzahl der gezählten gefüllten Samen und ihres Gesamtgewichts extrapoliert wird. Ein erhöhtes TKG kann das Ergebnis einer erhöhten Samengröße und/oder eines erhöhten Samengewichts sein und kann auch das Ergebnis einer Erhöhung der Embryo- und/oder Endospermgröße sein.Improved seed yield may manifest as one or more of the following: a) increase in seed biomass (total seed weight), either based on individual seeds and / or per plant and / or per m ² ; b) increased number of flowers per plant; c) increased number (filled) semen; d) increased seed filling rate (expressed as the ratio between the number of filled semen divided by the total number of seeds); e) increased harvest index, expressed as the ratio of crop yield such as seed divided by total biomass; and f) increased Thousand Grain Weight (TKG) extrapolated based on the number of filled seeds counted and their total weight. Increased TKG may be the result of increased seed size and / or seed weight, and may also be the result of an increase in embryo and / or endosperm size.

Eine Erhöhung des Samenertrags kann sich auch als Erhöhung der Samengröße und/oder des Samenvolumens äußern. Eine Erhöhung des Samenertrags kann sich auch als Vergrößerung der Samenfläche und/oder Samenlänge und/oder Samenbreite und/oder des Samenumfangs äußern. Ein verbesserter Ertrag kann auch zu einer modifizierten Architektur führen oder kann aufgrund einer modifizierten Architektur vorliegen.An increase in seed yield may also be manifested as an increase in seed size and / or seed volume. An increase in the seed yield can also manifest itself as an increase in the seed area and / or seed length and / or seed width and / or seed size. Improved yield may also result in a modified architecture or may be due to a modified architecture.

Greenness IndexGreenness Index

Der ”Greenness Index”, wie hier verwendet, wird aus digitalen Bildern von Pflanzen berechnet. Für jeden zu dem Pflanzenobjekt auf dem Bild gehörigen Pixel wird das Verhältnis des Grünwertes gegenüber dem Rotwert (im RGB-Modell für Farbkodierung) berechnet. Der Greenness Index wird ausgedrückt als Prozent der Pixel, für die das Grün:Rot-Verhältnis eine bestimmte Schwelle überschreitet. Unter normalen Wachstumsbedingungen, unter Salzstress-Wachstumsbedingungen, und unter den Wachstumsbedingungen einer reduzierten Nährstoffverfügbarkeit wird der Greenness Index der Pflanzen bei der letzten Bildnahme vor dem Blühen gemessen. Unter Trockenstress-Wachstumsbedingungen, wird der Greenness Index der Pflanzen in der erste Bildnahme nach dem Trockenstress gemessen.The "greenness index" as used here is calculated from digital images of plants. For each pixel associated with the plant object on the image, the ratio of the green value to the red value (in the RGB model for color coding) is calculated. The greenness index is expressed as a percentage of the pixels for which the green: red ratio exceeds a certain threshold. Under normal growth conditions, under salt stress growth conditions, and under the growth conditions of reduced nutrient availability, the plants' Greenness Index is measured at the last image capture before flowering. Under dry stress growth conditions, the Greenness Index of the plants is measured in the first picture after the dry stress.

Marker-unterstützes ZüchtenMarker-assisted breeding

Bei solchen Züchtungsprogrammen ist manchmal das Einführen von allelischer Variation durch Mutagenbehandlung der Pflanzen erforderlich, wobei zum Beispiel EMS-Mutagenese verwendet wird; alternativ kann das Programm von einer Sammlung von allelischen Varianten so genannten ”natürlichen” Ursprungs ausgehen, die nicht mit Absicht hervorgerufen wurden. Die Identifikation allelischer Varianten erfolgt zum Beispiel mittels PCR. Darauf folgt ein Schritt zur Selektion besserer allelischer Varianten der in Frage kommenden Sequenz, die bessere Erträge liefern. Die Selektion wird gewöhnlich durchgeführt, indem man die Wachstumsleistung von Pflanzen verfolgt, die verschiedene allelische Varianten der in Frage kommenden Sequenz enthalten. Die Wachstumsleistung kann im Gewächshaus oder auf dem Feld verfolgt werden. Weitere Schritte sind gegebenenfalls u. a. das Kreuzen der Pflanzen, in denen die bessere allelische Variante identifiziert wurde, mit einer anderen Pflanze. Dies kann zum Beispiel zur Herstellung einer Kombination interessanter phänotypischer Merkmale verwendet werden.Such breeding programs sometimes require the introduction of allelic variation by mutagenic treatment of the plants using, for example, EMS mutagenesis; alternatively, the program may assume a collection of allelic variants of so-called "natural" origin that were not intentionally induced. The identification of allelic variants takes place for example by means of PCR. This is followed by a step to select better allelic variants of the candidate sequence that provide better yields. Selection is usually done by monitoring the growth performance of plants containing various allelic variants of the sequence of interest. The growth performance can be monitored in the greenhouse or in the field. Further steps may be necessary u. a. crossing the plants in which the better allelic variant has been identified with another plant. This can be used, for example, to produce a combination of interesting phenotypic features.

Verwendung als Sonden (in der Genkartierung)Use as probes (in gene mapping)

Die Verwendung von Nukleinsäuren, die das interessierende Protein kodieren für eine genetische und physikalische Kartierung der Gene erfordert nur eine Nukleinsäuresequenz mit einer Länge von mindestens 15 Nukleotiden. Diese Nukleinsäuren können als Marker für Restriktionsfragmentlängenpolymorphismus (RFLP) verwendet werden. Southern-Blots ( Sambrook J, Fritsch EF und Maniatis T (1989) Molecular Cloning, A Laboratory Manual ) von restriktionsgespaltener genomischer Pflanzen-DNA können mit den das interessierende Protein kodierenden Nukleinsäuren sondiert werden. Die erhaltenen Bandenmuster können dann genetischen Analysen unter Verwendung von Computerprogrammen, wie MapMaker ( Lander et al. (1987) Genomics 1: 174–181 ), unterworfen werden, wodurch eine Genkarte erstellt wird. Außerdem können die Nukleinsäuren zum Sondieren von Southern-Blots verwendet werden, die restriktionsendonukelasebehandelte genomische DNAs von einem Satz von Individuen enthalten, die den Elter und die Nachkommen einer bestimmten genetischen Kreuzung darstellen. Die Segregation der DNA-Polymorphismen wird ermittelt und dazu verwendet, die Position der Nukleinsäure, die ein LBD-Polypeptid kodiert, in der zuvor unter Verwendung dieser Population erhaltenen Genkarte zu berechnen ( Botstein et al. (1980) Am. J. Hum. Genet. 32: 314–331 ).The use of nucleic acids encoding the protein of interest for genetic and physical mapping of the genes requires only a nucleic acid sequence of at least 15 nucleotides in length. These nucleic acids can be used as restriction fragment length polymorphism (RFLP) markers. Southern blots ( Sambrook J, Fritsch EF and Maniatis T (1989) Molecular Cloning, A Laboratory Manual ) of restriction digested genomic plant DNA can be probed with the nucleic acids encoding the protein of interest. The resulting band patterns can then be subjected to genetic analysis using computer programs such as MapMaker ( Lander et al. (1987) Genomics 1: 174-181 ), whereby a gene map is created. In addition, the nucleic acids can be used to probe Southern blots containing restriction endonuclease-treated genomic DNAs from a set of individuals representing the parent and offspring of a particular genetic cross. Segregation of the DNA polymorphisms is determined and used to calculate the position of the nucleic acid encoding a LBD polypeptide in the gene map previously obtained using this population ( Botstein et al. (1980) Am. J. Hum. Genet. 32: 314-331 ).

Die Herstellung und Verwendung von Sonden, die von Pflanzengenen stammen, für die Verwendung bei der genetischen Kartierung ist in Bernatzky und Tanksley (1986) Plant Mol. Biol. Reporter 4: 37–41 beschrieben. Zahlreiche Veröffentlichungen beschreiben die genetische Kartierung spezifischer cDNA-Klone, wobei die vorstehend erläuterte Methodik oder Varianten davon verwendet werden. Für die Kartierung können zum Beispiel F2-Inzuchtpopulationen, Rückkreuzungspopulationen, zufallsgemäß gepaarte Populationen, nahezu isogene Linien und andere Sätze von Individuen verwendet werden. Solche Verfahren sind dem Fachmann bestens bekannt. The preparation and use of probes derived from plant genes for use in genetic mapping is described in US Pat Bernatzky and Tanksley (1986) Plant Mol. Biol. Reporter 4: 37-41 described. Numerous publications describe the genetic mapping of specific cDNA clones using the methodology or variants discussed above. For example, F2 inbred populations, backcrossing populations, randomly matched populations, near-isogenic lines, and other sets of individuals may be used for mapping. Such methods are well known to those skilled in the art.

Die Nukleinsäuresonden können auch zur physikalischen Kartierung (d. h. zum Anordnen von Sequenzen in physikalischen Karten; siehe Hoheisel et al. In: Non-mammalian Genomic Analysis: A Practical Guide, Academic Press 1996, S. 319–346 und darin genannte Bezugsstellen) verwendet werden.The nucleic acid probes may also be used for physical mapping (ie, for arranging sequences in physical maps; Hoheisel et al. In: Non-mammalian Genomic Analysis: A Practical Guide, Academic Press 1996, pp. 319-346 and references therein).

In einer anderen Ausführungsform können die Nukleinsäuresonden bei der Kartierung mittels direkter Fluoreszenz-in-situ-Hybridisierung (FISH) ( Trask (1991) Trends Genet. 7: 149–154 ) verwendet werden. Zwar bevorzugen derzeitige FISH-Kartierungsverfahren die Verwendung großer Klone (mehrere kb bis mehrere Hundert kb; siehe Laan et al. (1995) Genome Res. 5: 13–20 ), aber durch Verbesserungen in der Empfindlichkeit kann die FISH-Kartierung auch unter Verwendung kürzerer Sonden durchgeführt werden.In another embodiment, the nucleic acid probes can be used in the direct fluorescence in situ hybridization (FISH) mapping (FISH). Trask (1991) Trends Genet. 7: 149-154 ) be used. Although current FISH mapping techniques favor the use of large clones (several kb to several hundred kb; Laan et al. (1995) Genome Res. 5: 13-20 ), but with improvements in sensitivity, FISH mapping can also be performed using shorter probes.

Eine Reihe von Verfahren auf Basis von Nukleinsäureamplifikation für die genetische und physikalische Kartierung kann unter Verwendung der Nukleinsäuren durchgeführt werden. Beispiele sind u. a. die allelspezifische Amplifikation ( Kazazian (1989) J. Lab. Clin. Med 11: 95–96 ), Polymorphismus PCR-amplifizierter Fragmente (CAPS; Sheffield et al. (1993) Genomics 16: 325–332 ), allelspezifische Ligation ( Landegren et al. (1988) Science 241: 1077–1080 ), Nukleotidverlängerungsreaktionen ( Sokolov (1990) Nucleic Acid Res. 18: 3671 ), Radiation-Hybrid-Kartierung ( Walter et al. (1997) Nat. Genet. 7: 22–28 ) und Happy-Kartierung ( Dear und Cook (1989) Nucleic Acid Res. 17: 6795–6807 ). Bei diesen Verfahren wird die Sequenz einer Nukleinsäure dazu verwendet, Primer-Paare zu gestalten und herzustellen, die bei der Amplifikationsreaktion oder bei Primerverlängerungsreaktionen verwendet werden. Die Gestaltung dieser Primer ist dem Fachmann bekannt. Bei Verfahren, die eine genetische Kartierung auf PCR-Basis einsetzen, kann es notwendig sein, dass man DNA-Sequenz-Unterschiede zwischen den Eltern der Kartierungskreuzung in dem Bereich identifiziert, welcher der vorliegenden Nukleinsäuresequenz entspricht. Dies ist jedoch für Kartierungsverfahren nicht allgemein erforderlich.A number of methods based on nucleic acid amplification for genetic and physical mapping can be performed using the nucleic acids. Examples include allele-specific amplification ( Kazazian (1989) J. Lab. Clin. Med. 11: 95-96 ), Polymorphism of PCR-amplified fragments (CAPS; Sheffield et al. (1993) Genomics 16: 325-332 ), allele-specific ligation ( Landegren et al. (1988) Science 241: 1077-1080 ), Nucleotide extension reactions ( Sokolov (1990) Nucleic Acids Res. 18: 3671 ), Radiation hybrid mapping ( Walter et al. (1997) Nat. Genet. 7: 22-28 ) and happy mapping ( Dear and Cook (1989) Nucleic Acid Res. 17: 6795-6807 ). In these methods, the sequence of a nucleic acid is used to design and produce primer pairs used in the amplification reaction or in primer extension reactions. The design of these primers is known to the person skilled in the art. In methods employing PCR-based genetic mapping, it may be necessary to identify DNA sequence differences between the parents of the mapping cross in the region corresponding to the subject nucleic acid sequence. However, this is not generally required for mapping procedures.

Pflanzeplant

Der Begriff ”Pflanze” wie hier verwendet umfasst ganze Pflanzen, Vorfahren und Nachfahren der Pflanzen und Pflanzenteile, wozu Samen, Sprosse, Stängel, Blätter, Wurzeln (einschließlich Knollen), Blüten und Gewebe und Organe gehören, wobei jedes der genannten Objekte das interessierende Gen bzw. die interessierende Nukleinsäure umfasst. Der Begriff ”Pflanze” umfasst auch Pflanzenzellen, Suspensionskulturen, Kallusgewebe, Embryonen, meristematische Regionen, Gametophyten, Sporophyten, Pollen und Mikrosporen, wobei wiederum jedes der genannten Objekte das interessierende Gen bzw. die interessierende Nukleinsäure umfasst.The term "plant" as used herein includes whole plants, ancestors and descendants of the plants and plant parts, which include seeds, shoots, stems, leaves, roots (including tubers), flowers and tissues and organs, each of said objects being the gene of interest or the nucleic acid of interest. The term "plant" also includes plant cells, suspension cultures, callus tissue, embryos, meristematic regions, gametophytes, sporophytes, pollen and microspores, wherein in turn each of said objects comprises the gene of interest or the nucleic acid of interest.

Zu Pflanzen, die sich für die erfindungsgemäßen Verfahren besonders eignen, gehören all diejenigen Pflanzen, die zu der Überfamilie Viridiplantae gehören, insbesondere monokotyle und dikotyle Pflanzen, darunter Futterleguminosen, Zierpflanzen, Nahrungsmittelpflanzen, Bäume oder Sträucher aus der Liste, die unter Anderem die folgenden Pflanzen umfasst: Acer spp., Actinidia spp., Abelmoschus spp., Agave sisalana, Agropyron spp., Agrostis stolonifera, Allium spp., Amaranthus spp., Ammophila arenaria, Ananas comosus, Annona spp., Apium graveolens, Arachis spp, Artocarpus spp., Asparagus officinalis, Avena spp. (bspw. Avena sativa, Avena fatua, Avena byzantina, Avena fatua var. sativa, Avena hybrida), Averrhoa carambola, Bambusa sp., Benincasa hispida, Bertholletia excelsea, Beta vulgaris, Brassica spp. (bspw. Brassica napus, Brassica rapa ssp. [Canola-Raps, normaler Raps, Rübsen]), Cadaba farinosa, Camellia sinensis, Canna indica, Cannabis sativa, Capsicum spp., Carex elata, Carica papaya, Carissa macrocarpa, Carya spp., Carthamus tinctorius, Castanea spp., Ceiba pentandra, Cichorium endivia, Cinnamomum spp., Citrullus lanatus, Citrus spp., Cocos spp., Coffea spp., Colocasia esculenta, Cola spp., Corchorus sp., Coriandrum sativum, Corylus spp., Crataegus spp., Crocus sativus, Cucurbita spp., Cucumis spp., Cynara spp., Daucus carota, Desmodium spp., Dimocarpus longan, Dioscorea spp., Diospyros spp., Echinochloa spp., Elaeis (bspw. Elaeis guineensis, Elaeis oleifera), Eleusine coracana, Eragrostis tef, Erianthus sp., Eriobotrya japonica, Eucalyptus sp., Eugenia uniflora, Fagopyrum spp., Fagus spp., Festuca arundinacea, Ficus carica, Fortunella spp., Fragaria spp., Ginkgo biloba, Glycine spp. (bspw. Glycine max, Soja hispida oder Soja max), Gossypium hirsutum, Helianthus spp. (bspw. Helianthus annuus), Hemerocallis fulva, Hibiscus app., Hordeum spp. (bspw. Hordeum vulgare), Ipomoea batatas, Juglans spp., Lactuca sativa, Lathyrus spp., Lens culinaris, Linum usitatissimum, Litchi chinensis, Lotus spp., Luffa acutangula, Lupinus spp., Luzula sylvatica, Lycopersicon spp. (bspw. Lycopersicon esculentum, Lycopersicon lycopersicum, Lycopersicon pyriforme), Macrotyloma spp., Malus spp., Malpighia emarginata, Mammea americana, Mangifera indica, Manihot spp., Manilkara zapota, Medicago sativa, Melilotus spp., Mentha spp., Miscanthus sinensis, Momordica spp., Morus nigra, Musa spp., Nicotiana spp., Olea spp., Opuntia spp., Ornithopus spp., Oryza spp. (bspw. Oryza sativa, Oryza latifolia), Panicum miliaceum, Panicum virgatum, Passiflora edulis, Pastinaca sativa, Pennisetum sp., Persea spp., Petroselinum crispum, Phalaris arundinacea, Phaseolus spp., Phleum pratense, Phoenix spp., Phragmites australis, Physalis spp., Pinus spp., Pistacia vera, Pisum spp., Poa spp., Populus spp., Prosopis spp., Prunus spp., Psidium spp., Punica granatum, Pyrus communis, Quercus spp., Raphanus sativus, Rheum rhabarbarum, Ribes spp., Ricinus communis, Rubus spp., Saccharum spp., Salix sp., Sambucus spp., Secale cereale, Sesamum spp., Sinapis sp., Solanum spp. (bspw. Solanum tuberosum, Salanum integrifolium oder Solanum lycopersicum), Sorghum bicolor, Spinacia spp., Syzygium spp., Tagetes spp., Tamarindus indica, Theobroma cacao, Trifolium spp., Tripsacum dactyloides, Triticosecale rimpaui, Triticum spp. (bspw. Triticum aestivum, Triticum durum, Triticum turgidum, Triticum hybernum, Triticum macha, Triticum sativum, Triticum monococcum oder Triticum vulgare), Tropaeolum minus, Tropaeolum majus, Vaccinium spp., Vicia spp., Vigna spp., Viola odorata, Vitis spp., Zea mays, Zizania palustris, Ziziphus spp.Plants which are particularly suitable for the methods of the invention include all those plants belonging to the superfamily Viridiplantae, in particular monocotyledonous and dicotyledonous plants, including forage legumes, ornamental plants, food plants, trees or shrubs from the list, including the following plants includes: Acer spp., Actinidia spp., Abelmoschus spp., Agave sisalana, Agropyron spp., Agrostis stolonifera, Allium spp., Amaranthus spp., Ammophila arenaria, Ananas comosus, Annona spp., Apium graveolens, Arachis spp, Artocarpus spp ., Asparagus officinalis, Avena spp. Avena hybrida), Averrhoa carambola, Bambusa sp., Benincasa hispida, Bertholletia excelsea, Beta vulgaris, Brassica spp. (eg Brassica napus, Brassica rapa ssp. [Canola oilseed rape, normal oilseed rape, turnip rape]), Cadaba farinosa, Camellia sinensis, Canna indica, Cannabis sativa, Capsicum spp., Carex elata, Carica papaya, Carissa macrocarpa, Carya spp. , Carthamus tinctorius, Castanea spp., Ceiba pentandra, Cichorium endivia, Cinnamomum spp., Citrullus lanatus, Citrus spp., Cocos spp., Coffea spp., Colocasia esculenta, Cola spp., Corchorus sp., Coriandrum sativum, Corylus spp. , Crataegus spp., Crocus sativus, Cucurbita spp., Cucumis spp., Cynara spp., Daucus carota, Desmodium spp., Dimocarpus longan, Dioscorea spp., Diospyros spp., Echinochloa spp., Elaeis (eg Elaeis guineensis, Elaeis oleifera), Eleusine coracana, Eragrostis tef, Erianthus sp., Eriobotrya japonica, Eucalyptus sp., Eugenia uniflora, Fagopyrum spp., Fagus spp., Festuca arundinacea, Ficus carica, Fortunella spp., Fragaria spp., Ginkgo biloba, Glycine spp , (eg Glycine max, soy hispida or soy max), Gossypium hirsutum, Helianthus spp. (eg Helianthus annuus), Hemerocallis fulva, Hibiscus app., Hordeum spp. (eg Hordeum vulgare), Ipomoea batatas, Juglans spp., Lactuca sativa, Lathyrus spp., Lens culinaris, Linum usitatissimum, Litchi chinensis, Lotus spp., Luffa acutangula, Lupinus spp., Luzula sylvatica, Lycopersicon spp. (e.g., Lycopersicon esculentum, Lycopersicon lycopersicum, Lycopersicon pyriforme), Macrotyloma spp., Malus spp., Malpighia emarginata, Mammea americana, Mangifera indica, Manihot spp., Manilkara zapota, Medicago sativa, Melilotus spp., Mentha spp., Miscanthus sinensis , Momordica spp., Morus nigra, Musa spp., Nicotiana spp., Olea spp., Opuntia spp., Ornithopus spp., Oryza spp. (eg Oryza sativa, Oryza latifolia), Panicum miliaceum, Panicum virgatum, Passiflora edulis, Pastinaca sativa, Pennisetum sp., Persea spp., Petroselinum crispum, Phalaris arundinacea, Phaseolus spp., Phleum pratense, Phoenix spp., Phragmites australis, Physalis spp., Pinus spp., Pistacia vera, Pisum spp., Poa spp., Populus spp., Prosopis spp., Prunus spp., Psidium spp., Punica granatum, Pyrus communis, Quercus spp., Raphanus sativus, Rheum rhabarbarum , Ribes spp., Ricinus communis, Rubus spp., Saccharum spp., Salix sp., Sambucus spp., Secale cereale, Sesamum spp., Sinapis spp., Solanum spp. (for example, Solanum tuberosum, Salanum integrifolium or Solanum lycopersicum), Sorghum bicolor, Spinacia spp., Syzygium spp., Tagetes spp., Tamarindus indica, Theobroma cacao, Trifolium spp., Tripsacum dactyloides, Triticosecale rimpaui, Triticum spp. (eg Triticum aestivum, Triticum durum, Triticum turgidum, Triticum hybernum, Triticum macha, Triticum sativum, Triticum monococcum or Triticum vulgare), Tropaeolum minus, Tropaeolum majus, Vaccinium spp., Vicia spp., Vigna spp., Viola odorata, Vitis spp., Zea mays, Zizania palustris, Ziziphus spp.

Kontrollpflanze(n)Control plant (s)

Die Auswahl von geeigneten Kontrollpflanzen ist ein routinemäßiger Teil eines experimentellen Ansatzes und kann entsprechende Wildtyp-Pflanzen oder entsprechende Pflanzen ohne das Gen von Interesse einschließen. Die Kontrollpflanze stammt typischerweise aus der gleichen Pflanzenart oder sogar aus der gleichen Varietät wie die zu untersuchende Pflanze. Die Kontrollpflanze kann auch eine Nullizygote der zu untersuchenden Pflanze sein. Nullizygoten sind Individuen, denen das Transgen aufgrund von Segregation fehlt. Eine ”Kontrollpflanze” wie hier verwendet betrifft nicht nur die vollständigen Pflanzen, sondern auch Pflanzenteile, einschließlich Samen und Samenteilen.Selection of suitable control plants is a routine part of an experimental approach and may include appropriate wild type plants or corresponding plants without the gene of interest. The control plant is typically of the same plant species or even the same variety as the plant to be tested. The control plant may also be a nullizygote of the plant to be tested. Nullizygotes are individuals who lack the transgene due to segregation. A "control plant" as used herein does not only refer to the whole plants but also to plant parts including seeds and seed parts.

Ausführliche Beschreibung der ErfindungDetailed description of the invention

Es wurde jetzt überraschenderweise gefunden, dass die Modulation der Expression einer Nukleinsäure, die ein C3H-ähnliches Polypeptid kodiert, in einer Pflanze zu Pflanzen mit verbesserten Ertragsmerkmalen im Vergleich zu Kontrollpflanzen führt. In einer ersten Ausführungsform stellt die vorliegende Erfindung ein Verfahren zur Verbesserung der Ertragsmerkmale in Pflanzen im Vergleich zu Kontrollpflanzen, umfassend das Modulieren der Expression einer Nukleinsäure, die ein C3H-ähnliches Polypeptid kodiert, in einer Pflanze, und gegebenenfalls das Selektieren auf Pflanzen mit verbesserten Ertragsmerkmalen bereit.It has now surprisingly been found that modulation of expression of a nucleic acid encoding a C3H-like polypeptide in a plant results in plants having improved yield-related traits relative to control plants. In a first aspect, the present invention provides a method of enhancing yield-related traits in plants relative to control plants, comprising modulating expression of a nucleic acid encoding a C3H-like polypeptide in a plant, and optionally selecting for plants having improved yield-related traits ready.

Es wurde zudem jetzt überraschenderweise gefunden, dass die Modulation der Expression einer Nukleinsäure, die ein SPT-ähnliches Polypeptid kodiert, in einer Pflanze zu Pflanzen mit verbesserten Ertragsmerkmalen im Vergleich zu Kontrollpflanzen führt. In einer ersten Ausführungsform stellt die vorliegende Erfindung ein Verfahren zur Verbesserung der Ertragsmerkmale in Pflanzen im Vergleich zu Kontrollpflanzen, umfassend das Modulieren der Expression einer Nukleinsäure, die ein SPT-ähnliches Polypeptid kodiert, in einer Pflanze, und gegebenenfalls das Selektieren auf Pflanzen mit verbesserten Ertragsmerkmalen bereit.It has now surprisingly been found that modulation of the expression of a nucleic acid encoding a SPT-like polypeptide in a plant results in plants having improved yield-related traits relative to control plants. In a first aspect, the present invention provides a method of enhancing yield-related traits in plants relative to control plants, comprising modulating expression of a nucleic acid encoding an SPT-like polypeptide in a plant, and optionally selecting for plants having improved yield-related traits ready.

Es wurde zudem jetzt überraschenderweise gefunden, dass die Modulation der Expression einer Nukleinsäure, die ein IDI2-Polypeptid kodiert, in einer Pflanze zu Pflanzen mit verbesserten Ertragsmerkmalen im Vergleich zu Kontrollpflanzen führt. In einer ersten Ausführungsform stellt die vorliegende Erfindung ein Verfahren zur Verbesserung der Ertragsmerkmale in Pflanzen im Vergleich zu Kontrollpflanzen, umfassend das Modulieren der Expression einer Nukleinsäure, die ein IDI2-Polypeptid kodiert, in einer Pflanze, und gegebenenfalls das Selektieren auf Pflanzen mit verbesserten Ertragsmerkmalen bereit.It has now surprisingly been found that modulation of expression of a nucleic acid encoding an IDI2 polypeptide in a plant results in plants having improved yield-related traits relative to control plants. In a first aspect, the present invention provides a method of enhancing yield-related traits in plants relative to control plants, comprising modulating the expression of a nucleic acid encoding an IDI2 polypeptide in a plant, and optionally selecting for plants having improved yield-related traits ,

Die Erfindung stellt die bisher unbekannten IDI2-kodierenden Nukleinsäuren und IDI2-Polypeptide bereit.The invention provides the hitherto unknown IDI2-encoding nucleic acids and IDI2 polypeptides.

Gemäß einer weiteren Ausführungsform der vorliegenden Erfindung wird daher ein isoliertes Nukleinsäuremolekül aus der folgenden Reihe bereitgestellt:

• (i) eine Nukleinsäure nach einer der Sequenzen von SEQ ID NO: 139, 157, 164, 169, 171, 186;
• (ii) das Komplement einer Nukleinsäure nach einer der Sequenzen von SEQ ID NO: 139, 157, 164, 169, 171, 186;
• (iii) eine Nukleinsäure, die ein GR-RBP Polypeptid kodiert. mit in steigender Reihenfolge der Präferenz mindestens 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% oder mehr Sequenzidentität zu den Aminosäuresequenzen nach einer der Sequenzen von SEQ ID NO: 140, 202, 209, 214, 216, 231, und mit einem oder mehreren der Motive 1 bis 6.

• (i) a nucleic acid according to any of the sequences of SEQ ID NOs: 139, 157, 164, 169, 171, 186;
• (ii) the complement of a nucleic acid according to any one of the sequences of SEQ ID NOS: 139, 157, 164, 169, 171, 186;
• (iii) a nucleic acid encoding a GR-RBP polypeptide. at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more in order of preference Sequence identity to the amino acid sequences according to one of the sequences of SEQ ID NO: 140, 202, 209, 214, 216, 231, and with one or more of the motifs 1 to 6.

Gemäß einer weiteren Ausführungsform der vorliegenden Erfindung wird außerdem ein isoliertes Polypeptid aus der folgenden Reihe bereitgestellt:

• (i) eine Aminosäuresequenz nach einer der Sequenzen von SEQ ID NO: 140, 202, 209, 214, 216, 231;
• (ii) eine Aminosäuresequenz mit in steigender Reihenfolge der Präferenz mindestens 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% oder mehr Sequenzidentität zu den Aminosäuresequenzen nach einer der Sequenzen von SEQ ID NO: 140, 202, 209, 214, 216, 231, und mit einem oder mehreren der Motive 1 bis 6;
• (iii) Derivate von einer der in (i) or (ii) oben angegebenen Aminosäuresequenzen.

• (i) an amino acid sequence according to any of the sequences of SEQ ID NO: 140, 202, 209, 214, 216, 231;
• (ii) an amino acid sequence having in increasing order of preference at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% , 99% or more sequence identity to the amino acid sequences of any of the sequences of SEQ ID NO: 140, 202, 209, 214, 216, 231, and to one or more of motifs 1 to 6;
• (iii) derivatives of any of the amino acid sequences given in (i) or (ii) above.

Es wurde zudem jetzt überraschenderweise gefunden, dass die Modulation der Aktivität eines eIF4F-ähnlichen Proteinkomplexes in einer Pflanze zu Pflanzen mit verbesserten Ertragsmerkmalen im Vergleich zu Kontrollpflanzen führt. In einer ersten Ausführungsform stellt die vorliegende Erfindung ein Verfahren zur Verbesserung der Ertragsmerkmale in Pflanzen im Vergleich zu Kontrollpflanzen, umfassend das Modulieren der Aktivität eines eIF4F-ähnlichen Proteinkomplexes in einer Pflanze, und gegebenenfalls das Selektieren auf Pflanzen mit verbesserten Ertragsmerkmalen bereit. Ein eIF4F-ähnlicher Proteinkomplex besteht aus eIF4FE, 4A, 4G-Polypeptid- oder Protein-Untereinheiten.It has now surprisingly been found that modulation of the activity of an eIF4F-like protein complex in a plant results in plants having improved yield-related traits relative to control plants. In a first aspect, the present invention provides a method for enhancing yield-related traits in plants relative to control plants, comprising modulating the activity of an eIF4F-like protein complex in a plant, and optionally selecting for plants having improved yield-related traits. An eIF4F-like protein complex consists of eIF4FE, 4A, 4G polypeptide or protein subunits.

Die Erfindung stellt auch die bisher unbekannte eIF4F-Proteinkomplex-Untereinheitenkodierenden Nukleinsäuren und die Untereinheiten der Polypeptid bereit.The invention also provides the hitherto unknown eIF4F protein complex subunit-encoding nucleic acids and the subunits of the polypeptide.

Gemäß einer weiteren Ausführungsform der vorliegenden Erfindung wird daher ein isoliertes Nukleinsäuremolekül aus der folgenden Reihe bereitgestellt:

• (i) eine Nukleinsäure nach SEQ ID NO: 306;
• (ii) das Komplement einer Nukleinsäure nach SEQ ID NO: 306;
• (iii) eine Nukleinsäure, die das Polypeptid nach einer der Sequenzen von SEQ ID NO: 307 kodiert, vorzugsweise als Folge der Degeneration des genetischen Codes, wobei die isolierte Nukleinsäure hergeleitet werden kann von einer Polypeptid-Sequenz nach SEQ ID NO: 307 und die zudem vorzugsweise gesteigerte Ertragsmerkmale im Vergleich zu Kontrollpflanzen verleiht;
• (iv) eine Nukleinsäure mit in steigender Reihenfolge der Präferenz mindestens 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% Sequenzidentität zu irgend einer der Nukleinsäuresequenzen der Tabellen A4 und die zudem vorzugsweise verbesserte Ertragsmerkmale im Vergleich zu Kontrollpflanzen verleiht;
• (v) ein Nukleinsäuremolekül, das unter stringenten Hybrisierungsbedingungen mit einem Nukleinsäuremolekül von (i) bis (iv) hybridisiert und vorzugsweise verbesserte Ertragsmerkmale im Vergleich zu Kontrollpflanzen verleiht;
• (vi) eine Nukleinsäure, die mindestens ein eIF4F Untereinheit-Polypeptid kodiert mit in steigender Reihenfolge der Präferenz mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% Sequenzidentität zu der Aminosäuresequenz nach SEQ ID NO: 68 und irgend eine der anderen Aminosäuresequenzen in den Tabellen A4 und vorzugsweise verbesserte Ertragsmerkmale im Vergleich zu Kontrollpflanzen verleiht.

• (i) a nucleic acid according to SEQ ID NO: 306;
• (ii) the complement of a nucleic acid of SEQ ID NO: 306;
• (iii) a nucleic acid which encodes the polypeptide according to one of the sequences of SEQ ID NO: 307, preferably as a consequence of the degeneracy of the genetic code, wherein the isolated nucleic acid can be derived from a polypeptide sequence according to SEQ ID NO: 307 and the moreover, preferably conferred enhanced yield-related traits relative to control plants;
• (iv) a nucleic acid having in order of preference at least 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42% , 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59 %, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to any of the nucleic acid sequences of Tables A4 and which moreover gives enhanced yield-related traits relative to control plants;
• (v) a nucleic acid molecule that hybridizes under stringent hybridization conditions with a nucleic acid molecule of (i) to (iv) and preferably confers improved yield-related traits relative to control plants;
• (vi) a nucleic acid encoding at least one eIF4F subunit polypeptide having in increasing order of preference at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59% , 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76 %, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 68 and any of the other amino acid sequences in Tables A4, and preferably conferred improved yield-related traits relative to control plants ,

Gemäß einer weiteren Ausführungsform der vorliegenden Erfindung wird außerdem ein isoliertes Polypeptid aus der folgenden Reihe bereitgestellt:

• (i) eine Aminosäuresequenz nach SEQ ID NO: 307;
• (ii) eine Aminosäuresequenz mit in steigender Reihenfolge der Präferenz mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% Sequenzidentität zu der Aminosäuresequenz nach SEQ ID NO: 307 und irgend eine der anderen Aminosäuresequenzen in den Tabellen A4 und vorzugsweise verbesserte Ertragsmerkmale im Vergleich zu Kontrollpflanzen verleiht.
• (iii) Derivate von irgend einer der in (i) oder (ii) oben angegebenen Aminosäuresequenzen.

• (i) an amino acid sequence according to SEQ ID NO: 307;
• (ii) an amino acid sequence with, in order of preference, at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62% 63% 64% 65% 66% 67% 68% 69% 70% 71% 72% 73% 74% 75% 76% 77% 78% 79 %, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 307 and any of the other amino acid sequences in Tables A4, and preferably conferred improved yield-related traits relative to control plants.
• (iii) derivatives of any of the amino acid sequences given in (i) or (ii) above.

Es wurde zudem jetzt überraschenderweise gefunden, dass die Modulation der Expression einer Nukleinsäure, die ein GR-RBP-Polypeptid kodiert, in einer Pflanze zu Pflanzen mit verbesserten Ertragsmerkmalen im Vergleich zu Kontrollpflanzen führt. In einer ersten Ausführungsform stellt die vorliegende Erfindung ein Verfahren zur Verbesserung der Ertragsmerkmale in Pflanzen im Vergleich zu Kontrollpflanzen, umfassend das Modulieren der Expression einer Nukleinsäure, die ein GR-RBP-Polypeptid kodiert, in einer Pflanze, und gegebenenfalls das Selektieren auf Pflanzen mit verbesserten Ertragsmerkmalen bereit.It has now surprisingly been found that modulation of the expression of a nucleic acid encoding a GR-RBP polypeptide in a plant results in plants having improved yield-related traits relative to control plants. In a first aspect, the present invention provides a method of enhancing yield-related traits in plants relative to control plants, comprising modulating the expression of a nucleic acid encoding a GR-RBP polypeptide in a plant, and optionally selecting for plants having improved Yield characteristics ready.

Die Erfindung stellt ebenfalls bisher unbekannte GR-RBP-kodierende Nukleinsäuren und GR-RBP-Polypeptide bereit.The invention also provides previously unknown GR-RBP-encoding nucleic acids and GR-RBP polypeptides.

Gemäß einer weiteren Ausführungsform der vorliegenden Erfindung wird daher ein isoliertes Nukleinsäuremolekül aus der folgenden Reihe bereitgestellt:

• (i) eine Aminosäuresequenz nach einer der Sequenzen von SEQ ID NO: 848, 849, 851, 852, 853, 854, 857, 862, 873, 874, 875, 876, 878, 879, 893, 897, 898, 900, 901, 905, 928, 931, 932, 933, 934, 937;
• (ii) das Komplement einer Nukleinsäure nach einer der Sequenzen von SEQ ID NO: 848, 849, 851, 852, 853, 854, 857, 862, 873, 874, 875, 876, 878, 879, 893, 897, 898, 900, 901, 905, 928, 931, 932, 933, 934, 937;
• (iii) eine Nukleinsäure, die ein GR-RBP Polypeptid kodiert mit in steigender Reihenfolge der Präferenz mindestens 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% oder mehr Sequenzidentität zu den Aminosäuresequenzen nach einer der Sequenzen von SEQ ID NO: 945, 946, 948, 949, 950, 951, 954, 959, 970, 971, 972, 973, 975, 976, 990, 994, 995, 997, 998, 1002, 1025, 1028, 1029, 1030, 1031, 1034, und umfassend Signatursequenz 3 (SEQ ID NO: 830) und Signatursequenz 4 (SEQ ID NO: 831).

• (i) an amino acid sequence according to one of the sequences of SEQ ID NO: 848, 849, 851, 852, 853, 854, 857, 862, 873, 874, 875, 876, 878, 879, 893, 897, 898, 900, 901, 905, 928, 931, 932, 933, 934, 937;
• (ii) the complement of a nucleic acid according to any of the sequences of SEQ ID NOs: 848, 849, 851, 852, 853, 854, 857, 862, 873, 874, 875, 876, 878, 879, 893, 897, 898, 900, 901, 905, 928, 931, 932, 933, 934, 937;
• (iii) a nucleic acid encoding a GR-RBP polypeptide having in increasing order of preference at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more sequence identity to the amino acid sequences of any of the sequences of SEQ ID NOs: 945, 946, 948, 949, 950, 951, 954, 959, 970, 971, 972, 973, 975, 976, 990, 994, 995, 997, 998, 1002, 1025, 1028, 1029, 1030, 1031, 1034, and comprising signature sequence 3 (SEQ ID NO: 830) and signature sequence 4 (SEQ ID NO: 831).

Gemäß einer weiteren Ausführungsform der vorliegenden Erfindung wird außerdem ein isoliertes Polypeptid aus der folgenden Reihe bereitgestellt:

• (i) eine Aminosäuresequenz nach einer der Sequenzen von SEQ ID NO: 945, 946, 948, 949, 950, 951, 954, 959, 970, 971, 972, 973, 975, 976, 990, 994, 995, 997, 998, 1002, 1025, 1028, 1029, 1030, 1031, 1034;
• (ii) eine Aminosäuresequenz mit in steigender Reihenfolge der Präferenz mindestens 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% oder mehr Sequenzidentität zu den Aminosäuresequenzen nach einer der Sequenzen von SEQ ID NO: 945, 946, 948, 949, 950, 951, 954, 959, 970, 971, 972, 973, 975, 976, 990, 994, 995, 997, 998, 1002, 1025, 1028, 1029, 1030, 1031, 1034, und umfassend Signatursequenz 3 (SEQ ID NO: 830) und Signatursequenz 4 (SEQ ID NO: 831);
• (iii) Derivate von irgend einer der in (i) oder (ii) oben angegebenen Aminosäuresequenzen.

• (i) an amino acid sequence according to one of the sequences of SEQ ID NO: 945, 946, 948, 949, 950, 951, 954, 959, 970, 971, 972, 973, 975, 976, 990, 994, 995, 997, 998, 1002, 1025, 1028, 1029, 1030, 1031, 1034;
• (ii) an amino acid sequence having in increasing order of preference at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% , 99% or more sequence identity to the amino acid sequences of any of the sequences of SEQ ID NOs: 945, 946, 948, 949, 950, 951, 954, 959, 970, 971, 972, 973, 975, 976, 990, 994, 995, 997, 998, 1002, 1025, 1028, 1029, 1030, 1031, 1034, and comprising signature sequence 3 (SEQ ID NO: 830) and signature sequence 4 (SEQ ID NO: 831);
• (iii) derivatives of any of the amino acid sequences given in (i) or (ii) above.

Ein bevorzugtes Verfahren zum Modulieren (vorzugsweise Erhöhen) der Expression einer Nukleinsäure, die ein C3H-ähnliches Polypeptid, oder ein SPT-Polypeptid, oder ein IDI2-Polypeptid oder ein GR-RBP-Protein kodiert, besteht darin, dass man eine Nukleinsäure, die ein ein C3H-ähnliches Polypeptid, oder ein SPT-Polypeptid, oder ein IDI2-Polypeptid oder ein GR-RBP-Protein kodiert, in eine(r) Pflanze einbringt und exprimiert.A preferred method for modulating (preferably, increasing) the expression of a nucleic acid encoding a C3H-like polypeptide, or an SPT polypeptide, or an IDI2 polypeptide or a GR-RBP protein is by reacting a nucleic acid, the a C3H-like polypeptide, or an SPT polypeptide, or an IDI2 polypeptide or GR-RBP protein, into a plant and expressed.

Wird im folgenden Text bezüglich C3H-ähnlicher Polypeptide auf ein ”Protein, das für die erfindungsgemäßen Verfahren geeignet ist” Bezug genommen, soll darunter ein C3H-ähnliches Polypeptid, wie hier definiert, verstanden werden. Wird im folgenden Text auf eine ”Nukleinsäure, die für die erfindungsgemäßen Verfahren geeignet ist” Bezug genommen, soll dies eine Nukleinsäure bedeuten, die ein solches C3H-ähnliches Polypeptid kodieren kann. Die Nukleinsäure, die in eine Pflanze eingeführt werden soll (und daher zur Durchführung der erfindungsgemäßen Verfahren geeignet ist), ist jede Nukleinsäure, die den Typ Protein kodiert, der im Folgenden beschrieben wird, und wird im Folgenden auch als ”C3H-ähnliche Nukleinsäure” oder ”C3H-ähnliches Gen” bezeichnet.When reference is made in the following to C3H-like polypeptides for a "protein useful in the methods of the invention", it is intended to mean a C3H-like polypeptide as defined herein. When reference is made in the following text to a "nucleic acid which is suitable for the methods according to the invention", this is intended to mean a nucleic acid which can encode such a C3H-like polypeptide. The nucleic acid to be introduced into a plant (and therefore suitable for carrying out the methods according to the invention) is any nucleic acid which codes for the type of protein which will be described below, and is also referred to below as "C3H-like nucleic acid" or "C3H-like gene".

Ein ”C3H-ähnliches Polypeptid” wie hier definiert steht für ein beliebiges Polypeptid, umfassend Domäne 4 und eine oder mehrere der Domänen 1, 2, 3 und 5:
Domäne 1: C-X₂-C-X_12-23-C-X₂-C-X₂-G-F
wobei X irgend eine Aminosäure ist, und die unterstrichenen Reste konserviert sind
Domäne 2: Y-X_7-12-L-X₃-P-X₁₀-G
wobei X irgend eine Aminosäure ist, und die unterstrichenen Reste konserviert sind
Domäne 3: S-K-X₆-P wobei X irgend eine Aminosäure ist, und die unterstrichenen Reste konserviert sind
Domäne 4: RING-C3H2C3 Typ
Domäne 5: DUF1117A "C3H-like polypeptide" as defined herein means any polypeptide comprising domain 4 and one or more of domains 1, 2, 3 and 5:
Domain 1: C - X ₂ - C - X _12-23 - C - X ₂ - C - X ₂ - G - F
wherein X is any amino acid and the underlined residues are conserved
Domain 2: Y -X _7-12 - L -X ₃ - P -X ₁₀ - G
wherein X is any amino acid and the underlined residues are conserved
Domain 3: S - K - X ₆ - P where X is any amino acid and the underlined residues are conserved
Domain 4: RING-C3H2C3 type
Domain 5: DUF1117

Vorzugsweise ist Domäne 1: CYSCTRFINLSDHTL----------IVCPHCDNGF, oder eine Domäne, umfassend die unterstrichenen konservierten Reste und mit in steigender Reihenfolge der Präferenz mindestens 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% oder mehr Sequenzidentität zu den nicht unterstrichenen Resten in Domäne 1, wobei ”-” eine Lücke oder irgend ein beliebiger Rest ist.Preferably, domain 1 is: C YS C TRFINLSDHTL ---------- IV C PH C DN GF , or a domain comprising the underlined conserved residues and having in increasing order of preference at least 60%, 65%, 70 %, 75%, 80%, 85%, 90%, 95% or more sequence identity to the non-underlined residues in domain 1, where "-" is a gap or any residue.

Vorzugsweise ist Domäne 2: YDDGDG-----SGLRPLPPTVSEFLLGSG, oder eine Domäne, umfassend die unterstrichenen konservierten Reste und mit in steigender Reihenfolge der Präferenz mindestens 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% oder mehr Sequenzidentität zu den nicht unterstrichenen Resten in Domäne 2, wobei ”-” eine Lücke oder irgend ein beliebiger Rest ist.Preferably, domain 2 is: Y DDGDG ----- SG L RPL P PTVSEFLLGS G , or a domain comprising the underlined conserved residues and having in increasing order of preference at least 60%, 65%, 70%, 75%, 80% , 85%, 90%, 95% or more sequence identity to the non-underlined residues in domain 2, where "-" is a gap or any residue.

Vorzugsweise ist Domäne 3: SKAAIESMP, oder eine Domäne, umfassend die unterstrichenen konservierten Reste und mit in steigender Reihenfolge der Präferenz mindestens 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% oder mehr Sequenzidentität zu den nicht unterstrichenen Resten in Domäne 3.Preferably, domain 3 is SK AAIESM P , or a domain comprising the underlined conserved groups and having in increasing order of preference at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more sequence identity to the non-underlined residues in domain 3.

Vorzugsweise ist Domäne 4: CAVCKEEFELHAEARELPCKHLYHSDCILPWLTVRNSCPVCR, oder eine Domäne, umfassend die unterstrichenen konservierten Reste und mit in steigender Reihenfolge der Präferenz mindestens 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% oder mehr Sequenzidentität zu den nicht unterstrichenen Resten in Domäne 4.Preferably, domain 4 is CA VCKEEFELHAEAREL PC K H LY H SD C IL PW LTVRNSC P VCR, or a domain comprising the underlined conserved residues and having in increasing order of preference at least 60%, 65%, 70%, 75%, 80 %, 85%, 90%, 95% or more sequence identity to the non-underlined residues in domain 4.

Vorzugsweise ist Domäne 5: GLTIWRLPGGGFAVGRFSGGRSA-GESHFPVVYTEMDGGLN, oder eine Domäne mit in steigender Reihenfolge der Präferenz mindestens 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% oder mehr Sequenzidentität zu den nicht unterstrichenen Resten in Domäne 5, wobei ”-” eine Lücke oder irgend ein beliebiger Rest ist.Preferably, domain 5 is: GLTIWRLPGGGFAVGRFSGGRSA-GESHFPVVYTEMDGGLN, or a domain having in increasing order of preference at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more sequence identity to the non-underlined residues in domain 5, where "-" is a gap or any remainder.

Das Homologon eines C3H-ähnlichen Polypeptids hat in steigender Reihenfolge der Präferenz mindestens 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% Gesamt-Sequenzidentität zu der Aminosäure nach SEQ ID NO: 2, und umfasst DOMÄNE 4 eine oder mehrere von DOMÄNE 1, 2, 3 und 5. Die Gesamtsequenzidentität wird unter Anwendung eines globalen Alignment-Algorithmus, wie dem Needleman-Wunsch-Algorithmus im Programm GAP (GCG Wisconsin Package, Accelrys), vorzugsweise mit Standardparametern und vorzugsweise mit Sequenzen reifer Proteine (d. h. ohne Berücksichtigung von Sekretionssignalen oder Transitpeptiden), ermittelt. Im Vergleich zu der Gesamtsequenzidentität wird die Sequenzidentität im Allgemeinen höher sein, wenn lediglich konservierte Domänen oder Motive betrachtet werden.The homologue of a C3H-like polypeptide has in increasing order of preference at least 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53% , 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70 %, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% total sequence identity to the amino acid according to SEQ ID NO: 2, and DOMAIN 4 comprises one or more of DOMAINS 1, 2, 3, and 5. Overall sequence identity is preferably determined using a global alignment algorithm, such as the Needleman-Wunsch algorithm in the GAP program (GCG Wisconsin Package, Accelrys) Standard parameters and preferably with sequences of mature proteins (ie without consideration of secretion signals or transit peptides) determined. In comparison to overall sequence identity, sequence identity will generally be higher when only conserved domains or motifs are considered.

Die Polypeptid-Sequenz bildet bei der Verwendung bei der Konstruktion eines Stammbaums, wie er in der 2 gezeigt ist, mit der Gruppe der C3H-ähnlichen Polypeptide umfassend die Aminosäuresequenz nach SEQ ID NO: 2, eher Cluster als mit irgend einer anderen Gruppe.The polypeptide sequence, when used in the construction of a pedigree, as described in U.S. Pat 2 with the group of C3H-like polypeptides comprising the amino acid sequence of SEQ ID NO: 2, rather clusters than with any other group.

Wird im folgenden Text bezüglich SPT-ähnlicher Polypeptide auf ein ”Protein, das für die erfindungsgemäßen Verfahren geeignet ist” Bezug genommen, soll darunter ein SPT-ähnliches Polypeptid, wie hier definiert, verstanden werden. Wird im folgenden Text auf eine ”Nukleinsäure, die für die erfindungsgemäßen Verfahren geeignet ist” Bezug genommen, soll dies eine Nukleinsäure bedeuten, die ein solches SPT-ähnliches Polypeptid kodieren kann. Die Nukleinsäure, die in eine Pflanze eingeführt werden soll (und daher zur Durchführung der erfindungsgemäßen Verfahren geeignet ist), ist jede Nukleinsäure, die den Typ Protein kodiert, der im Folgenden beschrieben wird, und wird im Folgenden auch als ”SPT-ähnliche Nukleinsäure” oder ”SPT-ähnliches Gen” bezeichnet.When reference is made in the following to SPT-like polypeptides for a "protein useful in the methods of the invention", it is intended to mean an SPT-like polypeptide as defined herein. When reference is made in the following text to a "nucleic acid which is suitable for the methods according to the invention", this is intended to mean a nucleic acid which can encode such a SPT-like polypeptide. The nucleic acid to be introduced into a plant (and therefore suitable for carrying out the methods according to the invention) is any nucleic acid which codes for the type of protein which will be described below and is also referred to below as "SPT-like nucleic acid" or "SPT-like gene".

Ein ”SPT-ähnliches Polypeptid”, wie hier definiert betrifft ein beliebiges Polypeptid, umfassend vorzugsweise vom N-Terminus zum C-Terminus jeweils die folgenden:

Motiv I: eine amphipathische Helix, umfassend EEISTFLHQLLH, oder ein Motiv mit in steigender Reihenfolge der Präferenz mindestens 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% oder mehr Sequenzidentität zu Motiv I.

Motiv II: eine saure Domäne, umfassend DLGDFSCDSEK, oder ein Motiv mit in steigender Reihenfolge der Präferenz mindestens 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% oder mehr Sequenzidentität zu Motiv 11.

Motiv III: eine bHLH Domäne, umfassend: AAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEYLKQL, oder ein Motiv mit in steigender Reihenfolge der Präferenz mindestens 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% oder mehr Sequenzidentität zu Motiv III.An "SPT-like polypeptide" as defined herein refers to any polypeptide, preferably comprising from the N-terminus to the C-terminus, each of the following:

Motif I: an amphipathic helix comprising EEISTFLHQLLH, or a motif having in increasing order of preference at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more sequence identity to motif I.

Motif II: an acidic domain comprising DLGDFSCDSEK, or a motif having in increasing order of preference at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more sequence identity to motif 11.

Motif III: a bHLH domain comprising: AAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEYLKQL, or a motif having in increasing order of preference at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more sequence identity to motif III ,

Das SPT-ähnliche Polypeptid umfasst vorzugsweise eine oder mehrere serinreiche Regionen. Eine serinreiche Region soll in steigender Reihenfolge der Präferenz mindestens 30%, 40%, 50%, 60%, 70%, 80%, 90% oder mehr Serinreste in einem bestimmten Bereich von zusammenhängenden Aminosäuren bedeuten.The SPT-like polypeptide preferably comprises one or more serine-rich regions. A serine-rich region is said to have at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, or more serine residues in a particular range of contiguous amino acids in increasing order of preference.

Die ein oder mehreren serinreichen Regionen sind vorzugsweise wie in dem Alignment von 4 angeordnet.The one or more serine rich regions are preferably as in the alignment of 4 arranged.

Die bHLH umfasst vorzugsweise zudem mindestens ein oder mehrere Kernlokalisationssignale (NLS), vorzugsweise an den Stellen, die in dem Alignment von 4 angegeben sind.The bHLH preferably also comprises at least one or more nuclear localization signals (NLS), preferably at the sites that are in the alignment of 4 are indicated.

Das SPT-ähnliche Polypeptid umfasst vorzugsweise einen beta Strang nächst der bHLH Domäne ganz nahe an der C-terminalen Region, wobei der beta Strang vorzugsweise QLQVQMLTM umfasst.The SPT-like polypeptide preferably comprises a beta strand next to the bHLH domain very close to the C-terminal region, the beta strand preferably comprising QLQVQMLTM.

Zusätzlich oder alternativ hat das SPT-ähnliche Polypeptid in steigender Reihenfolge der Präferenz mindestens 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% Gesamt-Sequenzidentität zu der Aminosäure nach SEQ ID NO: 97 und umfasst jedes der Motive I bis III wie vorstehend definiert. Die Gesamtsequenzidentität wird unter Anwendung eines globalen Alignment-Algorithmus, wie dem Needleman-Wunsch-Algorithmus im Programm GAP (GCG Wisconsin Package, Accelrys), vorzugsweise mit Standardparametern und vorzugsweise mit Sequenzen reifer Proteine (d. h. ohne Berücksichtigung von Sekretionssignalen oder Transitpeptiden), ermittelt. Im Vergleich zu der Gesamtsequenzidentität wird die Sequenzidentität im Allgemeinen höher sein, wenn lediglich konservierte Domänen oder Motive betrachtet werden.Additionally or alternatively, the SPT-like polypeptide has in increasing order of preference at least 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%. , 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53 %, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86% , 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% total sequence identity to the amino acid of SEQ ID NO : 97 and comprises each of the motifs I to III as defined above. Overall sequence identity is determined using a global alignment algorithm such as the Needleman-Wunsch algorithm in the GAP program (GCG Wisconsin Package, Accelrys), preferably with standard parameters and preferably with sequences of mature proteins (i.e., without regard to secretion signals or transit peptides). In comparison to overall sequence identity, sequence identity will generally be higher when only conserved domains or motifs are considered.

Die Polypeptid-Sequenz bildet bei der Verwendung bei der Konstruktion eines Stammbaums, wie er in der 5 gezeigt ist, mit der Gruppe der SPT-ähnlichen Polypeptide, umfassend die Aminosäuresequenz nach SEQ ID NO: 97 (durch Pfeil angezeigt), eher Cluster als mit irgend einer anderen Gruppe.The polypeptide sequence, when used in the construction of a pedigree, as described in U.S. Pat 5 with the group of SPT-like polypeptides comprising the amino acid sequence of SEQ ID NO: 97 (indicated by arrow), clusters rather than any other group.

Wird im folgenden Text bezüglich IDI2-ähnlicher Polypeptide auf ein ”Protein, das für die erfindungsgemäßen Verfahren geeignet ist” Bezug genommen, soll darunter ein IDI2-Polypeptid, wie hier definiert, verstanden werden. Wird im folgenden Text auf eine ”Nukleinsäure, die für die erfindungsgemäßen Verfahren geeignet ist” Bezug genommen, soll dies eine Nukleinsäure bedeuten, die ein solches IDI2-Polypeptid kodieren kann. Die Nukleinsäure, die in eine Pflanze eingeführt werden soll (und daher zur Durchführung der erfindungsgemäßen Verfahren geeignet ist), ist jede Nukleinsäure, die den Typ Protein kodiert, der im Folgenden beschrieben wird, und wird im Folgenden auch als ”IDI2-Nukleinsäure” oder ”IDI2-Gen” bezeichnet.When reference is made in the following text to IDI2-like polypeptides for a "protein useful in the methods of the invention", it is intended to mean an IDI2 polypeptide as defined herein. When reference is made in the following text to a "nucleic acid which is suitable for the methods according to the invention", this is intended to mean a nucleic acid which can encode such an IDI2 polypeptide. The nucleic acid to be introduced into a plant (and therefore suitable for carrying out the methods of the invention) is any nucleic acid encoding the type of protein described below, and will also be referred to hereinafter as "IDI2 nucleic acid" or Referred to as "IDI2 gene".

Ein ”IDI2 Polypeptid” wie hier definiert betrifft irgend eine alpha Untereinheit des eukaryotischen Translationsinitiationsfaktors EIF-2B, wobei die alpha Untereinheit eine IF-2B Domäne (Pfam Zugangs-Nr. PF01008) umfasst. Das IDI2 Polypeptid umfasst vorzugsweise auch eines oder mehrere der folgenden Motive:

Das IDI2 Polypeptid umfasst stärker bevorzugt mindestens 2, am stärksten bevorzugt 3 der vorstehenden Motive.The IDI2 polypeptide more preferably comprises at least 2, most preferably 3 of the above motifs.

Alternativ hat das Homologon des IDI2 Proteins in steigender Reihenfolge der Präferenz mindestens 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% Gesamt-Sequenzidentität zu der Aminosäure nach SEQ ID NO: 140, vorausgesetzt, dass das homologe Protein die konservierten Motive wie vorstehend gezeigt umfasst. Die Gesamtsequenzidentität wird unter Anwendung eines globalen Alignment-Algorithmus, wie dem Needleman-Wunsch-Algorithmus im Programm GAP (GCG Wisconsin Package, Accelrys), vorzugsweise mit Standardparametern ermittelt. Im Vergleich zu der Gesamtsequenzidentität wird die Sequenzidentität im Allgemeinen höher sein, wenn lediglich konservierte Domänen oder Motive betrachtet werden. Die Motive in einem IDI2 Polypeptid haben vorzugsweise in steigender Reihenfolge der Präferenz mindestens 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% Sequenzidentität zu den Motiven nach SEQ ID NO: 141 bis SEQ ID NO: 146 (Motive 1 bis 6).Alternatively, the homologue of the IDI2 protein has at least 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37 in increasing order of preference %, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70% 71% 72% 73% 74% 75% 76% 77% 78% 79% 80% 81% 82% 83% 84% 85% 86% 87 %, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% total sequence identity to the amino acid of SEQ ID NO: 140 provided that the homologous protein comprises the conserved motifs as shown above. Overall sequence identity is determined using a global alignment algorithm, such as the Needleman-Wunsch algorithm in the GAP program (GCG Wisconsin Package, Accelrys), preferably with default parameters. In comparison to overall sequence identity, sequence identity will generally be higher when only conserved domains or motifs are considered. The motifs in an IDI2 polypeptide preferably have in increasing order of preference at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% , or 99% sequence identity to the motifs according to SEQ ID NO: 141 to SEQ ID NO: 146 (motifs 1 to 6).

Die Polypeptid-Sequenz bildet bei der Verwendung bei der Konstruktion eines Stammbaums, wie er in der 9 gezeigt ist, mit der Gruppe A oder B eher Cluster als mit irgend einer anderen Gruppe, stärker bevorzugt bildet die Polypeptid-Sequenz mit der Gruppe A der IDI2-Polypeptide, umfassend die Aminosäuresequenz nach SEQ ID NO: 140, Cluster.The polypeptide sequence, when used in the construction of a pedigree, as described in U.S. Pat 9 more preferably clusters with group A or B than with any other group, more preferably the polypeptide sequence with group A of IDI2 polypeptides comprising the amino acid sequence of SEQ ID NO: 140, cluster.

Bezüglich der eIF4F-ähnlichen Proteinkomplex-Untereinheiten, kann die Aktivität eines eIF4F-ähnlichen Proteinkomplexes vorzugsweise moduliert werden, indem man die Expression von einer oder mehreren der Untereinheiten des eIF4F-ähnlichen Proteinkomplexes, nämlich eIF4G und/oder eIF4A und/oder eIF4E, moduliert, und/oder indem man die Spiegel des eIF4F-ähnlichen Proteinkomplexes moduliert. Ein bevorzugtes Verfahren zur Modulation der Aktivität eines eIF4F-ähnlichen Proteinkomplexes ist durch Einbringen und Exprimieren einer Nukleinsäure, die eine eIF4F-ähnliche Proteinkomplex-Untereinheit kodiert, wie eine oder mehrere von eIF4E, eIF4G, und/oder eIF4A und/oder Isoformen davon in eine(r) Pflanze.With respect to the eIF4F-like protein complex subunits, the activity of an eIF4F-like protein complex may preferably be modulated by modulating the expression of one or more of the subunits of the eIF4F-like protein complex, eIF4G and / or eIF4A and / or eIF4E, and / or by modulating the levels of the eIF4F-like protein complex. A preferred method of modulating the activity of an eIF4F-like protein complex is by introducing and expressing a nucleic acid encoding an eIF4F-like protein complex subunit, such as one or more of eIF4E, eIF4G, and / or eIF4A and / or isoforms thereof (r) plant.

Ein ”eIF4F-ähnlicher Proteinkomplex” wie hier definiert betrifft irgend einen Proteinkomplex, umfassend eIF4E, eIF4G, und/oder eIF4A Untereinheiten und/oder isoformen davon. In Pflanzen besteht ein Auftreten von eIF4F vorwiegend aus eIFiso4G, eIFiso4E und eIF4A Untereinheiten.An "eIF4F-like protein complex" as defined herein refers to any protein complex comprising eIF4E, eIF4G, and / or eIF4A subunits and / or isoforms thereof. In plants, eIF4F predominantly consists of eIFiso4G, eIFiso4E and eIF4A subunits.

Funktionen der Bestandteil-Untereinheiten des eIF4F-ähnlichen Proteinkomplexes umfassen die Erkennung der mRNA 5 Kappenstruktur (eIF4E), die Abgabe einer RNA Helicase an die 5' Region (eIF4A), die Überbrückung der mRNA und des Ribosoms (eIF4G), und die Zirkularisierung der mRNA über die Wechselwirkung mit poly(A)-bindendem Protein (eIF4G).Functions of the constituent subunits of the eIF4F-like protein complex include recognition of the mRNA 5 cap structure (eIF4E), delivery of an RNA helicase to the 5 'region (eIF4A), bridging of the mRNA and ribosome (eIF4G), and circularization of the mRNA via the interaction with poly (A) -binding protein (eIF4G).

1. Definition von IF4isoG:1. Definition of IF4isoG:

eIF4isoG gehört zu dem eIF4F-ähnlichen Proteinkomplex und ist ein Dockingelement für eIF4E und eIF4A, eIF4B, polyA bindendes Protein. Es ist eine Isoform von eIF4G uns seine sequenz hat etwa 750–800 Aminosäuren. ”eIF4isoG Polypeptid” wie hier definiert betrifft ein beliebiges Polypeptid, das die folgenden 3 Motive umfasst:

Motiv 7: KAV[LF]EPTFCPMYA[QL]LCSDLNEKLP[PS]FPS[ED]EPGGKEITFKRVLLN[NI]CQEAF oder ein Motiv mit in steigender Reihenfolge der Präferenz von mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% oder mehr Sequenzidentität zu Motiv 7.

Motiv 8: CP[AE]EENVEAIC[QH]FFNTIGKQLDE[SN]PKSRRIND[MVT]YF[SIN][RQ]LKEL[TS][TS]NPQLAPR oder ein Motiv mit in steigender Reihenfolge der Präferenz von mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% oder mehr Sequenzidentität zu Motiv 8.

Motiv 9: T[AG]P[DE]QE[ML]ERRDKERLVKLRTLGNIRLIGELLKQKMVPEKIVHHIVQELLG oder ein Motiv mit in steigender Reihenfolge der Präferenz von mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% oder mehr Sequenzidentität zu Motiv 9.eIF4isoG belongs to the eIF4F-like protein complex and is a docking element for eIF4E and eIF4A, eIF4B, polyA binding protein. It is an isoform of eIF4G us its sequence has about 750-800 Amino acids. "EIF4isoG polypeptide" as defined herein refers to any polypeptide comprising the following 3 motifs:

Motif 7: KAV [LF] EPTFCPMYA [QL] LCSDLNEKLP [PS] FPS [ED] EPGGKEITFKRVLLN [NI] CQEAF or a motif in increasing order of preference of at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71% , 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88 %, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more sequence identity to motif 7.

Motive 8: CP [AE] EENVEAIC [QH] FFNTIGKQLDE [SN] PKSRRIND [MVT] YF [SIN] [RQ] LKEL [TS] [TS] NPQLAPR or a subject with increasing order of preference of at least 50%, 51% , 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68 %, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more Sequence identity to subject 8th.

Motif 9: T [AG] P [DE] QE [ML] ERRDKERLVKLRTLGNIRLIGELLKQKMVPEKIVHHIVQELLG or a subject in increasing order of preference of at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57% 58% 59% 60% 61% 62% 63% 64% 65% 66% 67% 68% 69% 70% 71% 72% 73% 74 %, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more sequence identity to motif 9.

Das erfindungsgemäße eIF4isoG Polypeptid umfasst vorzugsweise die folgenden konservierten Domänen: MA3 (PFam Zugangsnummer: PF02847) und MIF4G (PFam Zugangsnummer: PF02854).The eIF4isoG polypeptide of the invention preferably comprises the following conserved domains: MA3 (PFam accession number: PF02847) and MIF4G (PFam accession number: PF02854).

2. Definition von IF4G:2. Definition of IF4G:

eIF4G gehört zu dem eIF4F-ähnlichen Proteinkomplex und ist ebenfalls ein Dockingelement für eIF4F und eIF4A, eIF4B, polyA bindendes Protein, so dass man eine äquivalente Bindung erhält, die funktionell wie eIF4isoG in Bezug auf seine Rolle bei der Translation ist. Seine Sequenz hat etwa 1570–1900 Aminosäuren. ”eIF4G Polypeptid” wie hier definiert betrifft irgend ein Polypeptid, das die folgenden 3 Motive umfasst:

Motiv 10: TPQNF[ED][KR]LFEQVKAVNIDN[AV]VTL[TN]GVISQIF[DE]KALMEPTFCEMYANFCFH oder ein Motiv mit in steigender Reihenfolge der Präferenz von mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% oder mehr Sequenzidentität zu Motiv 10.

Motiv 11: IGELYKK[RK]MLTERIMHECIKKLLGQYQ[DN]PDEE[DN][IV]E[AS]LCKLMSTIGEMIDH oder ein Motiv mit in steigender Reihenfolge der Präferenz von mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% oder mehr Sequenzidentität zu Motiv 11.

Motiv 12: LSNN[MQ][KN]LSSRVRFMLKD[ASV]IDLRKNKWQQRRKVEGPKKIEEVHRDAAQERQ oder ein Motiv mit in steigender Reihenfolge der Präferenz von mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, Oder 99% Oder mehr Sequenzidentität zu Motiv 12.eIF4G belongs to the eIF4F-like protein complex and is also a docking element for eIF4F and eIF4A, eIF4B, polyA binding protein, providing an equivalent binding that is functional as eIF4isoG in terms of its role in translation. Its sequence has about 1570-1900 amino acids. "EIF4G polypeptide" as defined herein refers to any polypeptide comprising the following 3 motifs:

Subject 10: TPQNF [ED] [KR] LFEQVKAVNIDN [AV] VTL [TN] GVISQIF [DE] KALMEPTFCEMYANFCFH or a subject with increasing order of preference of at least 50%, 51%, 52%, 53%, 54%, 55 %, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88% , 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more sequence identity to motif 10.

Motif 11: IGELYKK [RK] MLTERIMHECIKKLLGQYQ [DN] PDEE [DN] [IV] E [AS] LCKLMSTIGEMIDH or a subject in increasing order of preference of at least 50%, 51%, 52%, 53%, 54%, 55 %, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88% , 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more sequence identity to motif 11.

Subject 12: LSNN [MQ] [KN] LSSRVRFMLKD [ASV] IDLRKNKWQQRRKVEGPKKIEEVHRDAAQERQ or a subject with in order of preference of at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74% , 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more sequence identity to motif 12.

Das erfindungsgemäße eIF4G Polypeptid umfasst vorzugsweise die folgenden konservierten Domänen: MA3 (PFam Zugangsnummer: PF02847) und MIF4G (PFam Zugangsnummer: PF02854).The eIF4G polypeptide of the invention preferably comprises the following conserved domains: MA3 (PFam accession number: PF02847) and MIF4G (PFam accession number: PF02854).

3. Definition von eIF4A Polypeptid:3. Definition of eIF4A polypeptide:

eIF4A Polypeptid ist ebenfalls eine Untereinheit des eIF4F-ähnlichen Proteinkomplexes und ist dasjenige Polypeptid, das an eIF4G/isoG bindet, und eIF4E an der m7Gppp Kappe der mRNA bindet. Seine Sequenz hat etwa 369–414 Aminosäuren Länge. ”eIF4A Polypeptid” wie hier definiert betrifft irgend ein Polypeptid, das die folgenden 3 Motive umfasst:

Motiv 13: RDELTLEGIKQF[YF]V[NA]V[ED][KR]EEWK[LF][DE]TLCDLY[ED]TL[AT]ITQ[SA]VIF oder ein Motiv mit in steigender Reihenfolge der Präferenz von mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% oder mehr Sequenzidentität zu Motiv 13.

Motiv 14: SLVINYDLP[TN][QN][PR]E[NL]Y[LI]HRIGRSGRFGRKGVAINF oder ein Motiv mit in steigender Reihenfolge der Präferenz von mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% oder mehr Sequenzidentität zu Motiv 14.

Motiv 15: MG[LI][QK]E[ND]LLRGIYAYGFEKPSAIQQR[GA][IV]VP[FI][CI]KG[LR]DVI[QA]QAQSGTGKT[AS][TM][FI] oder ein Motiv mit in steigender Reihenfolge der Präferenz von mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64% 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96% 97%, 98%, oder 99% oder mehr Sequenzidentität zu Motiv 15.eIF4A polypeptide is also a subunit of the eIF4F-like protein complex and is the polypeptide that binds to eIF4G / isoG and binds eIF4E to the m7Gppp cap of the mRNA. Its sequence has about 369-414 amino acids in length. "EIF4A polypeptide" as defined herein refers to any polypeptide comprising the following 3 motifs:

Motif 13: RDELTLEGIKQF [YF] V [NA] V [ED] [KR] EEWK [LF] [DE] TLCDLY [ED] TL [AT] ITQ [SA] VIF or a subject in ascending order of preference of at least 50 %, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83% , 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more sequence identity to motif 13.

Subject 14: SLVINYDLP [TN] [QN] [PR] E [NL] Y [LI] HRIGRSGRFGRKGVAINF or a subject with increasing order of preference of at least 50%, 51%, 52%, 53%, 54%, 55% 56% 57% 58% 59% 60% 61% 62% 63% 64% 65% 66% 67% 68% 69% 70% 71% 72 %, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more sequence identity to motif 14.

Motif 15: MG [LI] [QK] E [ND] LLRGIYAYGFEKPSAIQQR [GA] [IV] VP [FI] [CI] KG [LR] DVI [QA] QAQSGTGKT [AS] [TM] [FI] or a motif with in ascending order of preference of at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64 % 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81 % 82% 83% 84% 85% 86% 87% 88% 89% 90% 91% 92% 93% 94% 95% 96% 97% 98 %, or 99% or more sequence identity to motif 15.

Das erfindungsgemäße eIF4A Polypeptid umfasst vorzugsweise die folgenden konservierten Domänen: DEAD (PFam Zugangsnummer: PF00270) und Helicase_C (PFam Zugangsnummer: PF00271).The eIF4A polypeptide of the invention preferably comprises the following conserved domains: DEAD (PFam accession number: PF00270) and Helicase_C (PFam accession number: PF00271).

4. Definition von eIF4E Polypeptid:4. Definition of eIF4E polypeptide:

Das eIF4E Polypeptid ist ebenfalls eine Untereinheit des eIF4F-ähnlichen Proteinkomplexes und ist dasjenige Polypeptid, das an eIF4G/isoG und an die m7Gppp Kappe der mRNA in dem Translations-Initiations-Prozess bindet. Es hat etwa 195–286 Aminosäuren Länge. ”eIF4E Polypeptid” wie hier definiert betrifft irgend ein Polypeptid, das die folgenden 3 Motive umfasst:

Motiv 16: YTFSTVE[ED]FW[SG]LYNNIH[HR]PSKLAVGADF[HY]CFK[NH]KIEPKWEDP[VI]CA NGGKW oder ein Motiv mit in steigender Reihenfolge der Präferenz von mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% oder mehr Sequenzidentität zu Motiv 16.

Motiv 17: T[SC]WLYTLLA[ML]IGEQFD[HY]GD[ED]ICGAVV[NS]VR oder ein Motiv mit in steigender Reihenfolge der Präferenz von mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% oder mehr Sequenzidentität zu Motiv 17.

Motiv 18: E[KR]I[AS][LI]WTKNA[AS]NE[AST]AQ[VL]SIGKQWKEFLDYN[DE][TS]IGFIFH[ED]DA oder ein Motiv mit in steigender Reihenfolge der Präferenz von mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% oder mehr Sequenzidentität zu Motiv 18.The eIF4E polypeptide is also a subunit of the eIF4F-like protein complex and is the polypeptide that binds to eIF4G / isoG and to the m7Gppp cap of the mRNA in the translation initiation process. It has about 195-286 amino acids in length. "EIF4E polypeptide" as defined herein refers to any polypeptide comprising the following 3 motifs:

Motif 16: YTFSTVE [ED] FW [SG] LYNNIH [HR] PSKLAVGADF [HY] CFK [NH] KIEPKWEDP [VI] CA NGGKW or a motif in increasing order of preference of at least 50%, 51%, 52%, 53 %, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86% , 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more sequence identity to motif 16.

Motif 17: T [SC] WLYTLLA [ML] IGEQFD [HY] GD [ED] ICGAVV [NS] VR or a motif in increasing order of preference of at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71% , 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88 %, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more sequence identity to motif 17.

Motif 18: E [KR] I [AS] [LI] WTKNA [AS] NE [AST] AQ [VL] SIGKQWKEFLDYN [DE] [TS] IGFIFH [ED] DA or a subject in increasing order of preference of at least 50 %, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83% , 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more sequence identity to motif 18.

Das erfindungsgemäße eIF4E Polypeptid umfasst vorzugsweise die folgende konservierte Domäne: IF4E (PFam Zugangsnummer: PF01652).The eIF4E polypeptide of the invention preferably comprises the following conserved domain: IF4E (PFam accession number: PF01652).

5. Definition von eIF4isoE Polypeptid:5. Definition of eIF4isoE polypeptide:

Das eIF4isoE Polypeptid ist eine Isoform von eIF4E und eine Untereinheit des eIF4F-ähnlichen Proteinkomplexes. Es hat die gleichen Bindungsaktivitäten wie eIF4E und hat etwa 189–217 Aminosäuren Länge. ”eIF4isoE Polypeptid” wie hier definiert betrifft irgend ein Polypeptid, das die folgenen 3 Motive umfasst:

Motiv 19: WCLYDQ[IV]F[KR]PSKLP[GA]NADFHLFKAG[VI]EPKWEDPECANGGKW oder ein Motiv mit in steigender Reihenfolge der Präferenz von mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% oder mehr Sequenzidentität zu Motiv 19.

Motiv 20: L[ED]TMWLETLMALIGEQFD[ED][AS][DE][ED]ICGVVASVR oder ein Motiv mit in steigender Reihenfolge der Präferenz von mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% oder mehr Sequenzidentität zu Motiv 20.

Motiv 21: QDKL[SA]LWT[KR][TN]A[AS]NEA[AV]QM[SG]IG[RK]KWKE[IV]ID mit in steigender Reihenfolge der Präferenz von mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61% 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% oder mehr Sequenzidentität zu Motiv 21.The eIF4isoE polypeptide is an isoform of eIF4E and a subunit of the eIF4F-like protein complex. It has the same binding activities as eIF4E and has about 189-217 amino acids in length. "EIF4isoE polypeptide" as defined herein refers to any polypeptide comprising the following 3 motifs:

Motif 19: WCLYDQ [IV] F [KR] PSKLP [GA] NADFHLFKAG [VI] EPKWEDPECANGGKW or a motive with increasing order of preference of at least 50%, 51%, 52%, 53%, 54%, 55%, 56 %, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89% , 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more sequence identity to motif 19.

Motif 20: L [ED] TMWLETLMALIGEQFD [ED] [AS] [DE] [ED] ICGVVASVR or a motif in increasing order of preference of at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72% , 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89 %, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more sequence identity to motif 20.

Motif 21: QDKL [SA] LWT [KR] [TN] A [AS] NEA [AV] QM [SG] IG [RK] KWKE [IV] ID with in increasing order of preference of at least 50%, 51%, 52 %, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61% 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69 %, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more Sequence identity to motif 21.

Das erfindungsgemäße eIF4isoE Polypeptid umfasst vorzugsweise die folgende konservierte Domäne: IF4E (PFam Zugangsnummer: PF01652).The eIF4isoE polypeptide of the invention preferably comprises the following conserved domain: IF4E (PFam accession number: PF01652).

In einer bevorzugten Ausführungsform der vorliegenden Erfindung wird die Expression von eIF4G und seiner Isoform gesteigert, am stärksten bevorzugt wird eIF4isoG überexprimiert.In a preferred embodiment of the present invention, the expression of eIF4G and its isoform is increased, most preferably eIF4isoG is overexpressed.

In einer weiteren bevorzugten Ausführungsform der vorliegenden Erfindung wird die Expression von eIF4A gesteigert.In a further preferred embodiment of the present invention, the expression of eIF4A is increased.

In einer am stärksten bevorzugten Ausführungsform der vorliegenden Erfindung werden eIF4isoG und/oder eIF4A überexprimiert und die Expression von eIF4isoE wird verringert, wobei vorzugsweise eIF4isoG und eIF4A überexprimiert werden.In a most preferred embodiment of the present invention, eIF4isoG and / or eIF4A are overexpressed and expression of eIF4isoE is reduced, preferably overexpressing eIF4isoG and eIF4A.

Alternativ, hat das Homologon der eIF4F-ähnlichen Proteinkomplex-Untereinheit-Polypeptide in steigender Reihenfolge der Präferenz mindestens 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32% 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% Gesamt Sequenzidentität zu der Aminosäure nach SEQ ID NO: 241, SEQ ID NO: 301 und/oder SEQ ID NO. 561 vorausgesetzt dass das homologe Protein die konservierten Motive wie vorstehend angegeben umfasst. Die Gesamtsequenzidentität wird unter Anwendung eines globalen Alignment-Algorithmus, wie dem Needleman-Wunsch-Algorithmus im Programm GAP (GCG Wisconsin Package, Accelrys), vorzugsweise mit Standardparametern und vorzugsweise mit Sequenzen reifer Proteine (d. h. ohne Berücksichtigung von Sekretionssignalen oder Transitpeptiden), ermittelt. Im Vergleich zu der Gesamtsequenzidentität wird die Sequenzidentität im Allgemeinen höher sein, wenn lediglich konservierte Domänen oder Motive betrachtet werden. Für lokale Alignments ist der Smith-Waterman-Algorithmus besonders geeignet ( Smith TF, Waterman MS (1981) J. Mol. Biol 147(1); 195–7 ).Alternatively, the homologue of eIF4F-like protein complex subunit polypeptides has at least 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32% 33%, 34%, 35 in increasing order of preference %, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68% , 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85 %, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% total sequence identity to the amino acid after SEQ ID NO: 241, SEQ ID NO: 301 and / or SEQ ID NO. 561 provided that the homologous protein comprises the conserved motifs as indicated above. Overall sequence identity is determined using a global alignment algorithm, such as the Needleman-Wunsch algorithm in the GAP program (GCG Wisconsin Package, Accelrys), preferably with standard parameters and preferably with sequences of mature proteins (ie, without regard to secretion signals or transit peptides). In comparison to overall sequence identity, sequence identity will generally be higher when only conserved domains or motifs are considered. For local alignments, the Smith-Waterman algorithm is particularly suitable ( Smith TF, Waterman MS (1981) J. Mol. Biol. 147 (1); 195-7 ).

Die Polypeptid-Sequenzen der eIF4F Untereinheiten bilden vorzugsweise bei der Verwendung bei der Konstruktion eines Stammbaums, wie er in den 12, 13 und 14 gezeigt ist, Cluster mit der Gruppe der eIF4F-ähnlichen Proteinkomplex-Untereinheiten, wie eIF4isoG, eIF4A und eIF4isoE, umfassend die Aminosäuresequenzen nach SEQ ID NO: 241, SEQ ID NO: 301, und/oder SEQ ID NO: 561.The polypeptide sequences of the eIF4F subunits preferably form when used in the construction of a pedigree as described in U.S. Pat 12 . 13 and 14 8, clusters with the group of the eIF4F-like protein complex subunits, such as eIF4isoG, eIF4A and eIF4isoE, comprising the amino acid sequences according to SEQ ID NO: 241, SEQ ID NO: 301, and / or SEQ ID NO: 561.

Am stärksten bevorzugt bilden die erfindungsgemäßen Polypeptid-Sequenzen eher Cluster mit der Gruppe der eIF4F-ähnlichen Proteinkomplex-Untereinheit eIF4isoG nach SEQ ID NO: 241, als mit irgend einer anderen Gruppe.Most preferably, the polypeptide sequences of the invention form clusters with the group of the eIF4F-like protein complex subunit eIF4isoG of SEQ ID NO: 241 rather than any other group.

Wird im folgenden Text bezüglich GR-RBP-Polypeptide auf ein ”Protein, das für die erfindungsgemäßen Verfahren geeignet ist” Bezug genommen, soll darunter ein GR-RBP-Polypeptid, wie hier definiert, verstanden werden. Wird im folgenden Text auf eine ”Nukleinsäure, die für die erfindungsgemäßen Verfahren geeignet ist” Bezug genommen, soll dies eine Nukleinsäure bedeuten, die ein solches GR-RBP-Polypeptid kodieren kann. Die Nukleinsäure, die in eine Pflanze eingeführt werden soll (und daher zur Durchführung der erfindungsgemäßen Verfahren geeignet ist), ist jede Nukleinsäure, die den Typ Protein kodiert, der im Folgenden beschrieben wird, und wird im Folgenden auch als ”GR-RBP-Nukleinsäure” oder ”GR-RBP-Gen” bezeichnet.When reference is made in the following text to GR-RBP polypeptides for a "protein useful in the methods of the invention", it is intended to mean a GR-RBP polypeptide as defined herein. When reference is made in the following text to a "nucleic acid which is suitable for the methods according to the invention", this is intended to mean a nucleic acid which can encode such a GR-RBP polypeptide. The nucleic acid to be introduced into a plant (and therefore suitable for carrying out the methods of the invention) is any nucleic acid encoding the type of protein described below, and will also be referred to hereinafter as "GR-RBP nucleic acid Or "GR-RBP gene".

Ein ”GR-RBP Polypeptid” wie hier definiert betrifft irgend ein RNA bindendes Polypeptid, umfassend ein RNA Erkennungs-Motiv 1 (PFam Zugangsnummer PF00076, RRM_1). Das GR-RBP Polypeptid umfasst vorzugsweise zudem eine oder mehrere der folgenden Signatursequenzen:
Signatursequenz 1 (SEQ ID NO: 828): GGYGG
Signatursequenz 2 (SEQ ID NO: 829): GGYG
Signatursequenz 3 (SEQ ID NO: 830): [CLIV][FY][IV]GG[LIMV]
Signatursequenz 4 (SEQ ID NO: 831): RGF[GA]F[IV][SDHTN][FY] A "GR-RBP polypeptide" as defined herein refers to any RNA-binding polypeptide comprising an RNA recognition motif 1 (PFam accession number PF00076, RRM_1). The GR-RBP polypeptide preferably also comprises one or more of the following signature sequences:
Signature sequence 1 (SEQ ID NO: 828): GGYGG
Signature sequence 2 (SEQ ID NO: 829): GGYG
Signature Sequence 3 (SEQ ID NO: 830): [CLIV] [FY] [IV] GG [LIMV]
Signature Sequence 4 (SEQ ID NO: 831): RGF [GA] F [IV] [SDHTN] [FY]

Das GR-RBP Polypeptid umfasst vorzugsweise eine HMMPanther PTHR10432:SF31 RRM_Gly_reiche Domäne. Gegebenenfalls umfasst das GR-RBP Polypeptid auch eine Glycin-reiche Domäne in der C-terminalen Hälfte des Proteins. Der Begriff ”Glycin-reiche Domäne” wie er in der vorliegenden Erfindung verwendet wird, steht für einen Bereich von mindestens 10, vorzugsweise mindestens 11, vorzugsweise mindestens 12, stärker bevorzugt mindestens 13, am stärksten bevorzugt mindestens 15 Aminosäuren in der Sequenz des GR-RBP Polypeptid, das mindestens 30% Glycinreste aufweist.The GR-RBP polypeptide preferably comprises an HMMPanther PTHR10432: SF31 RRM_Gly_reich domain. Optionally, the GR-RBP polypeptide also comprises a glycine-rich domain in the C-terminal half of the protein. The term "glycine-rich domain" as used in the present invention means a range of at least 10, preferably at least 11, preferably at least 12, more preferably at least 13, most preferably at least 15 amino acids in the sequence of the GR- RBP polypeptide having at least 30% glycine residues.

Das GR-RBP Polypeptid umfasst zudem weiter vorzugsweise mindestens eines oder mehrere der folgenden Motive:

Das GR-RBP Polypeptid umfasst stärker bevorzugt in steigender Reihenfolge der Präferenz mindestens 2, oder mindestens 3 der vorstehenden Motive.The GR-RBP polypeptide more preferably comprises in increasing order of preference at least 2, or at least 3 of the above motifs.

Alternativ hat das Homologon eines GR-RBP Proteins in steigender Reihenfolge der Präferenz mindestens 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% Gesamt-Sequenzidentität zu der Aminosäure nach SEQ ID NO: 827, vorausgesetzt, dass das homologe Protein 1, 2 oder 3 der konservierten Motive wie vorstehend hervorgehoben. Die Gesamtsequenzidentität wird unter Anwendung eines globalen Alignment-Algorithmus, wie dem Needleman-Wunsch-Algorithmus im Programm GAP (GCG Wisconsin Package, Accelrys), vorzugsweise mit Standardparametern ermittelt. Im Vergleich zu der Gesamtsequenzidentität wird die Sequenzidentität im Allgemeinen höher sein, wenn lediglich konservierte Domänen oder Motive betrachtet werden. Die Motive in einem GR-RBP Polypeptid haben in steigender Reihenfolge der Präferenz mindestens 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% Sequenzidentität zu den Motiven nach SEQ ID NO: 832 bis SEQ ID NO: 837 (Motive 22 bis 27).Alternatively, the homologue of a GR-RBP protein has in increasing order of preference at least 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36% , 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53 %, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86% , 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% total sequence identity to the amino acid of SEQ ID NO : 827, provided that the homologous protein 1, 2 or 3 of the conserved motifs were highlighted as above. Overall sequence identity is determined using a global alignment algorithm, such as the Needleman-Wunsch algorithm in the GAP program (GCG Wisconsin Package, Accelrys), preferably with default parameters. In comparison to overall sequence identity, sequence identity will generally be higher when only conserved domains or motifs are considered. The motifs in a GR-RBP polypeptide have in increasing order of preference at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81% 82% 83% 84% 85% 86% 87% 88% 89% 90% 91% 92% 93% 94% 95% 96% 97% 98 %, or 99% sequence identity to the motifs according to SEQ ID NO: 832 to SEQ ID NO: 837 (motifs 22 to 27).

Die Polypeptid-Sequenz bildet bei Verwendung bei der Konstruktion eines Stammbaums, wie er in 18 gezeigt ist, vorzugsweise eher mit der A oder B Gruppe als mit irgend einer anderen Gruppe Cluster, stärker bevorzugt mit der A Gruppe der GR-RBP Polypeptide, die die Aminosäuresequenz nach SEQ ID NO: 827 umfassen.The polypeptide sequence, when used in the construction of a pedigree, as found in U.S. Pat 18 preferably with the A or B group rather than with any other group of clusters, more preferably with the A group of GR-RBP polypeptides comprising the amino acid sequence of SEQ ID NO: 827.

Die Begriffe ”Domäne”, ”Signatur” und ”Motiv” sind im Abschnitt ”Definitionen” hier definiert. Für die Identifikation von Domänen gibt es Spezialdatenbanken, zum Beispiel SMART ( Schultz et al. (1998), Proc. Natl. Acad. Sci. USA 95, 5857–5864 ; Letunic et al., (2002), Nucleic Acids Res. 30, 242–244 , InterPro ( Mulder et al., (2003), Nucl. Acids Res. 31, 315–318 , Prosite ( Bucher und Bairoch (1994), A generalized profile syntax for biomolecular sequences Motivs und its function in automatic sequence interpretation. (In) ISMB-94 ; Proceedings 2nd International Conference an Intelligent Systems for Molecular Biology. Altman R., Brutlag D., Karp P., Lathrop R., Searls D., Hrsg., S. 53–61, AAAIPress, Menlo Park ; Hulo et al., Nucl. Acids Res. 32: D134–D137, (2004) , oder Pfam ( Bateman et al., Nucleic Acids Research 30(1): 276–280 (2002) . Ein Satz Werkzeuge für die In-silico-Analyse von Proteinsequenzen findet sich auf dem ExPASY-Proteomics-Server (Swiss Institute of Bioinformatics ( Gasteiger et al., ExPASy: the proteomics server for in-depth protein knowledge and analysis, Nucleic Acids Res. 31: 3784–3788 (2003) ). Domänen oder Motive können auch unter Verwendung von Routinetechniken, wie Sequenz-Alignment, identifiziert werden.The terms "domain", "signature" and "motif" are defined in the "Definitions" section here. For the identification of domains there are special databases, for example SMART ( Schultz et al. (1998), Proc. Natl. Acad. Sci. USA 95, 5857-5864 ; Letunic et al., (2002) Nucleic Acids Res. 30, 242-244 , InterPro ( Mulder et al., (2003), Nucl. Acids Res. 31, 315-318 , Prosite ( Bucher and Bairoch (1994), A generalized profile syntax for biomolecular sequences Motivs and its function in automatic sequence interpretation. (In) ISMB-94 ; Proceedings 2nd International Conference on Intelligent Systems for Molecular Biology. Altman R., Brutlag D., Karp P., Lathrop R., Searls D., eds, pp. 53-61, AAAIPress, Menlo Park ; Hulo et al., Nucl. Acids Res. 32: D134-D137, (2004) , or Pfam ( Bateman et al., Nucleic Acids Research 30 (1): 276-280 (2002) , A set of tools for in silico analysis of protein sequences can be found on the ExPASY Proteomics server (Swiss Institute of Bioinformatics ( Gasteiger et al., ExPASy: the proteomics server for in-depth protein knowledge and analysis, Nucleic Acids Res. 31: 3784-3788 (2003) ). Domains or motifs can also be identified using routine techniques such as sequence alignment.

Verfahren für das Alignment von Sequenzen für Vergleichszwecke sind in der Fachwelt gut bekannt, dazu zählen GAP, BESTFIT, BLAST, FASTA und TFASTA. Bei GAP wird der Algorithmus von Needleman und Wunsch ((1970), J. Mol. Biol. 48: 443–453) verwendet, um das globale Alignment (d. h. das Alignment, das sich über die vollständigen Sequenzen erstreckt) von zwei Sequenzen zu finden, das die Anzahl der ”matches” maximiert und die Anzahl der ”gaps” minimiert. Beim BLAST-Algorithmus ( Altschul et al., (1990), J. Mol. Biol. 215: 403–10 ) wird die Sequenzidentität in Prozent berechnet, und es wird eine statistische Analyse der Ähnlichkeit zwischen den beiden Sequenzen durchgeführt. Die Software für die Durchführung einer BLAST-Analyse ist der Öffentlichkeit über das National Centre for Biotechnology Information (NCBI) zugänglich. Homologa können leicht unter Verwendung von zum Beispiel dem multiplen Sequenz-Alignment-Algorithmus ClustalW (Version 1.83) identifiziert werden, und zwar mit den Default-Parametern für paarweises Alignment und einer Scoring-Methode in Prozent. Die Gesamtprozentsätze der Ähnlichkeit und der Identität können auch unter Verwendung von einer der in dem MatGAT-Software-Paket verfügbaren Methoden bestimmt werden ( Campanella et al., BMC Bioinformatics. 2003, Juli, 10; 4: 29. MatGAT: an application that generates similarity/identity matrices using protein or DNA sequences ). Für eine Optimierung des Alignments zwischen konservierten Motiven können, wie es dem Fachmann ersichtlich wird, kleine manuelle Veränderungen vorgenommen werden. Darüber hinaus können statt Volllängensequenzen für die Identifikation von Homologa auch spezifische Domänen verwendet werden. Die Sequenzidentitätswerte können mit den oben erwähnten Programmen unter Einstellung der Default-Parameter über die gesamte Nukleinsäure- oder Aminosäuresequenz oder über ausgewählte Domänen oder konservierte Motiv(e) bestimmt werden. Für lokale Alignments ist der Smith-Waterman-Algorithmus besonders geeignet ( Smith TF, Waterman MS (1981) J. Mol. Biol 147(1); 195–7 ).Methods for aligning sequences for comparison purposes are well known in the art, including GAP, BESTFIT, BLAST, FASTA, and TFASTA. For GAP, the algorithm of Needleman and Wunsch ((1970), J. Mol. Biol. 48: 443-453) is used to find the global alignment (ie, the alignment that spans the complete sequences) of two sequences that maximizes the number of matches and minimizes the number of gaps. In the BLAST algorithm ( Altschul et al., (1990), J. Mol. Biol. 215: 403-10 ) the sequence identity is calculated in percent and a statistical analysis of the similarity between the two sequences is made. The software for performing a BLAST analysis is available to the public via the National Center for Biotechnology Information (NCBI). Homologs can be easily identified using, for example, the multiple sequence alignment algorithm ClustalW (version 1.83), with the default parameters for pairwise alignment and a scoring method in percent. The total percentages of similarity and identity may also be determined using one of the methods available in the MatGAT software package ( Campanella et al., BMC Bioinformatics. 2003, July, 10; 4: 29. MatGAT: an application that generates similarity / identity matrices using protein or DNA sequences ). As will be apparent to those skilled in the art, small manual changes can be made to optimize alignment between preserved subjects. In addition, specific domains can be used instead of full-length sequences for the identification of homologs. The sequence identity values can be determined with the above-mentioned programs setting the default parameters throughout the nucleic acid or amino acid sequence or over selected domains or conserved motif (s). For local alignments, the Smith-Waterman algorithm is particularly suitable ( Smith TF, Waterman MS (1981) J. Mol. Biol. 147 (1); 195-7 ).

Zudem ergeben C3H-ähnliche Polypeptide bei Expression in Reis gemäß den erfindungsgemäßen Verfahren, wie sie in dem Abschnitt Beispiele aufgeführt sind, Pflanzen mit verbesserten Ertragsmerkmalen, insbesondere erhöhter oberirdischer Fläche und verbessertem Samenertrag im Vergleich zu Kontrollpflanzen.In addition, C3H-like polypeptides, when expressed in rice according to the methods of the present invention, as listed in the Examples section, yield plants having improved yield-related traits, in particular increased aboveground area, and improved seed yield relative to control plants.

Zudem können C3H-ähnliche Polypeptide eine bevorzugte subzellulare Lokalisierung anzeigen, gewöhnlich eine oder mehrere von Kern, Cytoplasma, Chloroplast oder Mitochondrium. Die Aufgabe der Vorhersage der subzellulären Proteinlokalisation ist wichtig und gut untersucht. Experimentelle Verfahren zur Proteinlokalisierung reichen von der Immunlokalisierung bis zum Tagging von Proteinen mit grün fluoreszierendem Protein (GFP) oder beta-Glucuronidase (GUS). Solche Verfahren sind zwar präzise, aber verglichen mit Computer-Verfahren arbeitsintensiv. Neuerdings wurde ein großer Fortschritt hinsichtlich der mittels Computer errechneten Vorhersage der Proteinlokalisation aus Sequenzdaten gemacht. An der ExPASy sind dem Fachmann bestens bekannte Algorithmen zugänglich, wie u. a beispielsweise die Proteomics-Werkzeuge PSort, TargetP, ChloroP, LocTree, Predotar, LipoP, MITOPROT, PATS, PTS1, Signale, TMHMM und andere, die vom Schweizer Institut für Bioinformatik gehosted werden.In addition, C3H-like polypeptides may indicate preferential subcellular localization, usually one or more of nucleus, cytoplasm, chloroplast or mitochondrion. The task of predicting subcellular protein localization is important and well studied. Experimental methods for protein localization range from immunolocalization to tagging of proteins with green fluorescent protein (GFP) or beta-glucuronidase (GUS). While such methods are precise, they are labor intensive compared to computer methods. Recently, great progress has been made in computer-calculated prediction of protein localization from sequence data. At ExPASy, algorithms which are well known to the person skilled in the art are available, such as For example, the proteomics tools PSort, TargetP, ChloroP, LocTree, Predotar, LipoP, MITOPROT, PATS, PTS1, Signals, TMHMM, and others hosted by the Swiss Institute of Bioinformatics.

Darüber hinaus haben SPT-ähnliche Polypeptide (zumindest in ihrer nativen Form) gewöhnlich eine DNA-Bindungsaktivität. Werkzeuge und Techniken zum Messern der DNA-Bindungsaktivität sind im Stand der Technik bestens bekannt.In addition, SPT-like polypeptides (at least in their native form) usually have DNA-binding activity. Tools and techniques for measuring DNA binding activity are well known in the art.

Zudem ergeben SPT-ähnliche Polypeptide bei Expression in Reis gemäß den erfindungsgemäßen Verfahren, wie sie in dem Abschnitt Beispiele aufgeführt sind, Pflanzen mit verbesserten Ertragsmerkmalen, insbesondere erhöhtem Tausendkorngewicht (TKG) im Vergleich zu Kontrollpflanzen.In addition, SPT-like polypeptides when expressed in rice according to the methods of the present invention, as listed in the Examples section, yield plants having improved yield-related traits, particularly increased milligrams (TKG), relative to control plants.

SPT-ähnliche Polypeptid sind gewöhnlich im Kern lokalisiert aufgrund des Vorhandenseins der Kernlokalisierungssignale (siehe Alignment von 4) in den SPT-ähnlichen Polypeptiden. Experimentelle Verfahren zur Proteinlokalisierung reichen von der Immunlokalisierung bis zum Tagging von Proteinen mit grün fluoreszierendem Protein (GFP) oder beta-Glucuronidase (GUS). Solche Verfahren sind zwar präzise aber verglichen mit Computer-Verfahren arbeitsintensiv. Neuerdings wurde ein großer Fortschritt hinsichtlich der mittels Computer errechneten Vorhersage der Proteinlokalisation aus Sequenzdaten gemacht. An der ExPASy sind dem Fachmann bestens bekannte Algorithmen zugänglich, wie u. a beispielsweise die Proteomics-Werkzeuge PSort, TargetP, ChloroP, LocTree, Predotar, LipoP, MITOPROT, PATS, PTS1, Signale, TMHMM und andere, die vom Schweizer Institut für Bioinformatik gehosted werden.SPT-like polypeptides are usually located in the nucleus due to the presence of nuclear localization signals (see alignment of 4 ) in the SPT-like polypeptides. Experimental methods for protein localization range from immunolocalization to tagging of proteins with green fluorescent protein (GFP) or beta-glucuronidase (GUS). While such methods are precise, they are labor intensive compared to computer methods. Recently, great progress has been made in computer-calculated prediction of protein localization from sequence data. At ExPASy, algorithms which are well known to the person skilled in the art are available, such as For example, the proteomics tools PSort, TargetP, ChloroP, LocTree, Predotar, LipoP, MITOPROT, PATS, PTS1, Signals, TMHMM and others hosted by the Swiss Institute of Bioinformatics.

Zudem können IDI2 Polypeptide als alpha Untereinheiten von eIF2B (zumindest in ihrer nativen Form) die Phosphorylierung von eIF2 vermitteln. Werkzeuge und Techniken zum Messen der Aktivität der eIF2Balpha Untereinheit sind im Stand der Technik bestens bekannt, siehe beispielsweise Fabian et al (J. Biol. Chem. 272, 12359–12369, 1997 und Prot. Expr. Purif. 13, 16–22, 1998) . Weitere Einzelheiten finden sich in Beispiel 6.In addition, IDI2 polypeptides can mediate, as alpha subunits of eIF2B (at least in their native form) phosphorylation of eIF2. Tools and techniques for measuring the activity of the eIF2Balpha subunit are well known in the art, see for example Fabian et al (J. Biol. Chem. 272, 12359-12369, 1997 and Prot. Expr. Purif. 13, 16-22, 1998) , Further details can be found in Example 6.

Zudem ergeben IDI2 Polypeptide, bei Expression in Reis nach den erfindungsgemäßen Verfahren, wie sie in den Beispielen 7 und 8 aufgeführt sind, Pflanzen, die bei Anzucht oder Nährstoffmangel verbesserte Ertragsmerkmale, insbesondere erhöhtes Gesamtgewicht der Samen, erhöhte Anzahl gefüllter Samen und/oder erhöhten Harvest Index haben.In addition, IDI2 polypeptides, when expressed in rice by the methods of the present invention as set forth in Examples 7 and 8, give plants which have improved yield-related traits, especially increased total weight of seeds, increased numbers of filled seeds, and / or increased harvest in culture or nutrient deficiency Index.

Zudem haben eIF4F-ähnliche Proteinkomplex-Untereinheiten (zumindest in ihrer nativen Form) gewöhnlich Translationsaktivität. Werkzeuge und Techniken zum Messen dieser Aktivität sind im Stand der Technik bestens bekannt.In addition, eIF4F-like protein complex subunits (at least in their native form) usually have translational activity. Tools and techniques for measuring this activity are well known in the art.

Zudem ergeben eIF4F-ähnliche Proteinkomplex-Untereinheiten bei Expression in Reis nach den erfindungsgemäßen Verfahren, wie sie in den Beispielen 8 und 9 aufgeführt sind, Pflanzen mit verbesserten Ertragsmerkmalen, insbesondere maximale Höhe pro Pflanze, Anzahl der Blüten (Einzelblüten) pro Rispe und Anzahl der Pflanzen pro m² (Harvest Index).In addition, eIF4F-like protein complex subunits, when expressed in rice by the methods of the present invention as set forth in Examples 8 and 9, yield plants with improved yield-related traits, in particular maximum plant height, number of flowers per panicle and number of flowers Plants per m ² (harvest index).

Zudem können eIF4F-ähnliche Proteinkomplex-Untereinheiten eine bevorzugte subzelluläre Lokalisierung anzeigen, gewöhnlich einen oder mehrere von Kern, Cytoplasma, Chloroplast oder Mitochondrium. Die Aufgabe der Vorhersage der subzellulären Proteinlokalisation ist wichtig und gut untersucht. Das Wissen über die Lokalisierung eines Proteins unterstützt die Aufklärung seiner Funktion. Experimentelle Verfahren zur Proteinlokalisierung reichen von der Immunlokalisierung bis zum Tagging von Proteinen mit grün fluoreszierendem Protein (GFP) oder beta-Glucuronidase (GUS). Solche Verfahren sind zwar präzise aber verglichen mit Computer-Verfahren arbeitsintensiv. Neuerdings wurde ein großer Fortschritt hinsichtlich der mittels Computer errechneten Vorhersage der Proteinlokalisation aus Sequenzdaten gemacht. An der ExPASy sind dem Fachmann bestens bekannte Algorithmen zugänglich, wie u. a beispielsweise die Proteomics-Werkzeuge PSort, TargetP, ChloroP, LocTree, Predotar, LipoP, MITOPROT, PATS, PTS1, SignalP, TMHMMM und andere, die vom Schweizer Institut für Bioinformatik gehosted werden.In addition, eIF4F-like protein complex subunits may indicate preferential subcellular localization, usually one or more of nucleus, cytoplasm, chloroplast or mitochondrion. The task of predicting subcellular protein localization is important and well studied. The knowledge about the localization of a protein supports the clarification of its function. Experimental methods for protein localization range from immunolocalization to tagging of proteins with green fluorescent protein (GFP) or beta-glucuronidase (GUS). While such methods are precise, they are labor intensive compared to computer methods. Recently, great progress has been made in computer-calculated prediction of protein localization from sequence data. At ExPASy, algorithms which are well known to the person skilled in the art are available, such as For example, the proteomics tools PSort, TargetP, ChloroP, LocTree, Predotar, LipoP, MITOPROT, PATS, PTS1, SignalP, TMHMMM, and others hosted by the Swiss Institute of Bioinformatics.

Zudem haben GR-RBP Polypeptide (zumindest in ihrer nativen Form) gewöhnlich RNA-Bindungsaktivität. Werkzeuge und Techniken zum Messen der RNA-Bindungsaktivität sind im Stand der Technik bestens bekannt siehe beispielsweise Kwak et al. (2005) or Hirose et al. (Nucl. Ac. Res. 21, 3981–3987, 1993) . Weitere Einzhelheiten finden sich in Beispiel 6.In addition, GR-RBP polypeptides (at least in their native form) usually have RNA binding activity. Tools and techniques for measuring RNA binding activity are well known in the art, see for example Kwak et al. (2005) or Hirose et al. (Nucl. Ac. Res. 21, 3981-3987, 1993) , Other individualities can be found in Example 6.

Zudem ergeben GR-RBP Pipetten-Probenentnahmesystem bei Expression in Reis nach den erfindungsgemäßen Verfahren, wie sie in den Beispielen 7 und 8 aufgeführt sind, Pflanzen mit verbesserten Ertragsmerkmalen, insbesondere verbesserter Füllrate, wenn die Pflanzen und den Bedingungen von Trockenheitsstress gezüchtet werden.In addition, GR-RBP pipette sampling system when expressed in rice by the methods of the present invention, as set forth in Examples 7 and 8, yield plants having improved yield-related traits, in particular improved fill rate, when the plants and the conditions of drought stress are grown.

In Bezug auf C3H-ähnliche Polypeptide wird die vorliegende Erfindung veranschaulicht durch Transformieren von Pflanzen mit der Nukleinsäuresequenz nach SEQ ID NO: 1, die die Polypeptidsequenz nach SEQ ID NO: 2 kodiert. Die erfindungsgemäße Leistungsfähigkeit ist jedoch nicht auf diese Sequenzen eingeschränkt; die erfindungsgemäßen Verfahren können vorteilhafterweise mit einer C3H-ähnlich-kodierenden Nukleinsäure oder einem C3H-ähnlichen Polypeptid, wie hier definiert durchgeführt werden.With respect to C3H-like polypeptides, the present invention is illustrated by transforming plants having the nucleic acid sequence of SEQ ID NO: 1 which encodes the polypeptide sequence of SEQ ID NO: 2. However, the performance of the invention is not limited to these sequences; the methods of the invention may be advantageously carried out with a C3H-like-encoding nucleic acid or a C3H-like polypeptide as defined herein.

Beispiele für Nukleinsäuren, die C3H-ähnliche Polypeptide kodieren, sind in der Tabelle A1 des Beispielteils hierin beschrieben. Solche Nukleinsäuresequenzen sind zur Durchführung der erfindungsgemäßen Verfahren geeignet. Die in Tabelle A1 des Beispielteils angegebenen Aminosäuresequenzen sind Beispiel-Sequenzen für Orthologa und Paraloga des durch SEQ ID NO: 2 veranschaulichten C3H-ähnlichen Polypeptids, wobei die Begriffe ”Orthologa” und ”Paraloga” die hier definierte Bedeutung haben. Weitere Orthologa und Paraloga können leicht durch Durchführen einer so genannten reziproken Blast-Suche identifiziert werden. Dies beinhaltet typischerweise einen ersten BLAST, bei der mit einer Abfragesequenz (zum Beispiel eine der in Tabelle A1 des Beispielteils aufgeführten Sequenzen) ein ”Blasting” gegen eine beliebige Sequenzdatenbank, wie die öffentlich zugängliche NCBI-Datenbank, durchgeführt wird. BLASTN oder TBLASTX (unter Verwendung von Standard-Default-Werten) werden im Allgemeinen dann verwendet, wenn man von einer Nukleotidsequenz ausgeht, und BLASTP oder TBLASTN (unter Verwendung von Standard-Default-Werten), wenn man von einer Proteinsequenz ausgeht. Die BLAST-Ergebnisse können gegebenenfalls gefiltert werden. Mit den Volllängen-Sequenzen der gefilterten oder ungefilterten Ergebnisse wird anschließend ein Rück-BLASTing (zweiter BLAST) gegen Sequenzen des Organismus, von dem die Abfragesequenz stammt, durchgeführt (ist die Abfragesequenz SEQ ID NO: 1 oder SEQ ID NO: 2, dann erfolgt das zweite BLASTing daher gegen Medicago-Sequenzen). Die Ergebnisse des ersten und des zweiten BLASTing werden dann verglichen. Ein Paralogon wird dann identifiziert, wenn ein hochrangiger Hit von dem ersten BLASTing von derselben Art ist, von der die Abfragesequenz stammt, in diesem Fall führt ein Rück-BLASTing idealerweise zu der Abfragesequenz unter den höchstrangigen Hits; ein Orthologon wird dann identifiziert, wenn ein hochrangiger Hit in dem ersten BLASTing nicht von der gleichen Art wie derjenigen, von der die Abfragesequenz stammt, ist, und führt vorzugsweise beim Rück-BLASTing dazu, dass die Abfragesequenz unter den höchstrangigen Hits ist.Examples of nucleic acids encoding C3H-like polypeptides are described in Table A1 of the Examples section herein. Such nucleic acid sequences are suitable for carrying out the methods according to the invention. The amino acid sequences given in Table A1 of the Examples section are example sequences for orthologues and paralogues of the C3H-like polypeptide illustrated by SEQ ID NO: 2, where the terms "orthologue" and "paralogues" have the meaning as defined herein. Further orthologues and paralogs can be easily identified by performing a so-called reciprocal blast search. This typically involves a first BLAST in which a query sequence (for example, one of the sequences listed in Table A1 of the Examples section) blasts against any sequence database, such as the publicly accessible NCBI database. BLASTN or TBLASTX (using default default values) are generally used when referring to a Nucleotide sequence, and BLASTP or TBLASTN (using standard default values), assuming a protein sequence. If necessary, the BLAST results can be filtered. The full-length sequences of the filtered or unfiltered results are then re-BLASTed (second BLAST) against sequences of the organism from which the interrogation sequence originates (if the interrogation sequence is SEQ ID NO: 1 or SEQ ID NO: 2, then the second BLASTing therefore against Medicago sequences). The results of the first and second BLASTing are then compared. A paralogue is identified when a high ranking hit from the first BLASTing is of the same type as the query sequence, in which case a return BLASTing ideally results in the query sequence among the highest ranking hits; an orthologon is identified when a high-ranking hit in the first BLASTing is not of the same type as that from which the query sequence originated, and preferably results in the BLASTing retrieving the query sequence among the highest ranking hits.

In Bezug auf SPT-ähnliche Polypeptide wird die vorliegende Erfindung veranschaulicht durch Transformieren von Pflanzen mit der Nukleinsäuresequenz nach SEQ ID NO: 96, die die Polypeptidsequenz nach SEQ ID NO: 97 kodiert. Die erfindungsgemäße Leistungsfähigkeit ist jedoch nicht auf diese Sequenzen eingeschränkt; die erfindungsgemäßen Verfahren können vorteilhafterweise mit einer SPT-ähnlich-kodierenden Nukleinsäure oder einem SPT-ähnlichen Polypeptid, wie hier definiert durchgeführt werden.With respect to SPT-like polypeptides, the present invention is exemplified by transforming plants having the nucleic acid sequence of SEQ ID NO: 96 which encodes the polypeptide sequence of SEQ ID NO: 97. However, the performance of the invention is not limited to these sequences; the methods of the invention may be advantageously carried out with an SPT-like-encoding nucleic acid or an SPT-like polypeptide as defined herein.

Beispiele für Nukleinsäuren, die SPT-ähnliche Polypeptide kodieren, sind in der Tabelle A2 des Beispielteils hierin beschrieben. Solche Nukleinsäuresequenzen sind zur Durchführung der erfindungsgemäßen Verfahren geeignet. Die in Tabelle A2 des Beispielteils angegebenen Aminosäuresequenzen sind Beispiel-Sequenzen für Orthologa und Paraloga des durch SEQ ID NO: 97 veranschaulichten SPT-ähnlichen Polypeptids, wobei die Begriffe ”Orthologa” und ”Paraloga” die hier definierte Bedeutung haben. Weitere Orthologa und Paraloga können leicht durch Durchführen einer so genannten reziproken Blast-Suche identifiziert werden. Dies beinhaltet typischerweise einen ersten BLAST, bei der mit einer Abfragesequenz (zum Beispiel eine der in Tabelle A2 des Beispielteils aufgeführten Sequenzen) ein ”Blasting” gegen eine beliebige Sequenzdatenbank, wie die öffentlich zugängliche NCBI-Datenbank, durchgeführt wird. BLASTN oder TBLASTX (unter Verwendung von Standard-Default-Werten) werden im Allgemeinen dann verwendet, wenn man von einer Nukleotidsequenz ausgeht, und BLASTP oder TBLASTN (unter Verwendung von Standard-Default-Werten), wenn man von einer Proteinsequenz ausgeht. Die BLAST-Ergebnisse können gegebenenfalls gefiltert werden. Mit den Volllängen-Sequenzen der gefilterten oder ungefilterten Ergebnisse wird anschließend ein Rück-BLASTing (zweiter BLAST) gegen Sequenzen des Organismus, von dem die Abfragesequenz stammt, durchgeführt (ist die Abfragesequenz SEQ ID NO: 96 oder SEQ ID NO: 97, dann erfolgt das zweite BLASTing daher gegen Pappel-Sequenzen). Die Ergebnisse des ersten und des zweiten BLASTing werden dann verglichen. Ein Paralogon wird dann identifiziert, wenn ein hochrangiger Hit von dem ersten BLASTing von derselben Art ist, von der die Abfragesequenz stammt, in diesem Fall führt ein Rück-BLASTing idealerweise zu der Abfragesequenz unter den höchstrangigen Hits; ein Orthologon wird dann identifiziert, wenn ein hochrangiger Hit in dem ersten BLASTing nicht von der gleichen Art wie derjenigen, von der die Abfragesequenz stammt, ist, und führt vorzugsweise beim Rück-BLASTing dazu, dass die Abfragesequenz unter den höchstrangigen Hits ist.Examples of nucleic acids encoding SPT-like polypeptides are described in Table A2 of the Examples section herein. Such nucleic acid sequences are suitable for carrying out the methods according to the invention. The amino acid sequences given in Table A2 of the Examples section are example sequences for orthologues and paralogues of the SPT-like polypeptide illustrated by SEQ ID NO: 97, wherein the terms "orthologue" and "paralogues" have the meaning as defined herein. Further orthologues and paralogs can be easily identified by performing a so-called reciprocal blast search. This typically involves a first BLAST in which a query sequence (for example, one of the sequences listed in Table A2 of the Examples section) blasts against any sequence database, such as the publicly accessible NCBI database. BLASTN or TBLASTX (using default default values) are generally used when assuming a nucleotide sequence, and BLASTP or TBLASTN (using default default values), assuming a protein sequence. If necessary, the BLAST results can be filtered. The full-length sequences of the filtered or unfiltered results are then re-BLASTed (second BLAST) against sequences of the organism from which the query sequence is derived (if the query sequence is SEQ ID NO: 96 or SEQ ID NO: 97, then the second BLASTing therefore against poplar sequences). The results of the first and second BLASTing are then compared. A paralogue is identified when a high ranking hit from the first BLASTing is of the same type as the query sequence, in which case a return BLASTing ideally results in the query sequence among the highest ranking hits; an orthologon is identified when a high-ranking hit in the first BLASTing is not of the same type as that from which the query sequence originated, and preferably results in the BLASTing retrieving the query sequence among the highest ranking hits.

In Bezug auf IDI2-Polypeptide wird die vorliegende Erfindung veranschaulicht durch Transformieren von Pflanzen mit der Nukleinsäuresequenz nach SEQ ID NO: 139, die die Polypeptidsequenz nach SEQ ID NO: 140 kodiert. Die erfindungsgemäße Leistungsfähigkeit ist jedoch nicht auf diese Sequenzen eingeschränkt; die erfindungsgemäßen Verfahren können vorteilhafterweise mit einer IDI2-kodierenden Nukleinsäure oder einem IDI2-Polypeptid, wie hier definiert durchgeführt werden.With respect to IDI2 polypeptides, the present invention is exemplified by transforming plants having the nucleic acid sequence of SEQ ID NO: 139 which encodes the polypeptide sequence of SEQ ID NO: 140. However, the performance of the invention is not limited to these sequences; the methods of the invention may advantageously be carried out with an IDI2-encoding nucleic acid or an IDI2 polypeptide as defined herein.

Beispiele für Nukleinsäuren, die IDI2-Polypeptide kodieren, sind in der Tabelle A3 des Beispielteils hierin beschrieben. Solche Nukleinsäuresequenzen sind zur Durchführung der erfindungsgemäßen Verfahren geeignet. Die in Tabelle A3 des Beispielteils angegebenen Aminosäuresequenzen sind Beispiel-Sequenzen für Orthologa und Paraloga des durch SEQ ID NO: 2 veranschaulichten IDI2-Polypeptids, wobei die Begriffe ”Orthologa” und ”Paraloga” die hier definierte Bedeutung haben. Weitere Orthologa und Paraloga können leicht durch Durchführen einer so genannten reziproken Blast-Suche identifiziert werden. Dies beinhaltet typischerweise einen ersten BLAST, bei der mit einer Abfragesequenz (zum Beispiel eine der in Tabelle A3 des Beispielteils aufgeführten Sequenzen) ein ”Blasting” gegen eine beliebige Sequenzdatenbank, wie die öffentlich zugängliche NCBI-Datenbank, durchgeführt wird. BLASTN oder TBLASTX (unter Verwendung von Standard-Default-Werten) werden im Allgemeinen dann verwendet, wenn man von einer Nukleotidsequenz ausgeht, und BLASTP oder TBLASTN (unter Verwendung von Standard-Default-Werten), wenn man von einer Proteinsequenz ausgeht. Die BLAST-Ergebnisse können gegebenenfalls gefiltert werden. Mit den Volllängen-Sequenzen der gefilterten oder ungefilterten Ergebnisse wird anschließend ein Rück-BLASTing (zweiter BLAST) gegen Sequenzen des Organismus, von dem die Abfragesequenz stammt, durchgeführt (ist die Abfragesequenz SEQ ID NO: 139 oder SEQ ID NO: 140, dann erfolgt das zweite BLASTing daher gegen Saccharum officinarum-Sequenzen). Die Ergebnisse des ersten und des zweiten BLASTing werden dann verglichen. Ein Paralogon wird dann identifiziert, wenn ein hochrangiger Hit von dem ersten BLASTing von derselben Art ist, von der die Abfragesequenz stammt, in diesem Fall führt ein Rück-BLASTing idealerweise zu der Abfragesequenz unter den höchstrangigen Hits; ein Orthologon wird dann identifiziert, wenn ein hochrangiger Hit in dem ersten BLASTing nicht von der gleichen Art wie derjenigen, von der die Abfragesequenz stammt, ist, und führt vorzugsweise beim Rück-BLASTing dazu, dass die Abfragesequenz unter den höchstrangigen Hits ist.Examples of nucleic acids encoding IDI2 polypeptides are described in Table A3 of the Examples section herein. Such nucleic acid sequences are suitable for carrying out the methods according to the invention. The amino acid sequences given in Table A3 of the Examples section are example sequences for orthologues and paralogues of the IDI2 polypeptide illustrated by SEQ ID NO: 2, the terms "orthologue" and "paralogues" having the meaning as defined herein. Further orthologues and paralogs can be easily identified by performing a so-called reciprocal blast search. This typically involves a first BLAST in which a query sequence (for example, one of the sequences listed in Table A3 of the Examples section) blasts against any sequence database, such as the publicly accessible NCBI database. BLASTN or TBLASTX (using default default values) are generally used when assuming a nucleotide sequence, and BLASTP or TBLASTN (using default default values), assuming a protein sequence. If necessary, the BLAST results can be filtered. The full-length sequences of the filtered or unfiltered results are then re-BLASTed (second BLAST) against sequences of the organism from which the query sequence is derived (is the Query sequence SEQ ID NO: 139 or SEQ ID NO: 140, then the second BLASTing therefore takes place against Saccharum officinarum sequences). The results of the first and second BLASTing are then compared. A paralogue is identified when a high ranking hit from the first BLASTing is of the same type as the query sequence, in which case a return BLASTing ideally results in the query sequence among the highest ranking hits; an orthologon is identified when a high-ranking hit in the first BLASTing is not of the same type as that from which the query sequence originated, and preferably results in the BLASTing retrieving the query sequence among the highest ranking hits.

In Bezug auf eIF4F-ähnliche Proteinkomplex-Untereinheiten wird die vorliegende Erfindung veranschaulicht durch Transformieren von Pflanzen mit mindestens einer Nukleinsäuresequenz mit den folgenden Sequenzen nach SEQ ID NO: 240, die die Polypeptidsequenz nach SEQ ID NO: 241 kodiert, SEQ ID NO: 300, die die Polypeptid-Sequenz nach SEQ ID NO: 301 kodiert, und SEQ ID NO: 560, die die Polypeptid-Sequenz nach SEQ ID NO: 561 kodiert. Die erfindungsgemäße Leistungsfähigkeit ist jedoch nicht auf diese Sequenzen eingeschränkt; die erfindungsgemäßen Verfahren können vorteilhafterweise mit mindestens einer eIF4F-ähnlichen Proteinkomplex-Untereinheiten-kodierenden Nukleinsäure oder mindestens einem eIF4F-ähnliche Proteinkomplex-Untereinheiten, wie hier definiert durchgeführt werden.With respect to eIF4F-like protein complex subunits, the present invention is exemplified by transforming plants having at least one nucleic acid sequence having the following sequences of SEQ ID NO: 240 encoding the polypeptide sequence of SEQ ID NO: 241, SEQ ID NO: 300, which encodes the polypeptide sequence of SEQ ID NO: 301, and SEQ ID NO: 560, which encodes the polypeptide sequence of SEQ ID NO: 561. However, the performance of the invention is not limited to these sequences; the methods of the invention may be advantageously carried out with at least one eIF4F-like protein complex subunit-encoding nucleic acid or at least one eIF4F-like protein complex subunit, as defined herein.

Beispiele für Nukleinsäuren, die eIF4F-ähnliche Proteinkomplex-Untereinheiten kodieren, sind in der Tabelle A4 des Beispielteils hierin beschrieben. Im Schutzbereich der vorliegenden Erfindung umfassen die ”Tabellen 4” die Tabelle A4a, A4b und A4c. Solche Nukleinsäuresequenzen sind zur Durchführung der erfindungsgemäßen Verfahren geeignet. Die in Tabelle A4 des Beispielteils angegebenen Aminosäuresequenzen sind Beispiel-Sequenzen für Orthologa und Paraloga der durch SEQ ID NO: 241, SEQ ID NO: 301 und SEQ ID NO: 561 veranschaulichten eIF4F-ähnlichen Proteinkomplex-Untereinheiten, wobei die Begriffe ”Orthologa” und ”Paraloga” die hier definierte Bedeutung haben. Weitere Orthologa und Paraloga können leicht durch Durchführen einer so genannten reziproken Blast-Suche identifiziert werden. Dies beinhaltet typischerweise einen ersten BLAST, bei der mit einer Abfragesequenz (zum Beispiel eine der in Tabelle A4 des Beispielteils aufgeführten Sequenzen) ein ”Blasting” gegen eine beliebige Sequenzdatenbank, wie die öffentlich zugängliche NCBI-Datenbank, durchgeführt wird. BLASTN oder TBLASTX (unter Verwendung von Standard-Default-Werten) werden im Allgemeinen dann verwendet, wenn man von einer Nukleotidsequenz ausgeht, und BLASTP oder TBLASTN (unter Verwendung von Standard-Default-Werten), wenn man von einer Proteinsequenz ausgeht. Die BLAST-Ergebnisse können gegebenenfalls gefiltert werden. Mit den Volllängen-Sequenzen der gefilterten oder ungefilterten Ergebnisse wird anschließend ein Rück-BLASTing (zweiter BLAST) gegen Sequenzen des Organismus, von dem die Abfragesequenz stammt, durchgeführt (ist die Abfragesequenz SEQ ID NO: 240 oder SEQ ID NO: 241, dann erfolgt das zweite BLASTing daher gegen Reis-Sequenzen). Die Ergebnisse des ersten und des zweiten BLASTing werden dann verglichen. Ein Paralogon wird dann identifiziert, wenn ein hochrangiger Hit von dem ersten BLASTing von derselben Art ist, von der die Abfragesequenz stammt, in diesem Fall führt ein Rück-BLASTing idealerweise zu der Abfragesequenz unter den höchstrangigen Hits; ein Orthologon wird dann identifiziert, wenn ein hochrangiger Hit in dem ersten BLASTing nicht von der gleichen Art wie derjenigen, von der die Abfragesequenz stammt, ist, und führt vorzugsweise beim Rück-BLASTing dazu, dass die Abfragesequenz unter den höchstrangigen Hits ist.Examples of nucleic acids encoding eIF4F-like protein complex subunits are described in Table A4 of the Examples section herein. Within the scope of the present invention, "Tables 4" include Tables A4a, A4b and A4c. Such nucleic acid sequences are suitable for carrying out the methods according to the invention. The amino acid sequences given in Table A4 of the Examples section are example sequences for orthologues and paralogues of the eIF4F-like protein complex subunits represented by SEQ ID NO: 241, SEQ ID NO: 301 and SEQ ID NO: 561, the terms "orthologues" and "Paralogues" that have the meaning defined here. Further orthologues and paralogs can be easily identified by performing a so-called reciprocal blast search. This typically involves a first BLAST in which a query sequence (for example, one of the sequences listed in Table A4 of the Examples section) blasts against any sequence database, such as the publicly accessible NCBI database. BLASTN or TBLASTX (using default default values) are generally used when assuming a nucleotide sequence, and BLASTP or TBLASTN (using default default values), assuming a protein sequence. If necessary, the BLAST results can be filtered. The full-length sequences of the filtered or unfiltered results are then re-BLASTed (second BLAST) against sequences of the organism from which the interrogation sequence originated (if the query sequence is SEQ ID NO: 240 or SEQ ID NO: 241) the second BLASTing therefore against rice sequences). The results of the first and second BLASTing are then compared. A paralogue is identified when a high ranking hit from the first BLASTing is of the same type as the query sequence, in which case a return BLASTing ideally results in the query sequence among the highest ranking hits; an orthologon is identified when a high-ranking hit in the first BLASTing is not of the same type as that from which the query sequence originated, and preferably results in the BLASTing retrieving the query sequence among the highest ranking hits.

In Bezug auf GR-RBP-Polypeptide wird die vorliegende Erfindung veranschaulicht durch Transformieren von Pflanzen mit der Nukleinsäuresequenz nach SEQ ID NO: 826, die die Polypeptidsequenz nach SEQ ID NO: 827 kodiert. Die erfindungsgemäße Leistungsfähigkeit ist jedoch nicht auf diese Sequenzen eingeschränkt; die erfindungsgemäßen Verfahren können vorteilhafterweise mit einer GR-RBP-kodierenden Nukleinsäure oder einem GR-RBP-Polypeptid, wie hier definiert durchgeführt werden.With respect to GR-RBP polypeptides, the present invention is illustrated by transforming plants having the nucleic acid sequence of SEQ ID NO: 826 which encodes the polypeptide sequence of SEQ ID NO: 827. However, the performance of the invention is not limited to these sequences; the methods of the invention may be advantageously carried out with a GR-RBP-encoding nucleic acid or a GR-RBP polypeptide as defined herein.

Beispiele für Nukleinsäuren, die SPT-ähnliche Polypeptide kodieren, sind in der Tabelle A5 des Beispielteils hierin beschrieben. Solche Nukleinsäuresequenzen sind zur Durchführung der erfindungsgemäßen Verfahren geeignet. Die in Tabelle A5 des Beispielteils angegebenen Aminosäuresequenzen sind Beispiel-Sequenzen für Orthologa und Paraloga des durch SEQ ID NO: 827 veranschaulichten GR-RBP-Polypeptids, wobei die Begriffe ”Orthologa” und ”Paraloga” die hier definierte Bedeutung haben. Weitere Orthologa und Paraloga können leicht durch Durchführen einer so genannten reziproken Blast-Suche identifiziert werden. Dies beinhaltet typischerweise einen ersten BLAST, bei der mit einer Abfragesequenz (zum Beispiel eine der in Tabelle A5 des Beispielteils aufgeführten Sequenzen) ein ”Blasting” gegen eine beliebige Sequenzdatenbank, wie die öffentlich zugängliche NCBI-Datenbank, durchgeführt wird. BLASTN oder TBLASTX (unter Verwendung von Standard-Default-Werten) werden im Allgemeinen dann verwendet, wenn man von einer Nukleotidsequenz ausgeht, und BLASTP oder TBLASTN (unter Verwendung von Standard-Default-Werten), wenn man von einer Proteinsequenz ausgeht. Die BLAST-Ergebnisse können gegebenenfalls gefiltert werden. Mit den Volllängen-Sequenzen der gefilterten oder ungefilterten Ergebnisse wird anschließend ein Rück-BLASTing (zweiter BLAST) gegen Sequenzen des Organismus, von dem die Abfragesequenz stammt, durchgeführt (ist die Abfragesequenz SEQ ID NO: 826 oder SEQ ID NO: 827, dann erfolgt das zweite BLASTing daher gegen Reis-Sequenzen). Die Ergebnisse des ersten und des zweiten BLASTing werden dann verglichen. Ein Paralogon wird dann identifiziert, wenn ein hochrangiger Hit von dem ersten BLASTing von derselben Art ist, von der die Abfragesequenz stammt, in diesem Fall führt ein Rück-BLASTing idealerweise zu der Abfragesequenz unter den höchstrangigen Hits; ein Orthologon wird dann identifiziert, wenn ein hochrangiger Hit in dem ersten BLASTing nicht von der gleichen Art wie derjenigen, von der die Abfragesequenz stammt, ist, und führt vorzugsweise beim Rück-BLASTing dazu, dass die Abfragesequenz unter den höchstrangigen Hits ist.Examples of nucleic acids encoding SPT-like polypeptides are described in Table A5 of the Examples section herein. Such nucleic acid sequences are suitable for carrying out the methods according to the invention. The amino acid sequences given in Table A5 of the Examples section are example sequences for orthologues and paralogues of the GR-RBP polypeptide represented by SEQ ID NO: 827, the terms "orthologue" and "paralogues" having the meaning as defined herein. Further orthologues and paralogs can be easily identified by performing a so-called reciprocal blast search. This typically involves a first BLAST in which a query sequence (e.g., one of the sequences listed in Table A5 of the Examples section) blasts against any sequence database, such as the publicly accessible NCBI database. BLASTN or TBLASTX (using default default values) are generally used when assuming a nucleotide sequence, and BLASTP or TBLASTN (using default default values), assuming a protein sequence. If necessary, the BLAST results can be filtered. The full-length sequences of the filtered or unfiltered results are then re-BLASTed (second BLAST) against sequences of the organism from which the query sequence is derived (if the query sequence is SEQ ID NO: 826 or SEQ ID NO: 827, then the second BLASTing is against rice sequences). The results of the first and second BLASTing are then compared. A paralogue is identified when a high ranking hit from the first BLASTing is of the same type as the query sequence, in which case a return BLASTing ideally results in the query sequence among the highest ranking hits; an orthologon is identified when a high-ranking hit in the first BLASTing is not of the same type as that from which the query sequence originated, and preferably results in the BLASTing retrieving the query sequence among the highest ranking hits.

Hochrangige Hits sind solche mit niedrigem E-Wert. Je niedriger der E-Wert, desto signifikanter der ”Score” (anders ausgedrückt, desto niedriger die Wahrscheinlichkeit, dass der Hit durch Zufall gefunden wurde). Die Berechnung des E-Werts ist Stand der Technik. Das ”Scoring” der Vergleiche erfolgt nicht nur mittels E-Werten, sondern auch mit dem Prozentsatz der Identität. Der Prozentsatz der Identität bezieht sich auf die Anzahl der identischen Nukleotide (oder Aminosäuren) zwischen den beiden verglichenen Nukleinsäure-(oder Polypeptid-)Sequenzen über eine bestimmte Länge. Bei großen Familien kann man ClustalW und anschließend einen Neighbour-Joining-Tree verwenden, um die Cluster der verwandten Gene leichter sichtbar zu machen und um Orthologa und Paraloga zu identifizieren.High-ranking hits are those with a low E value. The lower the E value, the more significant the "score" (in other words, the lower the probability that the hit was found by chance). The calculation of the E value is state of the art. The scoring of the comparisons is done not only by e-values but also by the percentage of identity. Percent identity refers to the number of identical nucleotides (or amino acids) between the two compared nucleic acid (or polypeptide) sequences over a particular length. Large families can use ClustalW followed by a neighbour-joining tree to make the clusters of related genes more visible and to identify orthologs and paralogues.

Die Aufgabe der Vorhersage der subzellulären Proteinlokalisation ist wichtig und gut untersucht. Experimentelle Verfahren zur Proteinlokalisierung reichen von der Immunlokalisierung bis zum Tagging von Proteinen mit grün fluoreszierendem Protein (GFP) oder beta-Glucuronidase (GUS). Solche Verfahren sind zwar präzise aber verglichen mit Computer-Verfahren arbeitsintensiv. Neuerdings wurde ein großer Fortschritt hinsichtlich der mittels Computer errechneten Vorhersage der Proteinlokalisation aus Sequenzdaten gemacht. An der ExPASy sind dem Fachmann bestens bekannte Algorithmen zugänglich, wie u. a beispielsweise die Proteomics-Werkzeuge PSort, TargetP, ChloroP, LocTree, Predotar, LipoP, MITOPROT, PATS, PTS1, SignalP, TMHMM und andere, die vom Schweizer Institut für Bioinformatik gehosted werden.The task of predicting subcellular protein localization is important and well studied. Experimental methods for protein localization range from immunolocalization to tagging of proteins with green fluorescent protein (GFP) or beta-glucuronidase (GUS). While such methods are precise, they are labor intensive compared to computer methods. Recently, great progress has been made in computer-calculated prediction of protein localization from sequence data. At ExPASy, algorithms which are well known to the person skilled in the art are available, such as For example, the proteomics tools PSort, TargetP, ChloroP, LocTree, Predotar, LipoP, MITOPROT, PATS, PTS1, SignalP, TMHMM, and others hosted by the Swiss Institute of Bioinformatics.

Auch Nukleinsäurevarianten können bei der Ausübung der Verfahren der Erfindung nützlich sein. Beispiele für solche Varianten umfassen Nukleinsäuren, die Homologa und Derivate von einer der in Tabelle A1 bis A5 des Beispielteils angegebenen Aminosäuresequenzen kodieren, wobei die Begriffe ”Homologa” und ”Derivat ” wie hier definiert sind. Bei den erfindungsgemäßen Verfahren sind auch Nukleinsäuren geeignet, die Homologa und Derivate von Orthologa oder Paraloga von einer der in Tabelle A1 bis A5 des Beispielteils angegebenen Aminosäuresequenzen kodieren. Homologe und Derivate, die in den Verfahren der vorliegenden Erfindung nützlich sind, besitzen im Wesentlichen die gleiche biologische und funktionelle Aktivität wie das unmodifizierte Protein, aus dem sie abgeleitet sind. Weitere für die Durchführung der Verfahren der Erfindung geeignete Varianten sind Varianten, bei denen der Codon-Einsatz optimiert ist oder bei denen miRNA-Targetstellen entfernt sind.Also, nucleic acid variants may be useful in practicing the methods of the invention. Examples of such variants include nucleic acids encoding homologs and derivatives of any one of the amino acid sequences given in Tables A1 to A5 of the Examples section, the terms "homologue" and "derivative" being as defined herein. Nucleic acids which code homologues and derivatives of orthologues or paralogues of one of the amino acid sequences given in Tables A1 to A5 of the Example section are also suitable in the methods according to the invention. Homologs and derivatives useful in the methods of the present invention have substantially the same biological and functional activity as the unmodified protein from which they are derived. Other variants suitable for carrying out the methods of the invention are variants in which the codon usage is optimized or in which miRNA target sites are removed.

Weitere Nukleinsäurevarianten, die sich bei der Ausübung der erfindungsgemäßen Verfahren eignen, umfassen Abschnitte von Nukleinsäuren, die C3H-ähnliche Polypeptide, oder SPT Polypeptide, oder IDI2 Polypeptide, oder eIF4F-ähnliche Proteinkomplex-Untereinheiten, oder GR-RBP Polypeptide kodieren, Nukleinsäuren, die an Nukleinsäuren hybridisieren, die C3H-ähnliche Polypeptide, oder SPT Polypeptide, oder IDI2 Polypeptide, oder eIF4F-ähnliche Proteinkomplex-Untereinheiten, oder GR-RBP Polypeptide kodieren, Spleißvarianten von Nukleinsäuren, die C3H-ähnliche Polypeptide, oder SPT Polypeptide, oder IDI2 Polypeptide, oder eIF4F-ähnliche Proteinkomplex-Untereinheiten, oder GR-RBP Polypeptide kodieren, Allelvarianten von Nukleinsäuren, die C3H-ähnliche Polypeptide, oder SPT Polypeptide, oder IDI2 Polypeptide, oder eIF4F-ähnliche Proteinkomplex-Untereinheiten, oder GR-RBP Polypeptide kodieren, und Varianten von Nukleinsäuren, die C3H-ähnliche Polypeptide, oder SPT Polypeptide, oder IDI2 Polypeptide, oder eIF4F-ähnliche Proteinkomplex-Untereinheiten, oder GR-RBP Polypeptide kodieren, die durch Gen-Shuffling erhalten wurden. Die Begriffe hybridisierende Sequenz, Spleißvariante, Allelvariante und Gen-Shuffling sind wie hier beschrieben.Other nucleic acid variants useful in the practice of the methods of the present invention include portions of nucleic acids encoding C3H-like polypeptides, or SPT polypeptides, or IDI2 polypeptides, or eIF4F-like protein complex subunits, or GR-RBP polypeptides, nucleic acids, the hybridize to nucleic acids encoding C3H-like polypeptides, or SPT polypeptides, or IDI2 polypeptides, or eIF4F-like protein complex subunits, or GR-RBP polypeptides, splice variants of nucleic acids, the C3H-like polypeptides, or SPT polypeptides, or IDI2 polypeptides , or eIF4F-like protein complex subunits, or GR-RBP polypeptides encode, allelic variants of nucleic acids encoding C3H-like polypeptides, or SPT polypeptides, or IDI2 polypeptides, or eIF4F-like protein complex subunits, or GR-RBP polypeptides, and Variants of nucleic acids, the C3H-like polypeptides, or SPT polypeptides, or IDI2 polypeptides, or eIF4F-like protein complex subunits, or GR-RBP polypeptides obtained by gene shuffling. The terms hybridizing sequence, splice variant, allelic variant and gene shuffling are as described herein.

Nukleinsäuren, die C3H-ähnliche Polypeptide, oder SPT Polypeptide, oder IDI2 Polypeptide, oder eIF4F-ähnliche Proteinkomplex-Untereinheiten, oder GR-RBP Polypeptide kodieren, müssen keine Volllängen-Nukleinsäuren sein, da die Leistungsfähigkeit der erfindungsgemäßen Verfahren nicht auf der Verwendung von Volllängen-Nukleinsäuresequenzen beruht. Erfindungsgemäß wird ein Verfahren bereitgestellt, zum Verbessern der Ertragsmerkmale in Pflanzen, umfassend das Einbringen und Exprimieren eines Teils von einer der in Tabelle A1 bis A5 des Beispielteils angegebenen Nukleinsäuresequenzen, oder eines Abschnitts einer Nukleinsäure, die ein Orthologon, Paralogon oder Homologon von einer der in Tabelle A1 bis A5 angegebenen angegebenen Aminosäuresequenzen des Beispielteils kodiert, in eine(r) Pflanze.Nucleic acids encoding C3H-like polypeptides, or SPT polypeptides, or IDI2 polypeptides, or eIF4F-like protein complex subunits, or GR-RBP polypeptides need not be full-length nucleic acids because the performance of the methods of the invention does not rely on the use of full-length Nucleic acid sequences. According to the invention, there is provided a method for improving the yield-related traits in plants, comprising introducing and expressing a portion of one of the nucleic acid sequences set forth in Tables A1 to A5 of the Examples section, or a portion of a nucleic acid containing an orthologue, paralogue or homologue of any of those described in U.S. Patent Nos Table A1 to A5 specified amino acid sequences of the example part coded in a (r) plant.

Ein Abschnitt einer Nukleinsäure kann zum Beispiel durch Vornehmen einer oder mehrerer Deletionen an der Nukleinsäure hergestellt werden. Die Abschnitte können in isolierter Form verwendet werden oder sie können an andere kodierende (oder nicht-kodierende) Sequenzen fusioniert sein, um zum Beispiel ein Protein zu erzeugen, das mehrere Aktivitäten vereint. Sofern es an andere kodierende Sequenzen fusioniert ist, kann das resultierende Polypeptid, das nach Translation produziert wird, größer sein als jenes, das für den Proteinabschnitt vorhergesagt wird. For example, a portion of a nucleic acid can be made by making one or more deletions on the nucleic acid. The segments may be used in isolated form or may be fused to other coding (or non-coding) sequences, for example, to create a protein that combines several activities. If fused to other coding sequences, the resulting polypeptide produced after translation may be larger than that predicted for the protein portion.

In Bezug auf C3H-ähnliche Polypeptide, kodieren Abschnitte, die sich bei den erfindungsgemäßen Verfahren eignen, ein C3H-ähnliches Polypeptid, wie hier definiert, und sie haben im Wesentlichen die gleiche biologische Aktivität, wie die in der Tabelle A1 des Beispielteils angegebenen Aminosäuresequenzen. Vorzugsweise ist der Abschnitt ein Abschnitt von einer beliebigen der in Tabelle A1 des Beispielteils angegebenen Nukleinsäuren, oder ist ein Abschnitt einer Nukleinsäure, die für ein Orthologon oder Paralogon einer beliebiger der in Tabelle A1 des Beispielteils angegebenen Aminosäuresequenzen kodiert. Der Abschnitt ist vorzugsweise mindestens 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, 1300, 1350, 1400, 1450, 1500 oder mehr zusamenhängende Nukleotide lang, wobei die zusammenhängenden Nukleotide von einer der in Tabelle A1 des Beispielteils angegebenen Nukleinsäuresequenzen stammen, oder einer Nukleinsäure, die ein Orthologon oder Paralogon von einer der in Tabelle A1 des Beispielteils angegebenen Aminosäuresequenzen ist. Am stärksten bevorzugt handelt es sich bei dem Abschnitt um einen Abschnitt der Nukleinsäure von SEQ ID NR: 1. Der Abschnitt kodiert vorzugsweise ein Fragment einer Aminosäuresequenz, die bei Verwendung bei der Konstruktion eines Stammbaums, wie er beispielsweise in der 2 gezeigt ist, mit der Gruppe der C3H-ähnlichen Polypeptide, umfassend die Aminosäuresequenz nach SEQ ID NO: 2 eher Cluster bildet, als mit einer anderen Gruppe.With respect to C3H-like polypeptides, portions useful in the methods of the invention encode a C3H-like polypeptide as defined herein and have substantially the same biological activity as the amino acid sequences set forth in Table A1 of the Examples section. Preferably, the portion is a portion of any of the nucleic acids set forth in Table A1 of the Examples section, or is a segment of nucleic acid encoding an orthologue or paralogue of any of the amino acid sequences set forth in Table A1 of the Examples section. The portion is preferably at least 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, 1300, 1350, 1400, 1450, 1500, or more contiguous nucleotides long, wherein the contiguous nucleotides are derived from one of the nucleic acid sequences given in Table A1 of the Examples section, or a nucleic acid which is an orthologue or paralogue of one of the amino acid sequences given in Table A1 of the Examples section. Most preferably, the portion is a portion of the nucleic acid of SEQ ID NO: 1. The portion preferably encodes a fragment of an amino acid sequence that, when used in the construction of a pedigree, such as those described in U.S. Patent Nos. 4,646,174; 2 is shown with the group of C3H-like polypeptides comprising the amino acid sequence of SEQ ID NO: 2 forms more clusters, as with another group.

In Bezug auf SPT-ähnliche Polypeptide, kodieren Abschnitte, die sich bei den erfindungsgemäßen Verfahren eignen, ein SPT-ähnliches Polypeptid, wie hier definiert, und sie haben im Wesentlichen die gleiche biologische Aktivität, wie die in der Tabelle A2 des Beispielteils angegebenen Aminosäuresequenzen. Vorzugsweise ist der Abschnitt ein Abschnitt von einer beliebigen der in Tabelle A2 des Beispielteils angegebenen Nukleinsäuren, oder ist ein Abschnitt einer Nukleinsäure, die für ein Orthologon oder Paralogon einer beliebigen der in Tabelle A2 des Beispielteils angegebenen Aminosäuresequenzen kodiert. Der Abschnitt ist vorzugsweise mindestens 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, 1300, 1350, 1400, 1450, 1500 oder mehr zusamenhängende Nukleotide lang, wobei die zusammenhängenden Nukleotide von einer der in Tabelle A2 des Beispielteils angegebenen Nukleinsäuresequenzen stammen, oder einer Nukleinsäure, die ein Orthologon oder Paralogon von einer der in Tabelle A2 des Beispielteils angegebenen Aminosäuresequenzen ist. Am stärksten bevorzugt handelt es sich bei dem Abschnitt um einen Abschnitt der Nukleinsäure von SEQ ID NR: 96. Der Abschnitt kodiert vorzugsweise ein Fragment einer Aminosäuresequenz, die bei Verwendung bei der Konstruktion eines Stammbaums, wie er beispielsweise in der 5 gezeigt ist, mit der Gruppe der SPT-ähnlichen Polypeptide umfassend die Aminosäuresequenz nach SEQ ID NO: 97 eher Cluster bildet, als mit einer anderen Gruppe.With respect to SPT-like polypeptides, portions useful in the methods of the invention encode an SPT-like polypeptide as defined herein and have substantially the same biological activity as the amino acid sequences set forth in Table A2 of the Examples section. Preferably, the portion is a portion of any of the nucleic acids set forth in Table A2 of the Examples section, or is a portion of a nucleic acid encoding an orthologue or paralogue of any of the amino acid sequences set forth in Table A2 of the Examples section. The portion is preferably at least 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, 1300, 1350, 1400, 1450, 1500, or more contiguous nucleotides long, wherein the contiguous nucleotides are derived from one of the nucleic acid sequences given in Table A2 of the Examples section, or a nucleic acid which is an orthologue or paralogue of one of the amino acid sequences given in Table A2 of the Examples section. Most preferably, the portion is a portion of the nucleic acid of SEQ ID NO: 96. Preferably, the portion encodes a fragment of an amino acid sequence that, when used in the construction of a pedigree such as that described in U.S. Pat 5 is shown with the group of SPT-like polypeptides comprising the amino acid sequence of SEQ ID NO: 97 forms more clusters, as with another group.

In Bezug auf IDI2-Polypeptide, kodieren Abschnitte, die sich bei den erfindungsgemäßen Verfahren eignen, ein IDI2-Polypeptid, wie hier definiert, und sie haben im Wesentlichen die gleiche biologische Aktivität, wie die in der Tabelle A3 des Beispielteils angegebenen Aminosäuresequenzen. Vorzugsweise ist der Abschnitt ein Abschnitt von einer beliebigen der in Tabelle A3 des Beispielteils angegebenen Nukleinsäuren, oder ist ein Abschnitt einer Nukleinsäure, die für ein Orthologon oder Paralogon einer beliebigen der in Tabelle A3 des Beispielteils angegebenen Aminosäuresequenzen kodiert. Der Abschnitt ist vorzugsweise mindestens 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, 1300, 1350, 1400, 1450, 1500 oder mehr zusammenhängende Nukleotide lang, wobei die zusammenhängenden Nukleotide von einer der in Tabelle A3 des Beispielteils angegebenen Nukleinsäuresequenzen stammen, oder einer Nukleinsäure, die ein Orthologon oder Paralogon von einer der in Tabelle A3 des Beispielteils angegebenen Aminosäuresequenzen ist. Am stärksten bevorzugt handelt es sich bei dem Abschnitt um einen Abschnitt der Nukleinsäure von SEQ ID NR: 139. Der Abschnitt kodiert vorzugsweise ein Fragment einer Aminosäuresequenz, die bei Verwendung bei der Konstruktion eines Stammbaums, wie er beispielsweise in der 9 gezeigt ist, eher mit der Gruppe A oder B Cluster bildet, als mit einer anderen Gruppe, stärker bevorzugt bildet die Polypeptid-Sequenz mit der Gruppe A der IDI2-Polypeptide, umfassend die Aminosäuresequenz nach SEQ ID NO: 140, Cluster.With respect to IDI2 polypeptides, portions useful in the methods of the invention encode an IDI2 polypeptide as defined herein and have substantially the same biological activity as the amino acid sequences set forth in Table A3 of the Examples section. Preferably, the segment is a segment of any of the nucleic acids set forth in Table A3 of the Examples section, or is a segment of a nucleic acid encoding a nucleic acid Orthologue or paralogue of any of the amino acid sequences given in Table A3 of the Examples section. The portion is preferably at least 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, 1300, 1350, 1400, 1450, 1500 or more contiguous nucleotides long, wherein the contiguous nucleotides are derived from one of the nucleic acid sequences given in Table A3 of the Examples section, or a nucleic acid which is an orthologue or paralogue of one of the amino acid sequences given in Table A3 of the Examples section. Most preferably, the portion is a portion of the nucleic acid of SEQ ID NO: 139. The portion preferably encodes a fragment of an amino acid sequence which, when used in the construction of a pedigree, such as those described in U.S. Patent Nos. 4,149,466 and 5,134,134 9 more preferably clustering with group A or B than with another group, more preferably the polypeptide sequence with group A of the IDI2 polypeptides comprising the amino acid sequence of SEQ ID NO: 140 forms clusters.

In Bezug auf eIF4F-ähnliche Proteinkomplex-Untereinheiten, kodieren Abschnitte, die sich bei den erfindungsgemäßen Verfahren eignen, eIF4F-ähnliche Proteinkomplex-Untereinheiten, wie hier definiert, und sie haben im Wesentlichen die gleiche biologische Aktivität, wie die in der Tabelle A4 des Beispielteils angegebenen Aminosäuresequenzen. Vorzugsweise ist der Abschnitt ein Abschnitt von einer beliebigen der in Tabelle A4 des Beispielteils angegebenen Nukleinsäuren, oder ist ein Abschnitt einer Nukleinsäure, die für ein Orthologon oder Paralogon einer beliebigen der in Tabelle A4 des Beispielteils angegebenen Aminosäuresequenzen kodiert. Der Abschnitt ist vorzugsweise mindestens 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, 1300, 1350, 1400, 1450, 1500 oder mehr zusammenhängende Nukleotide lang, wobei die zusammenhängenden Nukleotide von einer der in Tabelle A4 des Beispielteils angegebenen Nukleinsäuresequenzen stammen, oder einer Nukleinsäure, die ein Orthologon oder Paralogon von einer der in Tabelle A4 des Beispielteils angegebenen Aminosäuresequenzen ist. Am stärksten bevorzugt handelt es sich bei dem Abschnitt um einen Abschnitt der Nukleinsäure von SEQ ID NR: 240, 300 oder 560. Der Abschnitt kodiert vorzugsweise ein Fragment einer Aminosäuresequenz, die bei Verwendung bei der Konstruktion eines Stammbaums, wie er beispielsweise in den 12, 13 und 14 gezeigt ist, mit der Gruppe der eIF4F-ähnlichen Untereinheits-Polypeptide, umfassend die Aminosäuresequenz nach SEQ ID NO: 241 eher Cluster bildet, als mit einer anderen Gruppe.With respect to eIF4F-like protein complex subunits, portions useful in the methods of the invention encode eIF4F-like protein complex subunits as defined herein and have substantially the same biological activity as those set forth in Table A4 of the Examples section indicated amino acid sequences. Preferably, the portion is a portion of any of the nucleic acids set forth in Table A4 of the Examples section, or is a portion of a nucleic acid encoding an orthologue or paralogue of any of the amino acid sequences set forth in Table A4 of the Examples section. The portion is preferably at least 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, 1300, 1350, 1400, 1450, 1500 or more contiguous nucleotides long, wherein the contiguous nucleotides are derived from one of the nucleic acid sequences given in Table A4 of the Examples section, or a nucleic acid which is an orthologue or paralogue of one of the amino acid sequences given in Table A4 of the Examples section. Most preferably, the portion is a portion of the nucleic acid of SEQ ID NO: 240, 300, or 560. The portion preferably encodes a fragment of an amino acid sequence that, when used in the construction of a pedigree, as described, for example, in U.S. Pat 12 . 13 and 14 is shown to cluster with the group of eIF4F-like subunit polypeptides comprising the amino acid sequence of SEQ ID NO: 241 rather than another group.

In Bezug auf GR-RBP-Polypeptide, kodieren Abschnitte, die sich bei den erfindungsgemäßen Verfahren eignen, ein GR-RBP-Polypeptid, wie hier definiert, und sie haben im Wesentlichen die gleiche biologische Aktivität, wie die in der Tabelle A5 des Beispielteils angegebenen Aminosäuresequenzen. Vorzugsweise ist der Abschnitt ein Abschnitt von einer beliebigen der in Tabelle A5 des Beispielteils angegebenen Nukleinsäuren, oder ist ein Abschnitt einer Nukleinsäure, die für ein Orthologon oder Paralogon einer beliebigen der in Tabelle A5 des Beispielteils angegebenen Aminosäuresequenzen kodiert. Der Abschnitt ist vorzugsweise mindestens 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, 1300, 1350, 1400, 1450, 1500 oder mehr zusammenhängende Nukleotide lang, wobei die zusammenhängenden Nukleotide von einer der in Tabelle A5 des Beispielteils angegebenen Nukleinsäuresequenzen stammen, oder einer Nukleinsäure, die ein Orthologon oder Paralogon von einer der in Tabelle A5 des Beispielteils angegebenen Aminosäuresequenzen ist. Am stärksten bevorzugt handelt es sich bei dem Abschnitt um einen Abschnitt der Nukleinsäure von SEQ ID NR: 826. Der Abschnitt kodiert vorzugsweise ein Fragment einer Aminosäuresequenz, die bei Verwendung bei der Konstruktion eines Stammbaums, wie er beispielsweise in der 18 gezeigt ist, mit der Gruppe A oder B, stärker bevorzugt mit der Gruppe A der GR-RBP Polypeptide, umfassend die Aminosäuresequenz nach SEQ ID NO: 827, eher Cluster bildet, als mit einer anderen Gruppe.With respect to GR-RBP polypeptides, portions useful in the methods of the invention encode a GR-RBP polypeptide as defined herein and have substantially the same biological activity as those set forth in Table A5 of the Examples section amino acid sequences. Preferably, the portion is a portion of any of the nucleic acids set forth in Table A5 of the Examples section, or is a portion of a nucleic acid encoding an orthologue or paralogue of any of the amino acid sequences set forth in Table A5 of the Examples section. The portion is preferably at least 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, 1300, 1350, 1400, 1450, 1500 or more contiguous nucleotides long, wherein the contiguous nucleotides are derived from one of the nucleic acid sequences given in Table A5 of the Examples section, or a nucleic acid which is an orthologue or paralogue of one of the amino acid sequences given in Table A5 of the Examples section. Most preferably, the portion is a portion of the nucleic acid of SEQ ID NO: 826. The portion preferably encodes a fragment of an amino acid sequence which, when used in the construction of a pedigree, such as those described in U.S. Patent Nos. 4,616,466 and 5,634,686 18 with group A or B, more preferably group A of the GR-RBP polypeptides comprising the amino acid sequence of SEQ ID NO: 827, forms clusters rather than another group.

Eine weitere Nukleinsäurevariante, die sich bei den erfindungsgemäßen Verfahren eignet, ist eine Nukleinsäure, die unter reduzierten Stringenzbedingungen, vorzugsweise unter stringenten Bedingungen, mit einer Nukleinsäure, die ein C3H-ähnliches Polypeptid, oder ein SPT Polypeptid, oder ein IDI2 Polypeptid, oder eine eIF4F-ähnliche Proteinkomplex-Untereinheit, oder ein GR-RBP Polypeptid wie hier definiert kodiert, oder mit einem Abschnitt wie hier definiert hybridisieren kann.Another nucleic acid variant useful in the methods of the invention is a nucleic acid produced under reduced stringency conditions, preferably under stringent conditions, with a nucleic acid encoding a C3H-like polypeptide, or an SPT polypeptide, or an IDI2 polypeptide, or an eIF4F -like protein complex subunit, or a GR-RBP polypeptide as defined herein, or with a portion as defined herein.

Gemäß der vorliegenden Erfindung wird ein Verfahren zur Verbesserung von Ertragsmerkmalen bei Pflanzen bereitgestellt, bei dem man in eine(r) Pflanze eine Nukleinsäure, die mit einer der in den Tabellen A1 bis A5 des Beispielteils angegebenen Nukleinsäuren hybridisieren kann, einführt und exprimiert, oder bei dem man in eine(r) Pflanze eine Nukleinsäure, die mit einer Nukleinsäure, die ein Orthologon, Paralogon oder Homologon von einer der in den Tabellen A1 bis A5 des Beispielteils angegebenen Nukleinsäuren kodiert, hybridisieren kann, einführt und exprimiert.According to the present invention, there is provided a method of improving yield-related traits in plants comprising introducing and expressing into a plant a nucleic acid capable of hybridizing with any of the nucleic acids set forth in Tables A1 to A5 of the Examples section in which a nucleic acid which can hybridise with a nucleic acid which can hybridize to a nucleic acid which encodes an orthologone, paralogue or homologue of one of the nucleic acids indicated in Tables A1 to A5 of the Examples section, is introduced and expressed.

In Bezug auf C3H-ähnliche Polypeptide kodieren hybridisierende Sequenzen, die sich bei den erfindungsgemäßen Verfahren eignen, ein C3H-ähnliches Polypeptid wie hier definiert, und sie weisen im Wesentlichen die gleiche biologische Aktivität wie die in Tabelle A1 des Beispielteils angegebenen Aminosäuresequenzen auf. Die hybridisierende Sequenz kann vorzugsweise mit dem Komplement von einer der in Tabelle A1 des Beispielteils angegebenen Nukleinsäuren oder mit einem Abschnitt von einer dieser Sequenzen hybridisieren, wobei ein Abschnitt wie oben definiert ist, oder die hybridisierende Sequenz kann an das Komplement einer Nukleinsäure, die ein Orthologon oder Paralogon von einer der in Tabelle A1 des Beispielteils angegebenen Aminosäuresequenzen kodiert, hybridisieren. Am stärksten bevorzugt kann die hybridisierende Sequenz an das Komplement einer Nukleinsäure nach SEQ ID NO: 1 oder an einen Abschnitt davon hybridisieren.With respect to C3H-like polypeptides, hybridizing sequences useful in the methods of the invention encode a C3H-like polypeptide as defined herein and have substantially the same biological activity as the amino acid sequences set forth in Table A1 of the Examples section. The hybridizing sequence may preferably hybridize to the complement of one of the nucleic acids set forth in Table A1 of the Examples section or to a portion of one of these sequences, with a section as defined above, or the hybridizing sequence may be attached to the complement of a nucleic acid encoding an orthologue or paralogue of one of the amino acid sequences given in Table A1 of the Example section, hybridize. Most preferably, the hybridizing sequence can hybridize to the complement of a nucleic acid of SEQ ID NO: 1 or to a portion thereof.

Die hybridisierende Sequenz kodiert vorzugsweise ein Polypeptid mit einer Aminosäuresequenz, die wenn sie Volllänge ist und bei der Konstruktion eines Stammbaums verwendet wird, wie er in der 2 gezeigt, ist eher mit der Gruppe der C3H-ähnlichen Polypeptide, die die Aminosäuresequenz nach SEQ ID NO: 2 umfassen, Cluster bildet als mit einer anderen Gruppe.The hybridizing sequence preferably encodes a polypeptide having an amino acid sequence which, when full-length and used in the construction of a pedigree, as described in U.S. Pat 2 is more likely to cluster with the group of C3H-like polypeptides comprising the amino acid sequence of SEQ ID NO: 2 than with another group.

In Bezug auf SPT-ähnliche Polypeptide kodieren hybridisierende Sequenzen, die sich bei den erfindungsgemäßen Verfahren eignen, ein SPT-ähnliches Polypeptid wie hier definiert, und sie weisen im Wesentlichen die gleiche biologische Aktivität wie die in Tabelle A2 des Beispielteils angegebenen Ammnosäuresequenzen auf. Die hybridisierende Sequenz kann vorzugsweise mit dem Komplement von einer der in Tabelle A2 des Beispielteils angegebenen Nukleinsäuren oder mit einem Abschnitt von einer dieser Sequenzen hybridisieren, wobei ein Abschnitt wie oben definiert ist, oder die hybridisierende Sequenz kann an das Komplement einer Nukleinsäure, die ein Orthologon oder Paralogon von einer der in Tabelle A2 des Beispielteils angegebenen Aminosäuresequenzen kodiert, hybridisieren. Am stärksten bevorzugt kann die hybridisierende Sequenz an das Komplement einer Nukleinsäure nach SEQ ID NO: 96 oder an einen Abschnitt davon hybridisieren.With respect to SPT-like polypeptides, hybridizing sequences useful in the methods of the invention encode an SPT-like polypeptide as defined herein and have substantially the same biological activity as the amino acid sequences set forth in Table A2 of the Examples section. The hybridizing sequence may preferably be with the complement of any of those listed in Table Or a portion of one of these sequences, wherein a portion is as defined above, or the hybridizing sequence may encode the complement of a nucleic acid encoding an orthologue or paralogue of any of the amino acid sequences set forth in Table A2 of the Examples section , hybridize. Most preferably, the hybridizing sequence can hybridize to the complement of a nucleic acid of SEQ ID NO: 96 or to a portion thereof.

Die hybridisierende Sequenz kodiert vorzugsweise ein Polypeptid mit einer Aminosäuresequenz, die wenn sie Volllänge ist und bei der Konstruktion eines Stammbaums verwendet wird, wie er in der 5 gezeigt ist, eher mit der Gruppe der SPT-ähnlichen Polypeptide, die die Aminosäuresequenz nach SEQ ID NO: 97 umfassen, Cluster bildet als mit einer anderen Gruppe.The hybridizing sequence preferably encodes a polypeptide having an amino acid sequence which, when full-length and used in the construction of a pedigree, as described in U.S. Pat 5 is more likely to cluster with the group of SPT-like polypeptides comprising the amino acid sequence of SEQ ID NO: 97 than with another group.

In Bezug auf IDI2-Polypeptide kodieren hybridisierende Sequenzen, die sich bei den erfindungsgemäßen Verfahren eignen, ein IDI2-Polypeptid wie hier definiert, und sie weisen im Wesentlichen die gleiche biologische Aktivität wie die in Tabelle A3 des Beispielteils angegebenen Aminosäuresequenzen auf. Die hybridisierende Sequenz kann vorzugsweise mit dem Komplement von einer der in Tabelle A3 des Beispielteils angegebenen Nukleinsäuren oder mit einem Abschnitt von einer dieser Sequenzen hybridisieren, wobei ein Abschnitt wie oben definiert ist, oder die hybridisierende Sequenz kann an das Komplement einer Nukleinsäure, die ein Orthologon oder Paralogon von einer der in Tabelle A3 des Beispielteils angegebenen Aminosäuresequenzen kodiert, hybridisieren. Am stärksten bevorzugt kann die hybridisierende Sequenz an das Komplement einer Nukleinsäure nach SEQ ID NO: 139 oder an einen Abschnitt davon hybridisieren.With respect to IDI2 polypeptides, hybridizing sequences useful in the methods of the invention encode an IDI2 polypeptide as defined herein and have substantially the same biological activity as the amino acid sequences set forth in Table A3 of the Examples section. The hybridizing sequence may preferably hybridize to the complement of one of the nucleic acids set forth in Table A3 of the Examples section or to a portion of one of these sequences, with a section as defined above, or the hybridizing sequence may be attached to the complement of a nucleic acid encoding an orthologue or paralogue of one of the amino acid sequences given in Table A3 of the Examples section, hybridize. Most preferably, the hybridizing sequence can hybridize to the complement of a nucleic acid of SEQ ID NO: 139 or to a portion thereof.

Die hybridisierende Sequenz kodiert vorzugsweise ein Polypeptid mit einer Aminosäuresequenz, die wenn sie Volllänge ist und bei der Konstruktion eines Stammbaums verwendet wird, wie er in der 9 gezeigt ist, eher mit der Gruppe A oder B als mit einer anderen Gruppe Cluster bildet, stärker bevorzugt bildet die Polypeptid-Sequenz mit der Gruppe A der IDI2-Polypeptide, die die Aminosäuresequenz nach SEQ ID NO: 140 umfassen, Cluster.The hybridizing sequence preferably encodes a polypeptide having an amino acid sequence which, when full-length and used in the construction of a pedigree, as described in U.S. Pat 9 More preferably, the polypeptide sequence forms clusters with group A of the IDI2 polypeptides comprising the amino acid sequence of SEQ ID NO: 140, rather with group A or B than with another group.

In Bezug auf eIF4F-ähnliche Proteinkomplex-Untereinheiten kodieren hybridisierende Sequenzen, die sich bei den erfindungsgemäßen Verfahren eignen, mindesten eine eiF4F-ähnliche Proteinkomplex-Untereinheit wie hier definiert, und sie weisen im Wesentlichen die gleiche biologische Aktivität wie die in den Tabellen A4 des Beispielteils angegebenen Aminosäuresequenzen auf. Die hybridisierende Sequenz kann vorzugsweise mit dem Komplement von einer der in Tabelle A4 des Beispielteils angegebenen Nukleinsäuren oder mit einem Abschnitt von einer dieser Sequenzen hybridisieren, wobei am Abschnitt wie oben definiert ist, oder die hybridisierende Sequenz kann an das Komplement einer Nukleinsäure, die ein Orthologon oder Paralogon von einer der in Tabelle A4 des Beispielteils angegebenen Aminosäuresequenzen kodiert, hybridisieren. Am stärksten bevorzugt kann die hybridisierende Sequenz an das Komplement einer Nukleinsäure nach SEQ ID NO: 240, SEQ ID NO: 300 oder SEQ ID NO: 560 oder an einen Abschnitt davon hybridisieren und in einer weiter bevorzugten Ausführungsform der vorliegenden Erfindung kann die hybridisierende Sequenz an das Komplement einer Nukleinsäure nach SEQ ID NO: 240 oder an einen Abschnitt davon hybridisieren.With respect to eIF4F-like protein complex subunits, hybridizing sequences useful in the methods of the invention encode at least one eiF4F-like protein complex subunit as defined herein and have substantially the same biological activity as those in Tables A4 of the Examples section indicated amino acid sequences. The hybridizing sequence may preferably hybridize to the complement of one of the nucleic acids set forth in Table A4 of the Examples section, or to a portion of one of these sequences, wherein the section is as defined above, or the hybridizing sequence may be to the complement of a nucleic acid encoding an ortholog or paralogue of one of the amino acid sequences given in Table A4 of the Example section, hybridize. Most preferably, the hybridizing sequence may hybridize to the complement of a nucleic acid of SEQ ID NO: 240, SEQ ID NO: 300, or SEQ ID NO: 560, or to a portion thereof, and in a further preferred embodiment of the present invention, the hybridizing sequence hybridize the complement of a nucleic acid of SEQ ID NO: 240 or to a portion thereof.

Die hybridisierende Sequenz kodiert vorzugsweise ein Polypeptid mit einer Aminosäuresequenz, die wenn sie Vollänge ist und bei der Konstruktion eines Stammbaums verwendet wird, wie er in den 12, 13 und 14 gezeigt ist, eher mit der Gruppe der eIF4F-ähnlichen Proteinkomplex-Untereinheiten, die die Aminosäuresequenz nach SEQ ID NO: 241, SEQ ID NO: 301 und SEQ ID NO: 561, und am stärksten bevorzugt die Aminosäuresequenz nach SEQ ID NO: 241 umfassen, Cluster bildet, als mit einer anderen Gruppe.The hybridizing sequence preferably encodes a polypeptide having an amino acid sequence which, when full-length and used in the construction of a pedigree, as described in U.S. Pat 12 . 13 and 14 is shown more with the group of eIF4F-like protein complex subunits comprising the amino acid sequence of SEQ ID NO: 241, SEQ ID NO: 301 and SEQ ID NO: 561, and most preferably the amino acid sequence of SEQ ID NO: 241 , Cluster forms as with another group.

In Bezug auf GR-RBP-Polypeptide kodieren hybridisierende Sequenzen, die sich bei den erfindungsgemäßen Verfahren eignen, ein GR-RBP-Polypeptid wie hier definiert, und sie weisen im Wesentlichen die gleiche biologische Aktivität wie die in Tabelle A5 des Beispielteils angegebenen Aminosäuresequenzen auf. Die hybridisierende Sequenz kann vorzugsweise mit dem Komplement von einer der in Tabelle A5 des Beispielteils angegebenen Nukleinsäuren oder mit einem Abschnitt von einer dieser Sequenzen hybridisieren, wobei ein Abschnitt wie oben definiert ist, oder die hybridisierende Sequenz kann an das Komplement einer Nukleinsäure, die ein Orthologon oder Paralogon von einer der in Tabelle A5 des Beispielteils angegebenen Aminosäuresequenzen kodiert, hybridisieren. Am stärksten bevorzugt kann die hybridisierende Sequenz an das Komplement einer Nukleinsäure nach SEQ ID NO: 826 oder an einen Abschnitt davon hybridisieren.With respect to GR-RBP polypeptides, hybridizing sequences useful in the methods of the invention encode a GR-RBP polypeptide as defined herein and have substantially the same biological activity as the amino acid sequences set forth in Table A5 of the Examples section. The hybridizing sequence may preferably hybridize to the complement of one of the nucleic acids set forth in Table A5 of the Examples section or to a portion of one of these sequences, with a portion as defined above, or the hybridizing sequence may be attached to the complement of a nucleic acid encoding an orthologue or paralogon from one of the amino acid sequences given in Table A5 of the Examples section. Most preferably, the hybridizing sequence can hybridize to the complement of a nucleic acid of SEQ ID NO: 826 or to a portion thereof.

Die hybridisierende Sequenz kodiert vorzugsweise ein Polypeptid mit einer Aminosäuresequenz, die wenn sie Volllänge ist und bei der Konstruktion eines Stammbaums verwendet wird, wie er in der 18 gezeigt ist, eher mit der Gruppe A oder B, stärker bevorzugt mit der Gruppe A der GR-RBP Polypeptide, die die Aminosäuresequenz nach SEQ ID NO: 827 umfassen, Cluster bildet als mit einer anderen Gruppe.The hybridizing sequence preferably encodes a polypeptide having an amino acid sequence which, when full-length and used in the construction of a pedigree, as described in U.S. Pat 18 is shown clustering with group A or B, more preferably group A of the GR-RBP polypeptides comprising the amino acid sequence of SEQ ID NO: 827, than with another group.

In Bezug auf C3H-ähnliche Polypeptide, oder SPT-Polypeptide, oder IDI2-Polypeptide oder GR-RBP-Polypeptide ist eine weitere Nukleinsäurevariante, die sich in den erfindungsgemäßen Verfahren eignet, eine Spleißvariante, die ein C3H-ähnliches Polypeptid, oder SPT-Polypeptid, oder IDI2-Polypeptid oder GR-RBP-Polypeptid wie vorstehend definiert kodiert, wobei eine Spleißvariante die hier definierte Bedeutung hat. With respect to C3H-like polypeptides, or SPT polypeptides, or IDI2 polypeptides or GR-RBP polypeptides, another nucleic acid variant useful in the methods of the invention is a splice variant that is a C3H-like polypeptide, or SPT polypeptide , or IDI2 polypeptide or GR-RBP polypeptide as defined above, wherein a splice variant has the meaning as defined herein.

In Bezug auf eIF4F-ähnliche Proteinkomplex-Untereinheiten ist eine weitere Nukleinsäurevariante, die sich in den erfindungsgemäßen Verfahren eignet, eine Spleißvariante, die mindestens eine eIF4F-ähnliche Proteinkomplex-Untereinheit wie vorstehend definiert kodiert, wobei eine Spleißvariante die hier definierte Bedeutung hat.With respect to eIF4F-like protein complex subunits, another nucleic acid variant useful in the methods of the invention is a splice variant encoding at least one eIF4F-like protein complex subunit as defined above, wherein a splice variant has the meaning as defined herein.

In Bezug auf C3H-ähnliche Polypeptide, oder SPT-Polypeptide, oder IDI2-Polypeptide oder GR-RBP-Polypeptide wird erfindungsgemäß ein Verfahren zur Verbesserung der Ertragsmerkmale bei Pflanzen bereitgestellt, bei dem man in eine(r) Pflanze eine Spleißvariante von einer der in Tabelle A1 oder Tabelle A2 oder Tabelle A3 oder Tabelle A5 des Beispielteils angegebenen Nukleinsäuresequenzen, oder eine Spleißvariante einer Nukleinsäure, die ein Orthologon, Paralogon oder Homologon von von einer der in Tabelle A1, oder Tabelle A2 oder Tabelle A3 oder Tabelle A5 des Beispielteils angegebenen Aminosäuresequenzen kodiert, einführt und exprimiert.With respect to C3H-like polypeptides, or SPT polypeptides, or IDI2 polypeptides or GR-RBP polypeptides, there is provided in accordance with the present invention a method of enhancing plant yield-related traits comprising splicing a variant of one of the in-plant varieties into a plant Or a splice variant of a nucleic acid which is an orthologue, paralogue or homologue of one of the amino acid sequences given in Table A1, or Table A2 or Table A3 or Table A5 of the Examples section encodes, introduces and expresses.

In Bezug auf eIF4F-Proteinkomplex-Untereinheiten wird erfindungsgemäß ein Verfahren zur Verbesserung der Ertragsmerkmale bei Pflanzen bereitgestellt, bei dem man in eine(r) Pflanze eine Spleißvariante von mindestens einer der in Tabelle A4 des Beispielteils angegebenen Nukleinsäuresequenzen, oder mindestens eine Spleißvariante einer Nukleinsäure, die ein Orthologon, Paralogon oder Homologon von mindestens einer der in Tabelle A4 des Beispielteils angegebenen Aminosäuresequenzen kodiert, einführt und exprimiert.With regard to eIF4F protein complex subunits, a method for improving the yield-related traits in plants is provided according to the invention, in which a splice variant of at least one of the nucleic acid sequences given in Table A4 of the Examples section, or at least one splicing variant of a nucleic acid, which encodes, introduces and expresses an orthologue, paralogue or homologue of at least one of the amino acid sequences given in Table A4 of the Examples section.

In Bezug auf C3H-ähnliche Polypeptide, handelt es sich bei bevorzugten Spleißvarianten um Spleißvarianten einer Nukleinsäure nach SEQ ID NO: 1, oder eine Spleißvariante einer Nukleinsäure, die ein Orthologon oder Paralogon nach SEQ ID NO: 2 kodiert. Die von der Spleißvariante kodierte Aminosäuresequenz bildet vorzugsweise, wenn sie bei der Konstruktion eines Stammbaums verwendet wird, wie er in der 2 gezeigt ist, eher mit der Gruppe der C3H-ähnlichen Polypeptide, umfassend die Aminosäuresequenz nach SEQ ID NO: 2, Cluster als mit einer anderen Gruppe.With respect to C3H-like polypeptides, preferred splice variants are splice variants of a nucleic acid according to SEQ ID NO: 1, or a splice variant of a nucleic acid which encodes an orthologue or paralogon according to SEQ ID NO: 2. The amino acid sequence encoded by the splice variant preferably forms when used in the construction of a pedigree as described in U.S. Pat 2 with the group of C3H-like polypeptides comprising the amino acid sequence of SEQ ID NO: 2, clusters rather than with another group.

In Bezug auf SPT-Polypeptide, handelt es sich bei bevorzugten Spleißvarianten um Spleißvarianten einer Nukleinsäure nach SEQ ID NO: 96, oder eine Spleißvariante einer Nukleinsäure, die ein Orthologon oder Paralogon nach SEQ ID NO: 97 kodiert. Die von der Spleißvariante kodierte Aminosäuresequenz bildet vorzugsweise, wenn sie bei der Konstruktion eines Stammbaums verwendet wird, wie er in der 5 gezeigt ist, eher mit der Gruppe der SPT-ähnlichen Polypeptide, umfassend die Aminosäuresequenz nach SEQ ID NO: 97, Cluster als mit einer anderen Gruppe.With regard to SPT polypeptides, preferred splice variants are splice variants of a nucleic acid according to SEQ ID NO: 96, or a splice variant of a nucleic acid which encodes an orthologue or paralogon according to SEQ ID NO: 97. The amino acid sequence encoded by the splice variant preferably forms when used in the construction of a pedigree as described in U.S. Pat 5 shown with the group of SPT-like polypeptides comprising the amino acid sequence of SEQ ID NO: 97, rather than clusters with another group.

In Bezug auf IDI2-Polypeptide, handelt es sich bei bevorzugten Spleißvarianten um Spleißvarianten einer Nukleinsäure nach SEQ ID NO: 139, oder eine Spleißvariante einer Nukleinsäure, die ein Orthologon oder Paralogon nach SEQ ID NO: 140 kodiert. Die von der Spleißvariante kodierte Aminosäuresequenz bildet vorzugsweise, wenn sie bei der Konstruktion eines Stammbaums verwendet wird, wie er in der 9 gezeigt ist, eher mit der Gruppe A oder B als mit einer anderen Gruppe Cluster, stärker bevorzugt bildet die Polypeptid-Sequenz mit der Gruppe A der IDI2-Polypeptide, umfassend die Aminosäuresequenz nach SEQ ID NO: 140, Cluster.With respect to IDI2 polypeptides, preferred splice variants are splice variants of a nucleic acid according to SEQ ID NO: 139, or a splice variant of a nucleic acid which encodes an orthologue or paralogon of SEQ ID NO: 140. The amino acid sequence encoded by the splice variant preferably forms when used in the construction of a pedigree as described in U.S. Pat 9 More preferably, the polypeptide sequence with group A of the IDI2 polypeptides, comprising the amino acid sequence of SEQ ID NO: 140, forms clusters, rather with group A or B than with another group.

In Bezug auf eIF4F-ähnliche Proteinkomplex-Untereinheit, handelt es sich bei bevorzugten Spleißvarianten um Spleißvarianten einer Nukleinsäure nach SEQ ID NO: 240, SEQ ID NO: 300 und/oder SEQ ID NO: 560, oder eine Spleißvariante einer Nukleinsäure, die ein Orthologon oder Paralogon nach SEQ ID NO: SEQ ID NO: 241, SEQ ID NO: 301 oder SEQ ID NO: 561 kodiert. Die von der Spleißvariante kodierte Aminosäuresequenz bildet vorzugsweise, wenn sie bei der Konstruktion eines Stammbaums verwendet wird, wie er in den 12, 13 und/oder 14 gezeigt ist, eher mit mindestens einer aus der Gruppe der eIF4F-ähnlichen Proteinkomplex-Untereinheiten, wie eIF4isoG/G, eIF4A oder eIF4F/isoE, umfassend mindestens eine Aminosäuresequenz nach SEQ ID NO: 241, SEQ ID NO: 301 oder SEQ ID NO: 561, am stärksten bevorzugt die Aminosäuresequenz nach SEQ ID NO: 241, Cluster als mit einer anderen Gruppe.With respect to eIF4F-like protein complex subunit, preferred splice variants are splice variants of a nucleic acid according to SEQ ID NO: 240, SEQ ID NO: 300 and / or SEQ ID NO: 560, or a splice variant of a nucleic acid which is an orthologue or paralogon according to SEQ ID NO: SEQ ID NO: 241, SEQ ID NO: 301 or SEQ ID NO: 561. The amino acid sequence encoded by the splice variant preferably forms when used in the construction of a pedigree as described in U.S. Pat 12 . 13 and or 14 rather, at least one of the group of eIF4F-like protein complex subunits, such as eIF4isoG / G, eIF4A or eIF4F / isoE, comprising at least one amino acid sequence according to SEQ ID NO: 241, SEQ ID NO: 301 or SEQ ID NO: 561, most preferably the amino acid sequence of SEQ ID NO: 241, clusters than with another group.

In Bezug auf GR-RBP-Polypeptide, handelt es sich bei bevorzugten Spleißvarianten um Spleißvarianten einer Nukleinsäure nach SEQ ID NO: 826, oder eine Spleißvariante einer Nukleinsäure, die ein Orthologon oder Paralogon nach SEQ ID NO: 827 kodiert. Die von der Spleilivariante kodierte Aminosäuresequenz bildet vorzugsweise, wenn sie bei der Konstruktion eines Stammbaums verwendet wird, wie er in der 18 gezeigt ist, eher mit der Gruppe A oder B als mit einer anderen Gruppe Cluster, stärker bevorzugt mit der Gruppe A der GR-RBP-Polypeptide, umfassend die Aminosäuresequenz nach SEQ ID NO: 826.With respect to GR-RBP polypeptides, preferred splice variants are splice variants of a nucleic acid of SEQ ID NO: 826, or a splice variant of a nucleic acid encoding an orthologue or paralogue of SEQ ID NO: 827. The amino acid sequence encoded by the splice variant preferably forms when used in the construction of a pedigree as described in U.S. Pat 18 shown is more likely to cluster with group A or B than with another group, more preferably with group A of the GR-RBP polypeptides comprising the amino acid sequence of SEQ ID NO: 826.

Eine weitere Nukleinsäurevariante, die sich bei der Durchführung der erfindungsgemäßen Verfahren eignet ist eine allelische Variante einer Nukleinsäure, die ein C3H-ähnliches Polypeptid, oder ein SPT-Polypeptid oder ein IDI2-Polypeptid oder eine eIF4F-ähnliche Proteinkomplex-Untereinheit oder ein GR-RBP-Polypeptid wie vorstehend definiert kodiert, wobei eine allelische Variante die hier definierte Bedeutung hat.Another nucleic acid variant useful in performing the methods of the invention is an allelic variant of a nucleic acid encoding a C3H-like polypeptide, or an SPT polypeptide or an IDI2 polypeptide or an eIF4F-like protein complex subunit, or a GR-RBP Polypeptide as defined above, wherein an allelic variant has the meaning defined herein.

Erfindungsgemäß wird ein Verfahren zur Verbesserung der Ertragsmerkmale bei Pflanzen bereitgestellt, bei dem man in eine(r) Pflanze eine allelische Variante von einer der in den Tabellen A1 bis A5 des Beispielteils angegebenen Nukleinsäuren einführt und exprimiert, oder bei dem man in eine(r) Pflanze eine allelische Variante einer Nukleinsäure, die ein Orthologon, Paralogon oder Homologon von der in den Tabellen A1 bis A5 des Beispielteils angegebenen Aminosäuresequenzen kodiert, einführt und exprimiert.According to the invention, a method is provided for improving the yield-related traits in plants by introducing and expressing in an isolated plant an allelic variant of one of the nucleic acids specified in Tables A1 to A5 of the Examples section, or in which Plant an allelic variant of a nucleic acid which encodes, introduces and expresses an orthologue, paralogue or homologue of the amino acid sequences given in Tables A1 to A5 of the Examples section.

In Bezug auf C3H-ähnliche Polypeptide, haben die Polypeptide, die durch Allelvarianten kodiert werden, die sich in den erfindungsgemäßen Verfahren eignen, im Wesentlichen die gleiche biologische Aktivität wie das C3H-ähnliche Polypeptid nach SEQ ID NO: 2 und eine der in Tabelle A1 des Beispielteils angegebenen Aminosäuren. Allelvarianten kommen in der Natur vor, und in den erfindungsgemäßen Verfahren ist die Verwendung dieser natürlichen Allele umfasst. Bei der Allelvariante handelt es sich vorzugsweise um eine Allelvariante nach SEQ ID NO: 1 oder um eine Allelvariante einer Nukleinsäure, die ein Orthologon oder Paralogon nach SEQ ID NO: 2 kodiert. Die von der Allelvariante kodierte Aminosäuresequenz bildet vorzugsweise bei der Verwendung bei der Konstruktion eines Stammbaums, wie er in der 2 gezeigt ist, eher mit den C3H-ähnlichen Polypeptiden, umfassend die Aminosäuresequenz nach SEQ ID NO: 2 Cluster als mit einer anderen Gruppe.With respect to C3H-like polypeptides, the polypeptides encoded by allelic variants useful in the methods of the present invention have substantially the same biological activity as the C3H-like polypeptide of SEQ ID NO: 2 and one of those listed in Table A1 of the example part specified amino acids. Allelic variants occur in nature, and the methods of the invention include the use of these natural alleles. The allelic variant is preferably an allelic variant according to SEQ ID NO: 1 or an allelic variant of a nucleic acid which encodes an orthologue or paralogon of SEQ ID NO: 2. The amino acid sequence encoded by the allelic variant preferably forms when used in the construction of a pedigree as described in U.S. Pat 2 shown with the C3H-like polypeptides comprising the amino acid sequence of SEQ ID NO: 2 clusters rather than with another group.

In Bezug auf SPT-Polypeptide, haben die Polypeptide, die durch Allelvarianten kodiert werden, die sich in den erfindungsgemäßen Verfahren eignen, im Wesentlichen die gleiche biologische Aktivität wie das SPT-ähnliche Polypeptid nach SEQ ID NO: 97 und eine der in Tabelle A2 des Beispielteils angegebenen Aminosäuren. Allelvarianten kommen in der Natur vor, und in den erfindungsgemäßen Verfahren ist die Verwendung dieser natürlichen Allele umfasst. Bei der Allelvariante handelt es sich vorzugsweise um eine Allelvariante nach SEQ ID NO: 96 oder um eine Allelvariante einer Nukleinsäure, die ein Orthologon oder Paralogon nach SEQ ID NO: 97 kodiert. Die von der Allelvariante kodierte Aminosäuresequenz bildet vorzugsweise bei der Verwendung bei der Konstruktion eines Stammbaums, wie er in der 5 gezeigt ist, eher mit den SPT-ähnlichen Polypeptiden, umfassend die Aminosäuresequenz nach SEQ ID NO: 97 Cluster als mit einer anderen Gruppe.With respect to SPT polypeptides, the polypeptides encoded by allelic variants useful in the methods of the present invention have substantially the same biological activity as the SPT-like polypeptide of SEQ ID NO: 97 and one of those listed in Table A2 of the Example part given amino acids. Allelic variants occur in nature, and the methods of the invention include the use of these natural alleles. The allelic variant is preferably an allelic variant according to SEQ ID NO: 96 or an allelic variant of a nucleic acid which encodes an orthologue or paralogon according to SEQ ID NO: 97. The amino acid sequence encoded by the allelic variant preferably forms when used in the construction of a pedigree as described in U.S. Pat 5 is shown, rather with the SPT-like polypeptides comprising the amino acid sequence of SEQ ID NO: 97 clusters than with another group.

In Bezug auf IDI2-Polypeptide, haben die Polypeptide, die durch Allelvarianten kodiert werden, die sich in den erfindungsgemäßen Verfahren eignen, im Wesentlichen die gleiche biologische Aktivität wie das IDI2-Polypeptid nach SEQ ID NO: 140 und eine der in Tabelle A3 des Beispielteils angegebenen Aminosäuren. Allelvarianten kommen in der Natur vor, und in den erfindungsgemäßen Verfahren ist die Verwendung dieser natürlichen Allele umfasst. Bei der Allelvariante handelt es sich vorzugsweise um eine Allelvariante nach SEQ ID NO: 139 oder um eine Allelvariante einer Nukleinsäure, die ein Orthologon oder Paralogon nach SEQ ID NO: 140 kodiert. Die von der Allelvariante kodierte Aminosäuresequenz bildet vorzugsweise bei der Verwendung bei der Konstruktion eines Stammbaums, wie er in der 3 gezeigt ist, eher mit der Gruppe A oder B Cluster als mit einer anderen Gruppe, stärker bevorzugt bildet die Polypeptid-Sequenz mit der Gruppe A der IDI2-Polypeptide, umfassend die Aminosäuresequenz nach SEQ ID NO: 140 Cluster.With respect to IDI2 polypeptides, the polypeptides encoded by allelic variants useful in the methods of the present invention have substantially the same biological activity as the IDI2 polypeptide of SEQ ID NO: 140 and one of those listed in Table A3 of the Examples section indicated amino acids. Allelic variants occur in nature, and the methods of the invention include the use of these natural alleles. The allelic variant is preferably an allelic variant according to SEQ ID NO: 139 or an allelic variant of a nucleic acid which encodes an orthologue or paralogon according to SEQ ID NO: 140. The amino acid sequence encoded by the allelic variant preferably forms when used in the construction of a pedigree as described in U.S. Pat 3 More preferably, the group A polypeptide sequence of the IDI2 polypeptides, comprising the amino acid sequence of SEQ ID NO: 140, forms clusters with group A or B cluster rather than another group.

In Bezug auf eIF4F-ähnliche Proteinkomplex-Untereinheiten, haben die Polypeptide, die durch Allelvarianten kodiert werden, die sich in den erfindungsgemäßen Verfahren eignen, im Wesentlichen die gleiche biologische Aktivität wie die eIF4F-ähnlichen Proteinkomplex-Untereinheiten nach einer der Sequenzen nach SEQ ID NO: 241, SEQ ID NO: 301 oder SEQ ID NO: 561 und eine der in Tabelle A4 des Beispielteils angegebenen Aminosäuren. Allelvarianten kommen in der Natur vor, und in den erfindungsgemäßen Verfahren ist die Verwendung dieser natürlichen Allele umfasst. Bei der Allelvariante handelt es sich vorzugsweise um eine Allelvariante nach SEQ ID NO: 240, SEQ ID NO: 300 und/oder SEQ ID NO: 560 oder um eine Allelvariante einer Nukleinsäure, die ein Orthologon oder Paralogon nach SEQ ID NO: 241, SEQ ID NO: 301 und/oder SEQ ID NO: 561 kodiert. Die von der Allelvariante kodierte Aminosäuresequenz bildet vorzugsweise bei der Verwendung bei der Konstruktion eines Stammbaums, wie er in den 12, 13 und/oder 14 gezeigt ist, eher mit den eIF4F-ähnlichen Proteinkomplex-Untereinheiten, wie eIF4isoG/G, eIF4A oder eIF4F/isoE, umfassend die Aminosäuresequenz nach SEQ ID NO: 241 Cluster als mit einer anderen Gruppe.With respect to eIF4F-like protein complex subunits, the polypeptides encoded by allelic variants useful in the methods of the present invention have substantially the same biological activity as the eIF4F-like protein complex subunits of any of the sequences of SEQ ID NO : 241, SEQ ID NO: 301 or SEQ ID NO: 561 and one of the amino acids given in Table A4 of the Example section. Allelic variants occur in nature, and the methods of the invention include the use of these natural alleles. The allelic variant is preferably an allelic variant according to SEQ ID NO: 240, SEQ ID NO: 300 and / or SEQ ID NO: 560 or an allelic variant of a nucleic acid which is an orthologue or paralogue according to SEQ ID NO: 241, SEQ ID NO: 301 and / or SEQ ID NO: 561. The amino acid sequence encoded by the allelic variant preferably forms when used in the construction of a pedigree as described in U.S. Pat 12 . 13 and or 14 rather, with the eIF4F-like protein complex subunits, such as eIF4isoG / G, eIF4A or eIF4F / isoE, comprising the amino acid sequence of SEQ ID NO: 241 cluster rather than another group.

In Bezug auf GR-RBP-Polypeptide, haben die Polypeptide, die durch Allelvarianten kodiert werden, die sich in den erfindungsgemäßen Verfahren eignen, im Wesentlichen die gleiche biologische Aktivität wie das GR-RBP-Polypeptid nach SEQ ID NO: 827 und eine der in Tabelle A5 des Beispielteils angegebenen Aminosäuren. Allelvarianten kommen in der Natur vor, und in den erfindungsgemäßen Verfahren ist die Verwendung dieser natürlichen Allele umfasst. Bei der Allelvariante handelt es sich vorzugsweise um eine Allelvariante nach SEQ ID NO: 826 oder um eine Allelvariante einer Nukleinsäure, die ein Orthologon oder Paralogon nach SEQ ID NO: 827 kodiert. Die von der Allelvariante kodierte Aminosäuresequenz bildet vorzugsweise bei der Verwendung bei der Konstruktion eines Stammbaums, wie er in der 3 gezeigt ist, eher mit der Gruppe A oder B Cluster als mit einer anderen Gruppe, stärker bevorzugt mit der Gruppe A der GR-RBP-Polypeptide, umfassend die Aminosäuresequenz nach SEQ ID NO: 827 Cluster. With respect to GR-RBP polypeptides, the polypeptides encoded by allelic variants useful in the methods of the invention have substantially the same biological activity as the GR-RBP polypeptide of SEQ ID NO: 827 and any of those described in U.S. Pat Table A5 of the example part specified amino acids. Allelic variants occur in nature, and the methods of the invention include the use of these natural alleles. The allelic variant is preferably an allelic variant according to SEQ ID NO: 826 or an allelic variant of a nucleic acid which encodes an orthologue or paralogon according to SEQ ID NO: 827. The amino acid sequence encoded by the allelic variant preferably forms when used in the construction of a pedigree as described in U.S. Pat 3 cluster, rather than group A, more preferably group A of GR-RBP polypeptides comprising the amino acid sequence of SEQ ID NO: 827 cluster.

Gen-Shuffling oder gerichtete Evolution können ebenfalls eingesetzt werden, um Varianten von Nukleinsäuren, die C3H-ähnliche Polypeptide, oder SPT-Polypeptide oder IDI2-Polypeptide oder eIF4F-ähnliche Proteinkomplex-Untereinheiten oder GR-RBP-Polypeptide wie oben definiert kodieren, zu erzeugen, wobei der Begriff ”Gen-Shuffling” die vorstehend definierte Bedeutung hat.Gene shuffling or directed evolution may also be employed to generate variants of nucleic acids encoding C3H-like polypeptides, or SPT polypeptides or IDI2 polypeptides or eIF4F-like protein complex subunits or GR-RBP polypeptides as defined above , wherein the term "gene shuffling" has the meaning defined above.

Gemäß der vorliegenden Erfindung wird ein Verfahren zur Verbesserung von Ertragsmerkmalen, in Pflanzen bereitgestellt, bei dem man in eine(r) Pflanze eine Variante von einer der in den Tabellen A1 bis A5 des Beispielteils angegebenen Nukleinsäuresequenzen einführt und exprimiert, oder bei dem man in eine(r) Pflanze eine Variante einer Nukleinsäuresequenz, die ein Orthologon, Paralogon oder Homologon von einer der in den Tabellen A1 bis A5 des Beispielteils angegebenen Aminosäuresequenzen kodiert, wobei diese Nukleinsäurevariante durch Gen-Shuffling erhalten wurde, einführt und exprimiert.According to the present invention, there is provided a process for improving yield-related traits in plants, comprising introducing into a plant a variant of one of the nucleic acid sequences given in Tables A1 to A5 of the Examples section and expressing it (r) plant a variant of a nucleic acid sequence which encodes an orthologue, paralogue or homologue of one of the amino acid sequences given in Tables A1 to A5 of the Examples, this nucleic acid variant was obtained by gene shuffling, introduced and expressed.

In Bezug auf C3H-ähnliche Polypeptide, bildet vorzugsweise die Aminosäuresequenz, die von der durch Gen-Shuffling erhaltenen varianten Nukleinsäure kodiert wird, bei der Verwendung bei der Konstruktion eines Stammbaums, wie er in der 2 gezeigt ist, eher mit der Gruppe der C3H-ähnlichen Polypeptide, umfassend die Aminosäuresequenz nach SEQ ID NO: 2 Cluster als mit einer anderen Gruppe.With respect to C3H-like polypeptides, preferably, the amino acid sequence encoded by the variant nucleic acid obtained by gene shuffling forms when used in the construction of a pedigree such as that described in U.S. Pat 2 shown more with the group of C3H-like polypeptides comprising the amino acid sequence of SEQ ID NO: 2 cluster than with another group.

In Bezug auf SPT-Polypeptide, bildet vorzugsweise die Aminosäuresequenz, die von der durch Gen-Shuffling erhaltenen varianten Nukleinsäure kodiert wird, bei der Verwendung bei der Konstruktion eines Stammbaums, wie er in der 5 gezeigt ist, eher mit der Gruppe der SPT-ähnlichen Polypeptide, umfassend die Aminosäuresequenz nach SEQ ID NO: 97 Cluster als mit einer anderen Gruppe.With respect to SPT polypeptides, preferably, the amino acid sequence encoded by the variant nucleic acid obtained by gene shuffling forms when used in the construction of a pedigree as described in U.S. Pat 5 shown more with the group of SPT-like polypeptides comprising the amino acid sequence of SEQ ID NO: 97 cluster than with another group.

In Bezug auf IDI2-Polypeptide, bildet vorzugsweise die Aminosäuresequenz, die von der durch Gen-Shuffling erhaltenen varianten Nukleinsäure kodiert wird, bei der Verwendung bei der Konstruktion eines Stammbaums, wie er in der 9 gezeigt ist, eher mit der Gruppe A oder B als mit einer anderen Gruppe Cluster, stärker bevorzugt bildet die Polypeptid-Sequenz mit der Gruppe A der IDI2-Polypeptide, umfassend die Aminosäuresequenz nach SEQ ID NO: 140 Cluster.With respect to IDI2 polypeptides, preferably, the amino acid sequence encoded by the variant nucleic acid obtained by gene shuffling forms when used in the construction of a pedigree as described in U.S. Patent Nos. 5,243,646; 9 More preferably, the group A polypeptide sequence of the IDI2 polypeptides comprising the amino acid sequence of SEQ ID NO: 140 cluster is shown to be clustered with group A or B rather than another group.

In Bezug auf eIF4F-ähnliche Proteinkomplex-Untereinheiten Polypeptide, bildet vorzugsweise die Aminosäuresequenz, die von der durch Gen-Shuffling erhaltenen varianten Nukleinsäure kodiert wird, bei der Verwendung bei der Konstruktion eines Stammbaums, wie er in den 12, 13 und/oder 14 gezeigt ist Cluster mit der Gruppe der eIF4F-ähnlichen Proteinkomplex-Untereinheiten, umfassend die Aminosäuresequenz nach SEQ ID NO: 241, SEQ ID NO: 310 und/oder SEQ ID NO: 561, und bildet am stärksten bevorzugt eher mit der Gruppe der eIF4F-ähnlichen Proteinkomplex-Untereinheiten, umfassend die Aminosäuresequenz nach SEQ ID NO: 241, Cluster als mit einer anderen Gruppe.With respect to eIF4F-like protein complex subunit polypeptides, preferably, the amino acid sequence encoded by the variant nucleic acid obtained by gene shuffling, when used in the construction of a pedigree as described in U.S. Patent Nos. 4,236,646 and 4,200,237 12 . 13 and or 14 shown cluster with the group of eIF4F-like protein complex subunits, comprising the amino acid sequence of SEQ ID NO: 241, SEQ ID NO: 310 and / or SEQ ID NO: 561, and most preferably forms with the group of eIF4F- Similar protein complex subunits comprising the amino acid sequence of SEQ ID NO: 241, clusters as with another group.

In Bezug auf GR-RBP-Polypeptide, bildet vorzugsweise die Aminosäuresequenz, die von der durch Gen-Shuffling erhaltenen varianten Nukleinsäure kodiert wird, bei der Verwendung bei der Konstruktion eines Stammbaums, wie er in der 18 gezeigt ist, eher mit der Gruppe A oder B als mit einer anderen Gruppe Cluster, stärker bevorzugt mit der Gruppe A der GR-RBP-Polypeptide, umfassend die Aminosäuresequenz nach SEQ ID NO: 827 Cluster.With respect to GR-RBP polypeptides, preferably, the amino acid sequence encoded by the variant nucleic acid obtained by gene shuffling forms when used in the construction of a pedigree as described in U.S. Pat 18 cluster, more preferably group A of GR-RBP polypeptides, comprising the amino acid sequence of SEQ ID NO: 827 cluster.

Darüber hinaus können Nukleinsäurevarianten auch durch ortsgerichtete Mutagenese erhalten werden. Es gibt verschiedene Verfahren zur Erzielung von ortsgerichteter Mutagenese, wobei die üblichsten Verfahren auf PCR-Basis sind (Current Protocols in Molecular Biology. Wiley Eds.).In addition, nucleic acid variants can also be obtained by site-directed mutagenesis. There are several methods for obtaining site-directed mutagenesis, the most common being PCR-based methods (Current Protocols in Molecular Biology, Wiley Eds.).

Nukleinsäuresequenzen, die C3H-ähnliche Polypeptide kodieren, können von einer beliebigen natürlichen oder künstlichen Quelle stammen. Die Nukleinsäuresequenz kann aus ihrer nativen Form in ihrer Zusammensetzung und/oder genomischen Umgebung durch gezielten menschlichen Eingriff modifiziert werden. Die das C3H-ähnliche Polypeptid kodierende Nukleinsäure stammt vorzugsweise aus einer Pflanze, vorzugsweise aus der Familie Medicago, am stärksten bevorzugt stammt die Nukleinsäure aus Medicago truncatula.Nucleic acid sequences encoding C3H-like polypeptides can be from any natural or artificial source. The nucleic acid sequence can be modified from its native form in its composition and / or genomic environment by targeted human intervention. The the C3H-like polypeptide-encoding nucleic acid is preferably from a plant, preferably from the Medicago family, most preferably the nucleic acid is from Medicago truncatula.

Nukleinsäuresequenzen, die SPT-ähnliche Polypeptide kodieren, können von einer beliebigen natürlichen oder künstlichen Quelle stammen. Die Nukleinsäuresequenz kann aus ihrer nativen Form in ihrer Zusammensetzung und/oder genomischen Umgebung durch gezielten menschlichen Eingriff modifiziert werden. Die das SPT-ähnliche Polypeptid kodierende Nukleinsäure stammt vorzugsweise aus einer Pflanze, vorzugsweise aus der Familie Salicaceae, vorzugsweise aus der Gattung Populus, am stärksten bevorzugt stammt die Nukleinsäure aus Populus trichocarpa.Nucleic acid sequences encoding SPT-like polypeptides can be from any natural or artificial source. The nucleic acid sequence can be modified from its native form in its composition and / or genomic environment by targeted human intervention. Preferably, the SPT-like polypeptide-encoding nucleic acid is from a plant, preferably from the family Salicaceae, preferably from the genus Populus, most preferably the nucleic acid is from Populus trichocarpa.

Nukleinsäuresequenzen, die IDI2-Polypeptide kodieren, können von einer beliebigen natürlichen oder künstlichen Quelle stammen. Die Nukleinsäuresequenz kann aus ihrer nativen Form in ihrer Zusammensetzung und/oder genomischen Umgebung durch gezielten menschlichen Eingriff modifiziert werden. Die das IDI2-Polypeptid kodierende Nukleinsäure stammt vorzugsweise aus einer monokotyledonen Pflanze, vorzugsweise aus der Familie Poaceae, am stärksten bevorzugt stammt die Nukleinsäure aus Saccharum officinarum.Nucleic acid sequences encoding IDI2 polypeptides can be from any natural or artificial source. The nucleic acid sequence can be modified from its native form in its composition and / or genomic environment by targeted human intervention. Preferably, the IDI2 polypeptide-encoding nucleic acid is from a monocotyledonous plant, preferably from the family Poaceae, most preferably the nucleic acid is from Saccharum officinarum.

Nukleinsäuresequenzen, die eIF4F-ähnliche Proteinkomplex-Untereinheiten kodieren, können von einer beliebigen natürlichen oder künstlichen Quelle stammen. Die Nukleinsäuresequenz kann aus ihrer nativen Form in ihrer Zusammensetzung und/oder genomischen Umgebung durch gezielten menschlichen Eingriff modifiziert werden. Die die eIF4F-ähnlichen Proteinkomplex-Untereinheiten kodierende Nukleinsäuren stammt vorzugsweise aus einer monokotyledonen Pflanze, vorzugsweise aus der Familie Poaceae, am stärksten bevorzugt stammt die Nukleinsäure aus Oryza sativa.Nucleic acid sequences encoding eIF4F-like protein complex subunits can be from any natural or artificial source. The nucleic acid sequence can be modified from its native form in its composition and / or genomic environment by targeted human intervention. The nucleic acids encoding the eIF4F-like protein complex subunits preferably originate from a monocotyledonous plant, preferably from the family Poaceae, most preferably the nucleic acid is from Oryza sativa.

Nukleinsäuresequenzen, die GR-RBP-Polypeptide kodieren, können von einer beliebigen natürlichen oder künstlichen Quelle stammen. Die Nukleinsäuresequenz kann aus ihrer nativen Form in ihrer Zusammensetzung und/oder genomischen Umgebung durch gezielten menschlichen Eingriff modifiziert werden. Die das GR-RBP-Polypeptid kodierende Nukleinsäure stammt vorzugsweise aus einer monokotyledonen Pflanze, vorzugsweise aus der Familie Poaceae, am stärksten bevorzugt stammt die Nukleinsäure aus Oryza sativa.Nucleic acid sequences encoding GR-RBP polypeptides can be from any natural or artificial source. The nucleic acid sequence can be modified from its native form in its composition and / or genomic environment by targeted human intervention. Preferably, the GR-RBP polypeptide-encoding nucleic acid is from a monocotyledonous plant, preferably from the family Poaceae, most preferably the nucleic acid is from Oryza sativa.

In Bezug auf C3H-ähnliche Polypeptide oder SPT-Polypeptide oder eIF4F-ähnliche Proteinkomplex-Untereinheiten ergibt die Durchführung der erfindungsgemäßen Verfahren Pflanzen mit verbesserten Ertragsmerkmalen. Die Durchführung der erfindungsgemäßen Verfahren ergibt insbesondere Pflanzen mit verbessertem Ertrag, insbesondere verbessertem Samenertrag im Vergleich zu Kontrollpflanzen. Die Begriffe ”Ertrag” und ”Samenertrag” sind eingehender im Abschnitt ”Definitionen” beschrieben.With respect to C3H-like polypeptides or SPT polypeptides or eIF4F-like protein complex subunits, performance of the methods of the invention provides plants having improved yield-related traits. The implementation of the method according to the invention gives in particular plants with improved yield, in particular improved seed yield in comparison to control plants. The terms "yield" and "seed yield" are described in more detail in the "Definitions" section.

In Bezug auf IDI2-Polypeptide oder GR-RBP-Polypeptide ergibt die Durchführung der erfindungsgemäßen Verfahren Pflanzen mit verbesserten Ertragsmerkmalen. Insbesondere ergibt die Durchführung der erfindungsgemäßen Verfahren Pflanzen mit verbessertem Ertrag, insbesondere verbessertem Samenertrag, erhöhter Biomasse und/oder verbesserter Jungpflanzenvitalität im Vergleich zu Kontrollpflanzen. Die Begriffe ”Ertrag” und ”Samenertrag” und ”Jungpflanzenvitalität” sind im vorliegenden Text im Abschnitt ”Definitionen” genauer beschrieben.With respect to IDI2 polypeptides or GR-RBP polypeptides, performance of the methods of the present invention provides plants having improved yield-related traits. In particular, performance of the methods of the invention gives plants with improved yield, in particular improved seed yield, increased biomass and / or improved early vigor in comparison to control plants. The terms "yield" and "seed yield" and "seedling vitality" are described in greater detail herein in the "Definitions" section.

Werden in Bezug auf C3H-ähnliche Polypeptide, SPT-Polypeptide oder eIF4F-ähnliche Proteinkomplex-Untereinheiten hier verbesserte Ertragsmerkmale erwähnt, soll dies eine Erhöhung der Biomasse (Gewicht) von einem oder mehreren Teilen einer Pflanze bedeuten, was oberirdische (erntefähige) Teile und/oder unterirdische (erntefähige) Teile beinhalten kann. Insbesondere sind solche erntefähige Teile Samen, und die Durchführung der erfindungsgemäßen Verfahren führt zu Pflanzen mit verbessertem Samenertrag in Bezug auf den Samenertrag von Kontrollpflanzen.When reference is made herein to improved yield-related traits with respect to C3H-like polypeptides, SPT polypeptides or eIF4F-like protein complex subunits, this is intended to increase the biomass (weight) of one or more parts of a plant, including aboveground (harvestable) parts and / or or subterranean (harvestable) parts. In particular, such harvestable parts are seeds, and performance of the methods of the invention results in plants having improved seed yield relative to the seed yield of control plants.

Werden in Bezug auf IDI2-Polypeptide hier verbesserte Ertragsmerkmale erwähnt, soll dies eine Erhöhung der Biomasse (Gewicht) von einem oder mehreren Teilen einer Pflanze bedeuten, was oberirdische (erntefähige) Teile und/oder unterirdische (erntefähige) Teile beinhalten kann. Insbesondere sind solche erntefähige Teile Samen, oberirdische Biomasse und/oder Wurzeln, und die Durchführung der erfindungsgemäßen Verfahren führt zu Pflanzen mit verbesserter Jungpflanzenvitalität, gesteigertem Samenertrag und/oder gesteigerter Biomasse in Bezug auf Kontrollpflanzen.Improved yield-related traits for IDI2 polypeptides herein are meant to increase the biomass (weight) of one or more parts of a plant, which may include aboveground (harvestable) parts and / or subterranean (harvestable) parts. In particular, such harvestable parts are seeds, above-ground biomass, and / or roots, and performance of the methods of the invention results in plants having improved early vigor, increased seed yield, and / or increased biomass relative to control plants.

Werden in Bezug auf GR-RBP-Polypeptide hier verbesserte Ertragsmerkmale erwähnt, soll dies eine Erhöhung der Biomasse (Gewicht) von einem oder mehreren Teilen einer Pflanze bedeuten, was oberirdische (erntefähige) Teile und/oder unterirdische (erntefähige) Teile beinhalten kann. Insbesondere sind solche erntefähige Teile Samen und/oder Wurzeln, und die Durchführung der erfindungsgemäßen Verfahren führt zu Pflanzen mit verbessertem Samenertrag in Bezug auf den Samenertrag von Kontrollpflanzen und/oder verstärktes Wurzelwachstum im Vergleich zu Kontrollpflanzen.When reference is made to improved yield-related traits with respect to GR-RBP polypeptides, this is intended to increase the biomass (weight) of one or more parts of a plant, which may include aboveground (harvestable) parts and / or subterranean (harvestable) parts. In particular, such harvestable parts are seeds and / or roots, and performance of the methods of the invention results Plants with improved seed yield in terms of seed yield of control plants and / or increased root growth compared to control plants.

Wählt man Mais als Beispiel, kann sich eine Ertragserhöhung unter anderem als eines oder mehrere der folgenden Merkmale äußern: Erhöhte Anzahl Pflanzen, die sich pro m² entwickeln, Erhöhung der Anzahl Ähren pro Pflanze, Erhöhung der Anzahl Reihen, der Anzahl Körner pro Reihe, des Korngewichts, Tausendkorngewichts, Ährenlänge/-durchmessers, Erhöhung der Samenfüllungsrate (Anzahl gefüllter Samen dividiert durch die Gesamtzahl Samen und multipliziert mit Hundert).If one chooses corn as an example, an increase in yield may, among other things, be expressed as one or more of the following: increased numbers of plants developing per m ² , increasing the number of ears per plant, increasing the number of rows, the number of grains per row, of grain weight, thousand kernel weight, ear length / diameter, increase in seed filling rate (number of filled seeds divided by the total number of seeds and multiplied by one hundred).

Wählt man Reis als Beispiel, kann sich eine Ertragserhöhung unter anderem als Erhöhung von einem oder mehreren der folgenden Merkmale ausdrücken: Anzahl Pflanzen pro m², Anzahl Rispen pro Pflanze, Rispenlänge, Anzahl Ährchen pro Rispe, Anzahl Blüten (Einzelblüten) pro Rispe (ausgedrückt als Verhältnis der Anzahl der gefüllten Samen zu der Anzahl der Primärrispen), erhöhte Samenfüllungsrate (Anzahl gefüllter Samen dividiert durch die Gesamtzahl Samen und multipliziert mit Hundert), erhöhtes Tausendkorngewicht. In Reis kann die Toleranz gegenüber Untertauchen auch einen verbesserten Ertrag ergeben.By taking rice as an example, an increase in yield can be expressed inter alia as an increase of one or more of the following characteristics: number of plants per m ² , number of panicles per plant, panicle length, number of spikelets per panicle, number of flowers (single flowers) per panicle (expressed increased seed fill rate (number of filled seeds divided by the total number of seeds and multiplied by one hundred), increased thousand kernel weight, as a ratio of the number of filled seeds to the number of primary panicles). In rice tolerance to submersion can also provide improved yield.

Die vorliegende Erfindung stellt ein Verfahren zur Erhöhung des Ertrags, insbesondere Samenertrags von Pflanzen im Vergleich zu Kontrollpflanzen bereit, wobei man bei dem Verfahren in einer Pflanze die Expression einer Nukleinsäure, die ein C3H-ähnliches Polypeptid oder ein SPT-ähnliches Polypeptid oder ein IDI2-Polypeptid wie im vorliegenden Text definiert kodiert, moduliert.The present invention provides a method for increasing the yield, in particular seed yield, of plants in comparison to control plants, wherein in the method in a plant the expression of a nucleic acid comprising a C3H-like polypeptide or an SPT-like polypeptide or an IDI2- Polypeptide as defined herein, modulated.

Die vorliegende Erfindung stellt auch ein Verfahren zur Erhöhung des Ertrags, insbesondere Samenertrags von Pflanzen im Vergleich zu Kontrollpflanzen bereit, wobei man bei dem Verfahren in einer Pflanze die Aktivität eines eIF4F-ähnlichen. Proteinkomplexes moduliert, indem man die Expression von mindestens einer seiner Polypeptid-Untereinheiten-kodierenden Nukleinsäuren wie im vorliegenden Text definiert kodiert, moduliert.The present invention also provides a method for increasing the yield, in particular seed yield of plants compared to control plants, wherein in the method in a plant, the activity of an eIF4F-like. Protein complex is modulated by modulating the expression of at least one of its polypeptide subunit-encoding nucleic acids as defined herein.

Die vorliegende Erfindung stellt auch ein Verfahren zur Erhöhung des Ertrags, insbesondere Samenertrags und/oder Wurzelertrags von Pflanzen im Vergleich zu Kontrollpflanzen bereit, wobei man bei dem Verfahren in einer Pflanze die Expression einer Nukleinsäure, die ein GR-RBP Polypeptid kodiert, moduliert.The present invention also provides a method for increasing the yield, in particular seed yield and / or root yield of plants relative to control plants, wherein the method in a plant modulates the expression of a nucleic acid encoding a GR-RBP polypeptide.

Da die erfindungsgemäßen transgenen Pflanzen verbesserten Ertrag aufweisen, zeigen diese Pflanzen (zumindest während eines Teils ihres Lebenszyklus) wahrscheinlich eine im Vergleich zu der Wachstumsrate von Kontrollpflanzen in einem entsprechenden Stadium ihres Lebenszyklus erhöhte Wachstumsrate.Because the transgenic plants of the present invention have improved yield, these plants (at least for part of their life cycle) are likely to show an increased rate of growth compared to the growth rate of control plants at a corresponding stage of their life cycle.

Die erhöhte Wachstumsrate kann für einen oder mehrere Teile einer Pflanze (einschließlich Samen) spezifisch sein oder kann im Wesentlichen in der ganzen Pflanze stattfinden. Pflanzen mit einer erhöhten Wachstumsrate können einen kürzeren Lebenszyklus aufweisen. Unter dem Lebenszyklus einer Pflanze kann man diejenige Zeit verstehen, die die Pflanze braucht, um von einem reifen trockenen Samen bis zu dem Stadium heranzuwachsen, in dem die Pflanze reife trockene Samen ähnlich dem Ausgangsmaterial produziert hat. Dieser Lebenszyklus kann von Faktoren wie Keimungsgeschwindigkeit, Jungpflanzenvitalität, Wachstumsrate, Greenness Index, Blütezeit und Geschwindigkeit der Samenreifung beeinflusst werden. Die erhöhte Wachstumsrate kann in einem Stadium oder in mehreren Stadien im Lebenszyklus einer Pflanze oder im Wesentlichen während des gesamten Lebenszyklus der Pflanze stattfinden. Eine erhöhte Wachstumsrate während der Frühstadien im Lebenszyklus einer Pflanze kann verbesserte Jungpflanzen-Vitalität widerspiegeln. Die erhöhte Wachstumsrate kann den Erntezyklus einer Pflanze verändern, so dass die Pflanzen später gesät werden können und/oder früher geerntet werden können, als dies sonst möglich wäre (ein ähnlicher Effekt lässt sich mit einer früheren Blütezeit erzielen). Ist die Wachstumsrate ausreichend erhöht, kann dies ein weiteres Aussäen von Samen derselben Pflanzenart ermöglichen (zum Beispiel Aussäen und Ernten von Reispflanzen und anschließendes Aussäen und Ernten von weiteren Reispflanzen innerhalb einer traditionellen Wachstumsperiode). Entsprechend kann dies bei ausreichender Steigerung der Wachstumsrate ein weiteres Aussäen von Samen von unterschiedlichen Pflanzenarten ermöglichen (zum Beispiel das Aussäen und Ernten von Maispflanzen und anschließendes z. B. Aussäen und gegebenenfalls Ernten von Sojabohnen, Kartoffeln oder sonstigen geeigneten Pflanzen). Bei manchen Kulturpflanzen kann man auch zusätzlich mehrmals von demselben Wurzelstock ernten. Eine Veränderung des Erntezyklus einer Pflanze kann zu einer Erhöhung der jährlichen Biomasseproduktion pro m² führen (und zwar aufgrund einer Erhöhung der Häufigkeit (z. B. pro Jahr), mit der eine bestimmte Pflanze herangezogen und geerntet werden kann). Eine erhöhte Wachstumsrate kann auch den Anbau von transgenen Pflanzen in einem weiteren geographischen Bereich als ihre Wildtyp-Gegenstücke ermöglichen, da die räumlichen Begrenzungen für den Anbau einer Kulturpflanze häufig von ungünstigen Umweltbedingungen entweder während der Pflanzzeit (früh in der Saison) oder während der Erntezeit (spät in der Saison) bestimmt wird. Solche ungünstigen Bedingungen können vermieden werden, wenn der Erntezyklus verkürzt ist. Die Wachstumsrate kann durch Ableiten von verschiedenen Parametern von Wachstumskurven bestimmt werden, wobei die Parameter unter anderem folgendes sein können: T-Mid (Zeitdauer, die die Pflanzen benötigen, um 50% ihrer Maximalgröße zu erreichen) und T-90 (Zeitdauer, die die Pflanzen benötigen, um 90% ihrer Maximalgröße zu erreichen).The increased growth rate may be specific to one or more parts of a plant (including seeds) or may occur substantially throughout the plant. Plants with an increased growth rate may have a shorter life cycle. The life cycle of a plant can be understood as the time it takes for the plant to grow from a mature dry seed to the stage where the plant has produced mature dry seeds similar to the starting material. This life cycle can be influenced by factors such as germination rate, early vigor, growth rate, Greenness Index, flowering time and rate of seed maturation. The increased growth rate may occur at one stage or at several stages in the life cycle of a plant or substantially throughout the life cycle of the plant. An increased rate of growth during early stages of the life cycle of a plant may reflect improved seedling vitality. The increased growth rate may alter the harvest cycle of a plant so that the plants can later be sown and / or harvested earlier than would otherwise be possible (a similar effect can be achieved with an earlier flowering period). If the growth rate is sufficiently increased, this may allow further sowing of seeds of the same plant species (for example sowing and harvesting of rice plants and subsequent sowing and harvesting of further rice plants within a traditional growing season). Accordingly, with sufficient increase in the growth rate, this may allow further sowing of seeds from different plant species (for example, sowing and harvesting maize plants and then, for example, sowing and optionally harvesting soybeans, potatoes or other suitable plants). In some crops you can also harvest several times from the same rootstock. A change in the harvest cycle of a plant may increase annual biomass production per m ² (due to an increase in the frequency (eg per year) that a particular plant can be grown and harvested). An increased rate of growth may also allow the cultivation of transgenic plants in a wider geographical area than their wild-type counterparts, since the spatial limits for the cultivation of a crop often arise from unfavorable environmental conditions either during the planting season (early in the season) or during the harvest season ( late in the Season) is determined. Such unfavorable conditions can be avoided if the harvest cycle is shortened. The growth rate can be determined by deriving various parameters from growth curves, which parameters may include, but are not limited to, T-mid (the time it takes for the plants to reach 50% of their maximum size) and T-90 (the time that the plants require) Plants need to reach 90% of their maximum size).

In Bezug auf C3H-ähnliche Polypeptide, oder SPT-Polypeptide oder IDI2-Polypeptide oder GR-RBP-Polypeptide ergibt gemäß einem bevorzugten Merkmal der vorliegenden Erfindung die Durchführung der erfindungsgemäßen Verfahren Pflanzen mit einer im Vergleich zu Kontrollpflanzen erhöhten Wachstumsrate. Die vorliegende Erfindung stellt daher ein Verfahren zur Erhöhung der Wachstumsrate von Pflanzen bereit, wobei man bei dem Verfahren in einer Pflanze die Expression einer Nukleinsäure, die ein C3H-ähnliches Polypeptid, oder ein SPT-Polypeptid oder ein IDI2-Polypeptid oder eine eIF4F-ähnliche Proteinkomplex-Untereinheit oder ein GR-RBP-Polypeptid wie hier definiert kodiert, moduliert.With respect to C3H-like polypeptides, or SPT polypeptides or IDI2 polypeptides or GR-RBP polypeptides, in accordance with a preferred feature of the present invention, performance of the methods of the present invention yields plants with increased growth rate compared to control plants. The present invention therefore provides a method for increasing the growth rate of plants comprising, in the method in a plant, expression of a nucleic acid encoding a C3H-like polypeptide, or an SPT polypeptide or an IDI2 polypeptide or an eIF4F-like Protein complex subunit or a GR-RBP polypeptide as defined herein.

In Bezug auf eIF4F-ähnliche Proteinkomplex-Untereinheiten ergibt gemäß einem bevorzugten Merkmal der vorliegenden Erfindung die Durchführung der erfindungsgemäßen Verfahren Pflanzen mit einer im Vergleich zu Kontrollpflanzen erhöhten Wachstumsrate. Die vorliegende Erfindung stellt daher ein Verfahren zur Erhöhung der Wachstumsrate von Pflanzen bereit, wobei man bei dem Verfahren in einer Pflanze die Aktivität eines eIF4F-ähnlichen Proteinkomplexes moduliert, indem man mindestens eine Nukleinsäure, die ihre Polypeptid-Untereinheiten kodiert wie hier definiert moduliert und exprimiert.With respect to eIF4F-like protein complex subunits, in accordance with a preferred feature of the present invention, performance of the methods of the present invention yields plants with increased growth rate compared to control plants. The present invention therefore provides a method for increasing the growth rate of plants comprising modulating in a plant the activity of an eIF4F-like protein complex by modulating and expressing at least one nucleic acid encoding its polypeptide subunits as defined herein ,

Eine Erhöhung des Ertrags und/oder der Wachstumsrate tritt unabhängig davon auf, ob die Pflanze unter Nichtstressbedingungen steht oder ob die Pflanze im Vergleich zu Kontrollpflanzen verschiedenen Stressbedingungen unterworfen wird. Typischerweise reagieren Pflanzen auf Stress dadurch, dass sie langsamer wachsen. Unter starken Stressbedingungen kann die Pflanze sogar ihr Wachstum völlig einstellen. Leichter Stress ist dagegen hier als jeglicher Stress definiert, dem eine Pflanze ausgesetzt ist und der nicht dazu führt, dass die Pflanze völlig aufhört zu wachsen, ohne dass sie die Fähigkeit besitzt, ihr Wachstum wieder aufzunehmen. Leichter Stress im Sinne der Erfindung führt zu einer Verringerung des Wachstums der gestressten Pflanzen von weniger als 40%, 35%, 30% oder 25%, stärker bevorzugt weniger als 20% oder 15%, im Vergleich zu der Kontrollpflanze unter Nichtstressbedingungen. Aufgrund von Fortschritten bei den landwirtschaftlichen Praktiken (Bewässerung, Düngung, Pestizidbehandlungen) findet man bei angebauten Kulturpflanzen nicht oft starke Stressbedingungen. Daher ist das durch leichten Stress induzierte geschwächte Wachstum häufig ein unerwünschtes Merkmal in der Landwirtschaft. Leichte Stressbedingungen sind die alltäglichen biotischen und/oder abiotischen (Umwelt-)Stressbedingungen, denen eine Pflanze ausgesetzt ist. Abiotischer Stress kann durch Trockenheit oder Wasserüberschuss, anaeroben Stress, Salzstress, chemische Toxizität, oxidativen Stress und heiße, kalte oder Gefriertemperaturen verursacht werden. Bei dem abiotischen Stress kann es sich um einen osmotischen Stress handeln, der durch Wasserstress (insbesondere aufgrund von Trockenheit), Salzstress, oxidativen Stress oder ionenbedingten Stress verursacht wird. Unter biotischem Stress versteht man gewöhnlich Stressbedingungen, die durch Pathogene, wie Bakterien, Viren, Pilze, Nematoden und Insekten, verursacht werden. Der Begriff der ”Nichtstress”-Bedingungen wie hier verwendet, beinhaltet solche Umweltbedingungen, die ein optimales Wachstum der Pflanzen ermöglichen. Der Fachmann ist mit den normalen Boden- und Klimabedingungen für einen bestimmten Standort vertraut. Der Begriff der ”Nichtstress”-Bedingungen wie hier verwendet, beinhaltet gelegentliche oder alltägliche leichte Stressbedingungen, denen eine Pflanze wie hier definiert ausgesetzt ist, umfasst jedoch keine schweren Stressbedingungen.An increase in yield and / or growth rate occurs regardless of whether the plant is under non-stress conditions or whether the plant is subjected to different stress conditions compared to control plants. Typically, plants respond to stress by growing more slowly. Under severe stress conditions, the plant can even completely stop growing. Light stress, on the other hand, is defined here as any stress to which a plant is exposed and which does not cause the plant to completely stop growing without the ability to resume its growth. Light stress within the meaning of the invention results in a reduction in the growth of the stressed plants of less than 40%, 35%, 30% or 25%, more preferably less than 20% or 15%, compared to the control plant under non-stress conditions. Due to advances in agricultural practices (irrigation, fertilization, pesticide treatments) crops that are cultivated are not often subject to severe stress conditions. Therefore, the mild stress-induced debilitated growth is often an undesirable feature in agriculture. Light stress conditions are the everyday biotic and / or abiotic (environmental) stress conditions to which a plant is exposed. Abiotic stress can be caused by dryness or excess water, anaerobic stress, salt stress, chemical toxicity, oxidative stress and hot, cold or freezing temperatures. Abiotic stress can be an osmotic stress caused by water stress (especially dryness), salt stress, oxidative stress, or ion-related stress. Biotic stress is usually understood to mean stress conditions caused by pathogens such as bacteria, viruses, fungi, nematodes and insects. The term "non-stress" conditions as used herein includes those environmental conditions that allow optimal growth of the plants. The skilled person is familiar with the normal soil and climatic conditions for a particular location. The term "non-stress" conditions as used herein includes occasional or everyday mild stress conditions experienced by a plant as defined herein, but does not encompass severe stress conditions.

Insbesondere können die erfindungsgemäßen Verfahren unter Nichtstressbedingungen oder unter leichten Trockenheitsbedingungen durchgeführt werden, wobei man Pflanzen erhält, deren Ertrag im Vergleich zu Kontrollpflanzen erhöht ist. Wie von Wang et al. (Planta (2003), 218: 1–14) beschrieben, führt abiotischer Stress zu einer Reihe von morphologischen, physiologischen, biochemischen und molekularen Veränderungen, die das Pflanzenwachstum und die Pflanzenproduktivität negativ beeinflussen. Es ist bekannt, dass Trockenheit, Salinität, extreme Temperaturen und oxidativer Stress miteinander in Verbindung stehen und über ähnliche Mechanismen Wachstums- und Zellschäden induzieren können. Rabbani et al. (Plant Physiol. (2003), 133: 1755–1767) beschreibt ein besonders hohes Ausmaß an gegenseitiger Beeinflussung (”Cross-Talk”) von Trockenheitsstress und durch hohe Salinität verursachtem Stress. Zum Beispiel äußern sich Trockenheit und/oder Versalzung in erster Linie als osmotischer Stress, was zur Störung der Homöostase und der Zonenverteilung in der Zelle führt. Oxidativer Stress, der häufig hohe oder niedrige Temperatur, Salinität oder Trockenheitsstress begleitet, kann zur Denaturierung funktioneller und struktureller Proteine führen. Infolgedessen aktivieren diese verschiedenen Umweltstressbedingungen häufig ähnliche Zellsignalwege und Zellreaktionen wie die Produktion von Stressproteinen, die Hinaufregulation von Antioxidantien, die Akkumulation von kompatiblen gelösten Stoffen und ein Einstellen des Wachstums. Der begriff ”Nichtstress”-Bedingungen, wie hier verwendet, steht für diejenigen Umweltbedingungen, die ein optimales Wachstum von Pflanzen gestatten. Der Fachmann ist mit normalen Bodenbedingungen und Klimabedingungen für einen bestimmten Standort vertraut. Pflanzen unter optimalen Wachstumsbedingungen (die unter Nichtstressbedingungen herangezogen werden) liefern oft einen Ertrag von, in der Reihenfolge der zunehmenden Präferenz, von mindestens 97%, 95%, 92%, 90%, 87%, 85%, 83%, 80%, 77% oder 75% der durchschnittlichen Produktion einer solchen Pflanze in einer gegebenen Umgebung. Die durchschnittliche Produktion kann bezogen auf die Ernte und/oder die Saison berechnet werden. Der Fachmann ist mit den durchschnittlichen Erträgen einer Kultur vertraut.In particular, the methods of the invention may be carried out under non-stress conditions or under mild drought conditions to yield plants whose yield is increased compared to control plants. Like Wang et al. (Planta (2003), 218: 1-14) Abiotic stress leads to a series of morphological, physiological, biochemical and molecular changes that adversely affect plant growth and productivity. It is known that dryness, salinity, extreme temperatures and oxidative stress are related and can induce growth and cell damage through similar mechanisms. Rabbani et al. (Plant Physiol. (2003), 133: 1755-1767) describes a particularly high degree of cross-talk of dryness stress and high salinity stress. For example, dryness and / or salinization are primarily manifested as osmotic stress, resulting in disruption of homeostasis and zone distribution in the cell. Oxidative stress, which often accompanies high or low temperature, salinity, or drought stress, can lead to the denaturation of functional and structural proteins. As a result, these various environmental stress conditions often activate similar cell signaling pathways and cell responses, such as the production of stress proteins, the upregulation of antioxidants, the accumulation of compatible solutes and cessation of growth. The term "non-stress" conditions, as here used, stands for those environmental conditions that allow optimal growth of plants. The skilled person is familiar with normal soil conditions and climatic conditions for a particular location. Plants under optimal growth conditions (used under non-stress conditions) often yield, in order of increasing preference, at least 97%, 95%, 92%, 90%, 87%, 85%, 83%, 80%, 77% or 75% of the average production of such a plant in a given environment. The average production can be calculated based on the harvest and / or the season. The skilled person is familiar with the average yields of a culture.

In Bezug auf C3H-ähnliche Polypeptide, oder SPT-Polypeptide oder IDI2-Polypeptide oder GR-RBP-Polypeptide ergibt die Durchführung der erfindungsgemäßen Verfahren Pflanzen, die unter Nichtstressbedingungen oder unter leichten Trockenheitsbedingungen gewachsen waren, mit einem verbesserten Ertrag im Vergleich zu Kontrollpflanzen, die unter vergleichbaren Bedingungen gewachsen waren. Daher wird erfindungsgemäß ein Verfahren zum Steigern des Ertrags in Pflanzen bereitgestellt, die unter Nichtstressbedingungen oder unter leichten Trockenheitsbedingungen gewachsen waren, wobei bei dem Verfahren die Expression einer Nukleinsäure, die ein C3H-ähnliches Polypeptid, oder ein SPT Polypeptid oder ein IDI2 Polypeptid, oder ein GR-RBP Polypeptid kodiert, in einer Pflanze moduliert wird.With respect to C3H-like polypeptides, or SPT polypeptides or IDI2 polypeptides or GR-RBP polypeptides, performance of the methods of the invention results in plants grown under non-stress conditions or under mild drought conditions with improved yield as compared to control plants grown in comparable conditions. Thus, according to the present invention, there is provided a method of increasing yield in plants grown under non-stress conditions or under mild drought conditions, the method comprising expressing a nucleic acid encoding a C3H-like polypeptide, or an SPT polypeptide or IDI2 polypeptide GR-RBP polypeptide encoded in a plant.

In Bezug auf eIF4F-Proteinkomplex-Untereinheiten ergibt die Durchführung der erfindungsgemäßen Verfahren Pflanzen, die unter Nichtstressbedingungen oder unter leichten Trockenheitsbedingungen gewachsen waren, mit einem verbesserten Ertrag im Vergleich zu Kontrollpflanzen, die unter vergleichbaren Bedingungen gewachsen waren. Daher wird erfindungsgemäß ein Verfahren zum Steigern des Ertrags in Pflanzen bereitgestellt, die unter Nichtstressbedingungen oder unter leichten Trockenheitsbedingungen gewachsen waren, wobei bei dem Verfahren die Aktivität eines eIF4F-Proteinkomplexes in einer Pflanze moduliert wird, indem mindestens eine seiner Polypeptid-Untereinheiten kodierenden Nukleinsäure moduliert wird.With respect to eIF4F protein complex subunits, performance of the methods of the invention gives plants grown under non-stress conditions or under mild drought conditions with improved yield compared to control plants grown under comparable conditions. Therefore, according to the present invention, there is provided a method of increasing yield in plants grown under non-stress conditions or under mild drought conditions, the method comprising modulating the activity of an eIF4F protein complex in a plant by modulating at least one nucleic acid encoding its polypeptide subunits ,

In Bezug auf C3H-ähnliche Polypeptide, oder SPT-Polypeptide oder IDI2-Polypeptide oder GR-RBP-Polypeptide ergibt die Durchführung der erfindungsgemäßen Verfahren Pflanzen, die unter Nährstoffmangelbedingungen, insbesondere unter Stickstoffmangelbedingungen, gezüchtet wurden, mit besserem Ertrag im Vergleich zu unter vergleichbaren Bedingungen gezüchteten Kontrollpflanzen. Daher wird erfindungsgemäß ein Verfahren zur Steigerung des Ertrags bei Pflanzen bereitgestellt, die unter Nährstoffmangelbedingungen gezüchtet wurden, wobei man bei dem Verfahren die Expression einer Nukleinsäure, die ein C3H-ähnliches Polypeptid, oder SPT-Polypeptid oder IDI2-Polypeptid oder eIF4F-ähnliche Proteinkomplex-Untereinheit oder GR-RBP-Polypeptid kodiert, in einer Pflanze moduliert. Nährstoffmangel kann sich unter anderem aus einem Fehlen von Nährstoffen, wie Stickstoff, Phosphaten und anderen phosphorhaltigen Verbindungen, Kalium, Calcium, Cadmium, Magnesium, Mangan, Eisen und Bor, ergeben. Bei IDI2-Polypeptiden ist der Nährstoffmangel vorzugsweise ein Stickstoffmangel.With respect to C3H-like polypeptides, or SPT polypeptides or IDI2 polypeptides or GR-RBP polypeptides, performance of the methods of the present invention gives plants grown under nutrient-deficient conditions, particularly under nitrogen deficiency conditions, better yield as compared to comparable conditions grown control plants. Thus, according to the present invention there is provided a method of enhancing yield in plants grown under nutrient deficient conditions, the method comprising expressing a nucleic acid encoding a C3H-like polypeptide, or SPT polypeptide or IDI2 polypeptide or eIF4F-like protein complex. Subunit or GR-RBP polypeptide, modulated in a plant. Nutrient deficiencies can result, among other things, from a lack of nutrients such as nitrogen, phosphates and other phosphorus compounds, potassium, calcium, cadmium, magnesium, manganese, iron and boron. For IDI2 polypeptides, the nutrient deficiency is preferably a nitrogen deficiency.

In Bezug auf eIF4D-ähnliche Proteinkomplex-Untereinheiten ergibt die Durchführung der erfindungsgemäßen Verfahren Pflanzen, die unter Nährstoffmangelbedingungen, insbesondere unter Stickstoffmangelbedingungen, gezüchtet wurden, mit besserem Ertrag im Vergleich zu unter vergleichbaren Bedingungen gezüchteten Kontrollpflanzen. Daher wird erfindungsgemäß ein Verfahren zur Steigerung des Ertrags bei Pflanzen bereitgestellt, die unter Nährstoffmangelbedingungen gezüchtet wurden, wobei man bei dem Verfahren die Aktivität eines eIF4F-Proteinkomplexes moduliert, indem man mindestens eine seiner Polypeptid-Untereinheitenkodierende Nukleinsäure moduliert und exprimiert. Nährstoffmangel kann sich unter anderem aus einem Fehlen von Nährstoffen, wie Stickstoff, Phosphaten und anderen phosphorhaltigen Verbindungen, Kalium, Calcium, Cadmium, Magnesium, Mangan, Eisen und Bor, ergeben.With respect to eIF4D-like protein complex subunits, performance of the methods of the present invention gives plants grown under nutrient deficient conditions, particularly under nitrogen deficiency conditions, better yield as compared to control plants grown under comparable conditions. Thus, according to the present invention, there is provided a method of enhancing yield in plants grown under nutrient deficient conditions, the method comprising modulating the activity of an eIF4F protein complex by modulating and expressing at least one of its polypeptide subunit-encoding nucleic acid. Nutrient deficiencies can result, among other things, from a lack of nutrients such as nitrogen, phosphates and other phosphorus compounds, potassium, calcium, cadmium, magnesium, manganese, iron and boron.

Die Durchführung der Verfahren der Erfindung ergibt unter Salzstressbedingungen herangezogene Pflanzen mit verbessertem Ertrag im Vergleich zu unter vergleichbaren Bedingungen herangezogenen Kontrollpflanzen. Daher wird erfindungsgemäß ein Verfahren bereitgestellt zum Steigern des Ertrags von unter Salzstressbedingungen herangezogenen Pflanzen, wobei bei dem Verfahren die Expression in einer Pflanze einer Nukleinsäure, die ein C3H-ähnliches Polypeptid moduliert wird. Der Begriff Salzstress ist nicht auf Natriumchlorid (NaCl) beschränkt, sondern es kann sich dabei unter anderem um eines der folgenden Salze handeln: NaCl, KCl, LiCl, MgCl₂, CaCl₂.Performance of the methods of the invention provides plants grown under salt stress conditions with improved yield as compared to control plants grown under comparable conditions. Therefore, according to the present invention, there is provided a method of increasing the yield of plants grown under salt stress conditions, the method comprising expressing in a plant a nucleic acid that modulates a C3H-like polypeptide. The term salt stress is not limited to sodium chloride (NaCl), but may be, inter alia, one of the following salts: NaCl, KCl, LiCl, MgCl ₂ , CaCl ₂ .

Die vorliegende Erfindung umfasst Pflanzen oder Teile davon (einschließlich Samen), die durch die Verfahren gemäß der vorliegenden Erfindung erhältlich sind. Die Pflanzen oder Teile davon umfassen ein Nukleinsäuretransgen, das ein C3H-ähnliches Polypeptid, oder ein SPT Polypeptid oder ein IDI2 Polypeptid oder eine eIF4F-ähnliche Proteinkomplex-Untereinheit oder ein GR-RBP Polypeptid, wie vorstehend definiert kodiert.The present invention includes plants or parts thereof (including seeds) obtainable by the methods of the present invention. The plants or parts thereof comprise a nucleic acid transgene encoding a C3H-like polypeptide, or an SPT polypeptide or an IDI2 polypeptide or an eIF4F-like protein complex subunit or a GR-RBP polypeptide as defined above.

In Bezug auf C3H-ähnliche Polypeptide, oder SPT-Polypeptide oder IDI2-Polypeptide oder eIF4F-ähnliche Proteinkomplex-Untereinheiten oder GR-RBP-Polypeptide stellt die vorliegende Erfindung auch Genkonstrukte und Vektoren bereit, um die Einführung und/oder Expression von Nukleinsäuren, die die C3H-ähnliche Polypeptide, oder SPT-Polypeptide oder IDI2-Polypeptide oder eIF4F-ähnliche Proteinkomplex-Untereinheiten oder GR-RBP-Polypeptide kodieren, in Pflanzen zu erleichtern. Die Genkonstrukte können in handelsübliche Vektoren eingeführt werden, die für die Transformation in Pflanzen und für die Expression des interessierenden Gens in den transformierten Zellen geeignet sind. Die Erfindung stellt auch die Verwendung eines wie im vorliegenden Text definierten Genkonstrukts in den erfindungsgemäßen Verfahren bereit. With respect to C3H-like polypeptides, or SPT polypeptides or IDI2 polypeptides or eIF4F-like protein complex subunits or GR-RBP polypeptides, the present invention also provides gene constructs and vectors to facilitate the introduction and / or expression of nucleic acids, the C3H-like polypeptides, or SPT polypeptides or IDI2 polypeptides or eIF4F-like protein complex subunits or GR-RBP polypeptides, in plants. The gene constructs can be introduced into commercially available vectors suitable for transformation into plants and expression of the gene of interest in the transformed cells. The invention also provides the use of a gene construct as defined herein in the methods of the invention.

In Bezug auf eIF4F-ähnliche Proteinkomplex-Untereinheiten stellt die vorliegende Erfindung auch Genkonstrukte und Vektoren bereit, um die Einführung und/oder Expression von mindestens einer Nukleinsäure, die eine der eIF4F-ähnlichen Proteinkomplex-Untereinheit-Polypeptide kodiert, in Pflanzen zu erleichtern. Die Genkonstrukte können in handelsübliche Vektoren eingeführt werden, die für die Transformation in Pflanzen und für die Expression des interessierenden Gens in den transformierten Zellen geeignet sind. Die Erfindung stellt auch die Verwendung eines wie im vorliegenden Text definierten Genkonstrukts in den erfindungsgemäßen Verfahren bereit.With respect to eIF4F-like protein complex subunits, the present invention also provides gene constructs and vectors to facilitate the introduction and / or expression in plants of at least one nucleic acid encoding one of the eIF4F-like protein complex subunit polypeptides. The gene constructs can be introduced into commercially available vectors suitable for transformation into plants and expression of the gene of interest in the transformed cells. The invention also provides the use of a gene construct as defined herein in the methods of the invention.

Genauer ausgedrückt stellt die vorliegende Erfindung ein Konstrukt bereit, umfassend:

• (a) eine Nukleinsäure, die ein C3H-ähnliches Polypeptid, oder ein SPT-Polypeptid oder ein IDI2-Polypeptid oder ein GR-RBP-Polypeptid kodiert, oder mindestens eine Nukleinsäure, die ein eIF4F-ähnliches Proteinkomplex-Untereinheit-Polypeptid wie oben definiert kodiert;
• (b) eine oder mehrere Kontrollsequenzen, die die Expression der Nukleinsäuresequenz gemäß (a) antreiben; sowie gegebenenfalls
• (c) eine Transkriptionsterminationssequenz.

• (a) a nucleic acid encoding a C3H-like polypeptide, or an SPT polypeptide or an IDI2 polypeptide or a GR-RBP polypeptide, or at least one nucleic acid comprising an eIF4F-like protein complex subunit polypeptide as defined above encoding;
• (b) one or more control sequences that drive expression of the nucleic acid sequence of (a); and optionally
• (c) a transcription termination sequence.

In Bezug auf C3H-ähnliche Polypeptide, oder SPT-Polypeptide oder IDI2-Polypeptide oder GR-RBP-Polypeptide ist die Nukleinsäure, die ein C3H-ähnliches Polypeptid, oder ein SPT-Polypeptid oder ein IDI2-Polypeptid oder ein GR-RBP-Polypeptid kodiert, wie oben definiert. In Bezug auf die eIF4F-ähnlichen Proteinkomplex-Untereinheiten ist die Nukleinsäure, die eine eIF4F-ähnliche Proteinkomplex-Untereinheit kodiert, vorzugsweise mindestens von dem Untereinheit-Polypeptid wie vorstehend definiert. Der Begriff ”Kontrollsequenz” und ”Terminationssequenz” sind wie hier definiert.With respect to C3H-like polypeptides, or SPT polypeptides or IDI2 polypeptides or GR-RBP polypeptides, the nucleic acid is a C3H-like polypeptide, or an SPT polypeptide or an IDI2 polypeptide or a GR-RBP polypeptide encoded as defined above. With respect to the eIF4F-like protein complex subunits, the nucleic acid encoding an eIF4F-like protein complex subunit is preferably at least from the subunit polypeptide as defined above. The term "control sequence" and "termination sequence" are as defined herein.

Pflanzen werden mit einem Vektor transformiert, der eine der vorstehend beschriebenen Nukleinsäuren umfasst. Dem Fachmann sind die genetischen Elemente, die auf einem Vektor zur erfolgreichen Transformation, Selektion und Vermehrung der Wirtszellen, die die interessierende Sequenz enthalten, vorhanden sein müssen, geläufig. Die interessierende Sequenz ist funktionsfähig mit einer oder mehreren Kontrollsequenzen (mindestens mit einem Promotor) verknüpft.Plants are transformed with a vector comprising one of the nucleic acids described above. Those skilled in the art will recognize the genetic elements that must be present on a vector for successful transformation, selection and propagation of the host cells containing the sequence of interest. The sequence of interest is operably linked to one or more control sequences (at least one promoter).

Jede Art von Promotor kann unabhängig davon, ob er natürlich oder synthetisch ist, vorteilhafterweise zum Steuern der Expression der Nukleinsäuresequenz verwendet werden, vorzugsweise ist der Promotor jedoch pflanzlichen Ursprungs. Ein konstitutiver Promotor ist in den Verfahren besonders geeignet. Der konstitutive Promotor ist vorzugsweise auch ein ubiquitärer Promotor, oder ein ubiquitärer Promotor mittlerer Stärke. Siehe im Abschnitt ”Definitionen” hierin für Definitionen der verschiedenen Promotortypen.Any type of promoter, whether natural or synthetic, may be advantageously used to direct expression of the nucleic acid sequence, but preferably the promoter is of plant origin. A constitutive promoter is particularly suitable in the methods. The constitutive promoter is preferably also a ubiquitous promoter, or a middle-strength ubiquitous promoter. See the "Definitions" section herein for definitions of the various types of promoters.

In Bezug auf C3H-ähnliche Polypeptide sollte es klar sein, dass die Anwendbarkeit der vorliegenden Erfindung nicht auf die C3H-ähnliches-Polypeptid-kodierende Nukleinsäure eingeschränkt ist, die durch SEQ ID NO: 1 veranschaulicht ist, entsprechend ist die Anwendbarkeit der vorliegenden Erfindung nicht auf die Expression einer C3H-ähnliches-Polypeptid-kodierenden Nukleinsäuresequenz eingeschränkt, wenn sie durch einen konstitutiven Promotor gesteuert wird.With respect to C3H-like polypeptides, it should be understood that the applicability of the present invention is not limited to the C3H-like polypeptide-encoding nucleic acid illustrated by SEQ ID NO: 1, accordingly, the utility of the present invention is not upon expression of a C3H-like polypeptide-encoding nucleic acid sequence when controlled by a constitutive promoter.

Der konstitutive Promotor ist vorzugsweise ein mittelstarker Promotor, stärker bevorzugt ausgewählt aus einem aus einer Pflanze stammenden Promotor, wie ein GOS2-Promotor, vorzugsweise ein GOS2-Promotor aus Reis. Weiterhin bevorzugt wird der konstitutive Promotor durch eine Nukleinsäuresequenz wiedergegeben, die im Wesentlichen der SEQ ID NO: 95 gleicht, am stärksten bevorzugt wird der Protomotor durch die SEQ ID NO: 95 dargestellt. Weitere Beispiele für konstitutive Promotoren siehe hier im Abschnitt ”Definitionen”.The constitutive promoter is preferably a moderate promoter, more preferably selected from a plant derived promoter, such as a GOS2 promoter, preferably a rice GOS2 promoter. Further preferably, the constitutive promoter is represented by a nucleic acid sequence substantially equal to SEQ ID NO: 95, most preferably the protomotor is represented by SEQ ID NO: 95. For more examples of constitutive promoters, see the Definitions section here.

Gegebenenfalls können in dem in eine Pflanze eingeführten Konstrukt eine oder mehrere Terminatorsequenzen eingesetzt werden. Vorzugsweise umfasst das Konstrukt eine Expressionskassette, die einen GOS2-Promotor umfasst, im Wesentlichen ähnlich SEQ ID NR: 95, und die Nukleinsäure, die ein C3H-ähnliches Polypeptid kodiert.Optionally, one or more terminator sequences may be employed in the construct introduced into a plant. Preferably, the construct comprises an expression cassette comprising a GOS2 promoter comprises, substantially similar to SEQ ID NO: 95, and the nucleic acid encoding a C3H-like polypeptide.

In Bezug auf SPT-ähnliche Polypeptide sollte es klar sein, dass die Anwendbarkeit der vorliegenden Erfindung nicht auf die SPT-ähnliches-Polypeptid-kodierende Nukleinsäure eingeschränkt ist, die durch SEQ ID NO: 96 veranschaulicht ist, entsprechend ist die Anwendbarkeit der vorliegenden Erfindung nicht auf die Expression einer SPT-ähnliches-Polypeptid-kodierenden Nukleinsäuresequenz eingeschränkt, wenn sie durch einen konstitutiven Promotor gesteuert wird.With respect to SPT-like polypeptides, it should be understood that the applicability of the present invention is not limited to the SPT-like polypeptide-encoding nucleic acid illustrated by SEQ ID NO: 96, accordingly, the utility of the present invention is not restricted to the expression of a SPT-like polypeptide-encoding nucleic acid sequence when it is controlled by a constitutive promoter.

Der konstitutive Promotor ist vorzugsweise ein mittelstarker Promotor, stärker bevorzugt ausgewählt aus einem aus einer Pflanze stammenden Promotor, wie ein GOS2-Promotor, vorzugsweise ein GOS2-Promotor aus Reis. Weiterhin bevorzugt wird der konstitutive Promotor durch eine Nukleinsäuresequenz wiedergegeben, die im Wesentlichen der SEQ ID NO: 135 gleicht, am stärksten bevorzugt wird der Protomotor durch die SEQ ID NO: 135 dargestellt. Weitere Beispiele für konstitutive Promotoren siehe hier im Abschnitt ”Definitionen”.The constitutive promoter is preferably a moderate promoter, more preferably selected from a plant derived promoter, such as a GOS2 promoter, preferably a rice GOS2 promoter. Further preferably, the constitutive promoter is represented by a nucleic acid sequence substantially equal to SEQ ID NO: 135, most preferably the protomotor is represented by SEQ ID NO: 135. For more examples of constitutive promoters, see the Definitions section here.

Gegebenenfalls können in dem in eine Pflanze eingeführten Konstrukt eine oder mehrere Terminatorsequenzen eingesetzt werden. Vorzugsweise umfasst das Konstrukt eine Expressionskassette, die einen GOS2-Promotor umfasst, im Wesentlichen ähnlich SEQ ID NR: 135, und die Nukleinsäure, die ein SPT-ähnliches Polypeptid kodiert.Optionally, one or more terminator sequences may be employed in the construct introduced into a plant. Preferably, the construct comprises an expression cassette comprising a GOS2 promoter, substantially similar to SEQ ID NO: 135, and the nucleic acid encoding a SPT-like polypeptide.

In Bezug auf IDI2- Polypeptide sollte es klar sein, dass die Anwendbarkeit der vorliegenden Erfindung nicht auf die IDI2-Polypeptid-kodierende Nukleinsäure eingeschränkt ist, die durch SEQ ID NO: 139 veranschaulicht ist, entsprechend ist die Anwendbarkeit der vorliegenden Erfinung nicht auf die Expression einer IDI2-Polypeptid-kodierenden Nukleinsäuresequenz eingeschränkt, wenn sie durch einen konstitutiven Promotor gesteuert wird.With respect to IDI2 polypeptides, it should be understood that the utility of the present invention is not limited to the IDI2 polypeptide-encoding nucleic acid illustrated by SEQ ID NO: 139, accordingly, the applicability of the present invention is not to expression an IDI2 polypeptide-encoding nucleic acid sequence when controlled by a constitutive promoter.

Der konstitutive Promotor ist vorzugsweise ein mittelstarker Promotor, stärker bevorzugt ausgewählt aus einem aus einer Pflanze stammenden Promotor, wie ein GOS2-Promotor, vorzugsweise ein GOS2-Promotor aus Reis. Weiterhin bevorzugt wird der konstitutive Promotor durch eine Nukleinsäuresequenz wiedergegeben, die im Wesentlichen der SEQ ID NO: 149 gleicht, am stärksten bevorzugt wird der Protomotor durch die SEQ ID NO: 149 dargestellt. Weitere Beispiele für konstitutive Promotoren siehe hier im Abschnitt ”Definitionen”.The constitutive promoter is preferably a moderate promoter, more preferably selected from a plant derived promoter, such as a GOS2 promoter, preferably a rice GOS2 promoter. Further preferably, the constitutive promoter is represented by a nucleic acid sequence substantially equal to SEQ ID NO: 149, most preferably the protomotor is represented by SEQ ID NO: 149. For more examples of constitutive promoters, see the Definitions section here.

Gegebenenfalls können in dem in eine Pflanze eingeführten Konstrukt eine oder mehrere Terminatorsequenzen eingesetzt werden. Vorzugsweise umfasst das Konstrukt eine Expressionskassette, die einen GOS2-Promotor umfasst, im Wesentlichen ähnlich SEQ ID NR: 149, und die Nukleinsäure, die ein IDI2-Polypeptid kodiert.Optionally, one or more terminator sequences may be employed in the construct introduced into a plant. Preferably, the construct comprises an expression cassette comprising a GOS2 promoter, substantially similar to SEQ ID NO: 149, and the nucleic acid encoding an IDI2 polypeptide.

In Bezug auf eIF4F-ähnliche Proteinkomplex-Untereinheiten sollte es klar sein, dass die Anwendbarkeit der vorliegenden Erfindung nicht auf die eIF4F-ähnliche Proteinkomplex-Untereinheiten-Polypeptid-kodierende Nukleinsäuren eingeschränkt ist, die durch SEQ ID NO: 240, SEQ ID NO: 300 und/oder SEQ ID NO: 560 veranschaulicht werden, entsprechend ist die Anwendbarkeit der vorliegenden Erfindung nicht auf die Expression einer eIF4F-ähnliche Proteinkomplex-Untereinheiten-Polypeptid-kodierenden Nukleinsäuresequenz eingeschränkt, wenn sie durch einen konstitutiven Promotor gesteuert wird.With respect to eIF4F-like protein complex subunits, it should be understood that the applicability of the present invention is not limited to the eIF4F-like protein complex subunit polypeptide-encoding nucleic acids represented by SEQ ID NO: 240, SEQ ID NO: 300 and / or SEQ ID NO: 560, accordingly, the utility of the present invention is not limited to the expression of an eIF4F-like protein complex subunit polypeptide-encoding nucleic acid sequence when it is controlled by a constitutive promoter.

Der konstitutive Promotor ist vorzugsweise ein mittelstarker Promotor, stärker bevorzugt ausgewählt aus einem aus einer Pflanze stammenden Promotor, wie ein GOS2-Promotor, vorzugsweise ein GOS2-Promotor aus Reis. Weiterhin bevorzugt wird der konstitutive Promotor durch eine Nukleinsäuresequenz wiedergegeben, die im Wesentlichen der SEQ ID NO: 818 und/oder SEQ ID NO: 819 gleicht, am stärksten bevorzugt wird der Protomotor durch die SEQ ID NO: 818 dargestellt. Weitere Beispiele für konstitutive Promotoren siehe hier im Abschnitt ”Definitionen”.The constitutive promoter is preferably a moderate promoter, more preferably selected from a plant derived promoter, such as a GOS2 promoter, preferably a rice GOS2 promoter. Further preferably, the constitutive promoter is represented by a nucleic acid sequence substantially equal to SEQ ID NO: 818 and / or SEQ ID NO: 819, most preferably the protomotor is represented by SEQ ID NO: 818. For more examples of constitutive promoters, see the Definitions section here.

Gegebenenfalls können in dem in eine Pflanze eingeführten Konstrukt eine oder mehrere Terminatorsequenzen eingesetzt werden. Vorzugsweise umfasst das Konstrukt eine Expressionskassette, die einen GOS2-Promotor umfasst, im Wesentlichen ähnlich SEQ ID NR: 818, und mindestens eine Nukleinsäure, die ein eIF4F-ähnliches Proteinkomplex-Untereinheit-Polypeptid kodiert.Optionally, one or more terminator sequences may be employed in the construct introduced into a plant. Preferably, the construct comprises an expression cassette comprising a GOS2 promoter, substantially similar to SEQ ID NO: 818, and at least one nucleic acid encoding an eIF4F-like protein complex subunit polypeptide.

In Bezug auf GR-RBP-Polypeptide sollte es klar sein, dass die Anwendbarkeit der vorliegenden Erfindung nicht auf die GR-RBP-Polypeptid-kodierende Nukleinsäure eingeschränkt ist, die durch SEQ ID NO: 826 veranschaulicht ist, entsprechend ist die Anwendbarkeit der vorliegenden Erfindung nicht auf die Expression einer GR-RBP-Polypeptid-kodierenden Nukleinsäuresequenz eingeschränkt, wenn sie durch einen konstitutiven Promotor gesteuert wird.With respect to GR-RBP polypeptides, it should be understood that the applicability of the present invention is not limited to the GR-RBP polypeptide-encoding nucleic acid represented by SEQ ID NO: 826 Accordingly, the utility of the present invention is not limited to the expression of a GR-RBP polypeptide-encoding nucleic acid sequence when it is controlled by a constitutive promoter.

Der konstitutive Promotor ist vorzugsweise ein mittelstarker Promotor, stärker bevorzugt ausgewählt aus einem aus einer Pflanze stammenden Promotor, wie ein GOS2-Promotor, vorzugsweise ein GOS2-Promotor aus Reis. Weiterhin bevorzugt wird der konstitutive Promotor durch eine Nukleinsäuresequenz wiedergegeben, die im Wesentlichen der SEQ ID NO: 840 gleicht, am stärksten bevorzugt wird der Protomotor durch die SEQ ID NO: 840 dargestellt. Weitere Beispiele für konstitutive Promotoren siehe hier im Abschnitt ”Definitionen”.The constitutive promoter is preferably a moderate promoter, more preferably selected from a plant derived promoter, such as a GOS2 promoter, preferably a rice GOS2 promoter. Further preferably, the constitutive promoter is represented by a nucleic acid sequence substantially equal to SEQ ID NO: 840, most preferably the protomotor is represented by SEQ ID NO: 840. For more examples of constitutive promoters, see the Definitions section here.

Gegebenenfalls können in dem in eine Pflanze eingeführten Konstrukt eine oder mehrere Terminatorsequenzen eingesetzt werden. Vorzugsweise umfasst das Konstrukt eine Expressionskassette, die einen GOS2-Promotor umfasst, im Wesentlichen ähnlich SEQ ID NR: 840, und die Nukleinsäure, die da GR-RBP Polypeptid kodiert.Optionally, one or more terminator sequences may be employed in the construct introduced into a plant. Preferably, the construct comprises an expression cassette comprising a GOS2 promoter, substantially similar to SEQ ID NO: 840, and the nucleic acid encoding the GR-RBP polypeptide.

Zusätzliche regulatorische Elemente können Transkriptions- und Translations-Enhancer umfassen. Der Fachmann kennt Terminator- und Enhancer-Sequenzen, die sich zur Durchführung der Erfindung eignen. Eine Intronsequenz kann ebenfalls zu der 5'-untranslatierten Region (UTR) oder in der kodierenden Sequenz hinzugefügt werden, damit die Menge der reifen Botschaft gesteigert wird, die sich im Cytosol anreichert, wie es im Abschnitt Definitionen beschrieben ist. Andere Kontrollsequenzen (neben Promotor, Enhancer, Silencer, Intronsequenzen, 3'UTR-und/oder 5'UTR-Regionen) können protein- und/oder RNA-stabilisierende Elemente sein. Solche Sequenzen sind dem Fachmann bekannt oder können leicht von ihm erhalten werden.Additional regulatory elements may include transcriptional and translational enhancers. The person skilled in the art knows terminator and enhancer sequences which are suitable for carrying out the invention. An intron sequence can also be added to the 5 'untranslated region (UTR) or in the coding sequence to increase the amount of mature message that accumulates in the cytosol, as described in the Definitions section. Other control sequences (besides promoter, enhancer, silencer, intron sequences, 3'UTR and / or 5'UTR regions) may be protein and / or RNA stabilizing elements. Such sequences are known to the person skilled in the art or can easily be obtained from him.

Die erfindungsgemäßen Genkonstrukte können weiterhin eine Replikationsursprungssequenz beinhalten, die zur Aufrechterhaltung und/oder Replikation in einem bestimmten Zelltyp erforderlich ist. Bei einem Beispiel muss ein Genkonstrukt in einer Bakterienzelle als episomales genetisches Element aufrechterhalten werden (z. B. Plasmid- oder Cosmidmolekül). Bevorzugte Replikationsursprünge umfassen f1-ori und colE1, sind jedoch nicht darauf beschränkt.The gene constructs of the invention may further include an origin of replication necessary for maintenance and / or replication in a particular cell type. In one example, a gene construct must be maintained in a bacterial cell as an episomal genetic element (eg, plasmid or cosmid molecule). Preferred origins of replication include, but are not limited to, f1-ori and colE1.

Für den Nachweis des erfolgreichen Transfers der Nukleinsäuresequenzen, wie sie bei den erfindungsgemäßen Verfahren verwendet wurden, und/oder für die Selektion der transgenen Pflanzen, die diese Nukleinsäuren umfassen, werden vorteilhafterweise Markergene (oder Reportergene) verwendet. Das Genkonstrukt kann daher gegebenenfalls ein Selektionsmarkergen umfassen. Selektionsmarker sind hier eingehender im Abschnitt ”Definitionen” beschrieben. Die Markergene können aus der transgenen Zelle entfernt oder gespalten werden, sobald sie nicht mehr vonnöten sind. Techniken zur Markerentfernung sind Stand der Technik, geeignete Techniken sind oben im Abschnitt Definitionen beschrieben.For the detection of the successful transfer of the nucleic acid sequences as used in the methods of the invention and / or for the selection of the transgenic plants comprising these nucleic acids, it is advantageous to use marker genes (or reporter genes). The gene construct may therefore optionally comprise a selection marker gene. Selection markers are described in more detail in the section "Definitions". The marker genes can be removed from the transgenic cell or cleaved as soon as they are no longer needed. Techniques for marker removal are known in the art, suitable techniques are described above in the Definitions section.

Die Erfindung stellt auch ein Verfahren zur Produktion von transgenen Pflanzen mit verbesserten Ertragsmerkmalen gegenüber Kontrollpflanzen bereit, wobei eine beliebige Nukleinsäure, die ein C3H-ähnliches Polypeptid, oder ein SPT-Polypeptid oder ein IDI2-Polypeptid oder eine eIF4F-ähnliche Proteinkomplex-Lintereinheit oder ein GR-RBP-Polypeptid ein PHDf-HD-Polypeptid wie oben definiert, kodiert, in eine(r) Pflanze eingeführt und exprimiert wird.The invention also provides a method of producing transgenic plants having improved yield-related traits relative to control plants, wherein any nucleic acid encoding a C3H-like polypeptide, or an SPT polypeptide or an IDI2 polypeptide or an eIF4F-like protein complex lint unit or a GR-RBP polypeptide encodes a PHDf-HD polypeptide as defined above, introduced into a plant and expressed.

Insbesondere stellt die vorliegende Erfindung ein Verfahren zur Produktion von transgenen Pflanzen mit verbesserten Ertragsmerkmalen, insbesondere verbessertem (Samen)ertrag bereit, wobei das Verfahren umfasst:

• (i) Einbringen und Exprimieren einer Nukleinsäure, die ein C3H-ähnliches Polypeptid, oder ein SPT-Polypeptid oder ein IDI2-Polypeptid oder eine eIF4F-ähnliche Proteinkomplex-Untereinheit oder ein GR-RBP-Polypeptid kodiert, in eine(r) Pflanze oder Pflanzenzelle; und
• (ii) Züchten der Pflanzenzelle unter Bedingungen, die das Pflanzenwachstum und die Entwicklung fördern.

• (i) introducing and expressing in a plant or a nucleic acid encoding a C3H-like polypeptide, or an SPT polypeptide or an IDI2 polypeptide or an eIF4F-like protein complex subunit or a GR-RBP polypeptide plant cell; and
• (ii) growing the plant cell under conditions that promote plant growth and development.

Die Nukleinsäure von (i) kann eine beliebige Nukleinsäure sein, die ein C3H-ähnliches Polypeptid, oder ein SPT-Polypeptid oder ein IDI2-Polypeptid oder eine eIF4F-ähnliche Proteinkomplex-Untereinheit oder ein GR-RBP-Polypeptid wie hier definiert kodieren kann.The nucleic acid of (i) may be any nucleic acid capable of encoding a C3H-like polypeptide, or SPT polypeptide or IDI2 polypeptide or eIF4F-like protein complex subunit or GR-RBP polypeptide as defined herein.

Die Erfindung stellt auch ein Verfahren zur Herstellung transgener Pflanzen mit verbesserten Ertragsmerkmalen im Vergleich zu Kontrollpflanzen bereit, wobei in eine(r) Pflanze eine Nukleinsäure, die ein C3H-ähnliches Polypeptid, oder ein SPT-Polypeptid oder ein IDI2-Polypeptid oder eine eIF4F-ähnliche Proteinkomplex-Untereinheit oder ein GR-RBP-Polypeptid wie vorstehend definiert kodiert, eingeführt und exprimiert wird.The invention also provides a method of producing transgenic plants having improved yield-related traits relative to control plants, wherein a nucleic acid containing a C3H-like polypeptide, or an SPT polypeptide or an IDI2 polypeptide or an eIF4F protein, is introduced into a plant. similar protein complex subunit or a GR-RBP polypeptide as defined above, introduced and expressed.

Insbesondere stellt die vorliegende Erfindung ein Verfahren zur Produktion von transgenen Pflanzen mit verbesserten Ertragsmerkmalen, insbesondere verbessertem Ertrag und/oder verbesserter Jungpflanzenvitalität bereit, wobei das Verfahren umfasst:

• (i) Einbringen und Exprimieren einer Nukleinsäure, die ein C3H-ähnliches Polypeptid, oder ein SPT-Polypeptid oder ein IDI2-Polypeptid oder eine eIF4F-ähnliche Proteinkomplex-Untereinheit oder ein GR-RBP-Polypeptid kodiert, in eine(r) Pflanze oder Pflanzenzelle; und
• (ii) Züchten der Pflanzenzelle unter Bedingungen, die das Pflanzenwachstum und die Entwicklung fördern.

• (i) introducing and expressing in a plant or a nucleic acid encoding a C3H-like polypeptide, or an SPT polypeptide or an IDI2 polypeptide or an eIF4F-like protein complex subunit or a GR-RBP polypeptide plant cell; and
• (ii) growing the plant cell under conditions that promote plant growth and development.

Die Nukleinsäure von (i) kann eine beliebige Nukleinsäure sein, die ein C3H-ähnliches Polypeptid, oder ein SPT-Polypeptid oder ein IDI2-Polypeptid oder eine eIF4F-ähnliche Proteinkomplex-Untereinheit oder ein GR-RBP-Polypeptid wie hier definiert kodieren kann.The nucleic acid of (i) may be any nucleic acid capable of encoding a C3H-like polypeptide, or SPT polypeptide or IDI2 polypeptide or eIF4F-like protein complex subunit or GR-RBP polypeptide as defined herein.

Die Erfindung stellt auch ein Verfahren zur Herstellung transgener Pflanzen mit verbesserten Ertragsmerkmalen im Vergleich zu Kontrollplanzen bereit, wobei in eine(r) Pflanze mindestens eine Nukleinsäure, die ein eIF4F-ähnliche Proteinkomplex-Untereinheit-Polypeptid vorstehend definiert kodiert, eingeführt und exprimiert wird.The invention also provides a method for producing transgenic plants having improved yield-related traits relative to control plants, wherein at least one nucleic acid encoding an eIF4F-like protein complex subunit polypeptide defined above is introduced and expressed in a plant.

Insbesondere stellt die vorliegende Erfindung ein Verfahren zur Produktion von transgenen Pflanzen mit verbesserten Ertragsmerkmalen, insbesondere verbessertem (Samen)ertrag bereit, wobei das Verfahren umfasst:

• (i) Einbringen und Exprimieren von mindestens einer Nukleinsäure, die ein eIF4F-ähnliche Proteinkomplex-Untereinheit-Polypeptid kodiert, in eine(r) Pflanze oder Pflanzenzelle; und
• (ii) Züchten der Pflanzenzelle unter Bedingungen, die das Pflanzenwachstum und die Entwicklung fördern.

• (i) introducing and expressing at least one nucleic acid encoding an eIF4F-like protein complex subunit polypeptide into a plant or plant cell; and
• (ii) growing the plant cell under conditions that promote plant growth and development.

Die Nukleinsäure von (i) kann eine beliebige der Nukleinsäuren sein, die eIF4F-ähnliche Proteinkomplex-Untereinheits-Polypeptide wie hier definiert kodieren kann.The nucleic acid of (i) may be any of the nucleic acids capable of encoding eIF4F-like protein complex subunit polypeptides as defined herein.

Die Nukleinsäure kann in eine Pflanzenzelle oder in die Pflanze selbst direkt eingeführt werden (was das Einführen in ein Gewebe, Organ oder einen beliebigen anderen Teil einer Pflanze beinhaltet). Gemäß einem bevorzugten Merkmal der vorliegenden Erfindung wird die Nukleinsäure vorzugsweise mittels Transformation in eine Pflanze eingeführt. Der Begriff ”Transformation” wird im vorliegenden Text im Abschnitt ”Definitionen” genauer beschrieben.The nucleic acid can be introduced directly into a plant cell or into the plant itself (which involves introduction into a tissue, organ or any other part of a plant). According to a preferred feature of the present invention, the nucleic acid is preferably introduced into a plant by transformation. The term "transformation" is described in more detail in the text "Definitions" in the present text.

Die genetisch modifizierten Pflanzenzellen können nach allen Verfahren, mit denen der Fachmann vertraut ist, regeneriert werden. Geeignete Verfahren finden sich in den oben genannten Veröffentlichungen von S. D. Kung und R. Wu, Potrykus oder Höfgen und Willmitzer.The genetically modified plant cells can be regenerated by any of the methods familiar to those skilled in the art. Suitable methods can be found in the above-mentioned publications by S. D. Kung and R. Wu, Potrykus or Höfgen and Willmitzer.

Im Allgemeinen werden nach der Transformation die Pflanzenzellen oder Zellgruppen auf das Vorhandensein von einem oder mehreren Markern selektiert, die von den mit dem interessierenden Gen gemeinsam transferierten, in Pflanzen exprimierbaren Genen kodiert werden, wonach das transformierte Material zu einer ganzen Pflanze regeneriert wird. Für die Selektion von transformierten Pflanzen wird das bei der Transformation erhaltene Pflanzenmaterial im Allgemeinen Selektionsbedingungen unterworfen, so dass man transformierte Pflanzen von untransformierten Pflanzen unterscheiden kann. So können zum Beispiel Semen, die auf die oben beschriebene Art und Weise erhalten wurden, ausgepflanzt werden und nach einer anfänglichen Wachstumsphase durch Spritzen einer geeigneten Selektion unterworfen werden. Eine weitere Möglichkeit besteht darin, dass man die Samen, gegebenenfalls nach Sterilisieren, auf Agarplatten heranzieht, wobei man ein geeignetes Selektionsmittel verwendet, so dass nur die transformierten Samen zu Pflanzen heranwachsen können. Alternativ werden die transformierten Pflanzen auf das Vorhandensein eines Selektionsmarkers wie die oben beschriebenen gescreent.In general, after transformation, the plant cells or cell groups are selected for the presence of one or more markers encoded by the plant-expressible genes that are shared with the gene of interest, after which the transformed material is regenerated to a whole plant. For the selection of transformed plants, the plant material obtained in the transformation is generally subjected to selection conditions, so that transformed plants can be distinguished from untransformed plants. For example, semen obtained in the manner described above may be planted and subjected to an appropriate selection by an injection after an initial growth phase. Another possibility is to use the seeds, if appropriate after sterilization, on agar plates, using a suitable selection agent, so that only the transformed seeds can grow into plants. Alternatively, the transformed plants are screened for the presence of a selection marker such as those described above.

Nach dem DNA-Transfer und der Regeneration können mutmaßlich transformierte Pflanzen auch zum Beispiel unter Verwendung der Southern-Analyse auf das Vorhandensein des interessierenden Gens, die Kopienzahl und/oder die Genomorganisation ausgewertet werden. Alternativ dazu oder zusätzlich können die Expressionsniveaus der neu eingeführten DNA mittels Northern- und/oder Western-Analyse überwacht werden; wobei beide Techniken dem Durchschnittsfachmann gut bekannt sind.After DNA transfer and regeneration, putatively transformed plants may also be evaluated for example using Southern analysis for the presence of the gene of interest, copy number and / or genome organization. Alternatively or additionally, expression levels of the newly introduced DNA can be monitored by Northern and / or Western analysis; both techniques being well known to those of ordinary skill in the art.

Die erzeugten transformierten Pflanzen können mit unterschiedlichen Mitteln vermehrt werden, wie durch klonale Vermehrung oder durch klassische Züchtungstechniken. So kann zum Beispiel eine transformierte Pflanze der ersten Generation (T1-Pflanze) geselbstet werden, und homozygote Transformanten der zweiten Generation (T2-Pflanze) können selektiert werden, und die T2-Pflanzen können dann mit Hilfe von klassischen Züchtungstechniken weiter vermehrt werden. Die erzeugten transformierten Organismen können in verschiedener Form vorliegen. Sie können beispielsweise Chimären von transformierten Zellen und untransformierten Zellen sein; klonale Transformanten (z. B. alle Zellen wurden dahingehend transformiert, dass sie die Expressionskassette enthalten); Pfropfmaterial von transformiertem und untransformiertem Gewebe (z. B. bei Pflanzen ein transformierter Wurzelstock, der auf ein untransformiertes Edelreis gepfropft wurde).The transformed plants produced can be propagated by various means, such as by clonal propagation or by classical breeding techniques. For example, a first generation transformed plant (T1 plant) can be selfed, and second generation homozygous transformants (T2 plant) can be selected, and the T2 plants can then be selected using classic breeding techniques are further propagated. The transformed organisms produced may be in various forms. They may be, for example, chimeras of transformed cells and untransformed cells; clonal transformants (e.g., all cells were transformed to contain the expression cassette); Graft material from transformed and untransformed tissue (eg, in plants, a transformed rootstock grafted onto an untransformed gin).

Die vorliegende Erfindung erstreckt sich eindeutig auf eine jede Pflanzenzelle oder Pflanze, die nach einem der hier beschriebenen Verfahren erzeugt wurde, und auf sämtliche Pflanzenteile und sämtliches Vermehrungsmaterial davon. Die vorliegende Erfindung umfasst weiterhin die Nachkommenschaft einer/eines primär transformierten oder transfizierten Zelle, Gewebes, Organs oder ganzen Pflanze, die/das nach einem der oben genannten Verfahren erzeugt wurde, wobei die einzige Voraussetzung ist, dass die Nachkommenschaft dasselbe/dieselben genotypische(n) und/oder phänotypische(n) Merkmal(e) aufweist, wie es/sie von dem Elter bei den erfindungsgemäßen Verfahren gezeigt wird.The present invention clearly extends to any plant cell or plant produced by any of the methods described herein, and to all plant parts and all propagating material thereof. The present invention further includes the progeny of a primary transformed or transfected cell, tissue, organ or whole plant produced by any of the above methods, the sole requirement being that the progeny have the same genotypic (n ) and / or phenotypic trait (s) as exhibited by the parent in the methods of the invention.

Die Erfindung beinhaltet auch Wirtszellen, die eine isolierte Nukleinsäure, die ein wie oben definiertes C3H-ähnliches Polypeptid, oder ein SPT-Polypeptid oder ein IDI2-Polypeptid oder ein eIF4F-ähnliche Proteinkomplex-Untereinheits-Polypeptid oder ein GR-RBP-Polypeptid kodiert, enthalten. Bevorzugte erfindungsgemäße Wirtszellen sind Pflanzenzellen. Wirtspflanzen für die bei dem erfindungsgemäßen Verfahren verwendeten Nukleinsäuren oder den Vektor, für die Expressionskassette oder das Konstrukt oder den Vektor, sind im Prinzip vorteilhafterweise alle Pflanzen, die die bei dem erfindungsgemäßen Verfahren verwendeten Polypeptide synthetisieren können.The invention also includes host cells encoding an isolated nucleic acid encoding a C3H-like polypeptide as defined above, or an SPT polypeptide or an IDI2 polypeptide, or an eIF4F-like protein complex subunit polypeptide or GR-RBP polypeptide, contain. Preferred host cells according to the invention are plant cells. In principle, host plants for the nucleic acids or the vector used for the method according to the invention, for the expression cassette or the construct or the vector, are advantageously all plants which are able to synthesize the polypeptides used in the method according to the invention.

Die erfindungsgemäßen Verfahren lassen sich vorteilhaft auf jede beliebige Pflanze anwenden. Zu den Pflanzen, die bei den erfindungsgemäßen Verfahren besonders geeignet sind, gehören alle Pflanzen, die zu der Superfamilie Viridiplantae gehören, insbesondere monokotyle und dikotyle Pflanzen, einschließlich Futter- oder Weidepflanzenleguminosen, Zierpflanzen, Nahrungsmittelkulturpflanzen, Bäume oder Sträucher. Gemäß einer bevorzugten Ausführungsform der vorliegenden Erfindung handelt es sich bei der Pflanze um eine Kulturpflanze. Zu den Kulturpflanzen gehören zum Beispiel Sojabohne, Sonnenblume, Canola-Raps, Luzerne, Raps, Leinsaat, Baumwolle, Tomate, Kartoffel und Tabak. Weiter bevorzugt handelt es sich bei der Pflanze um eine monokotyle Pflanze. Zu den monokotylen Pflanzen gehört zum Beispiel Zuckerrohr. Weiter bevorzugt handelt es sich bei der Pflanze um ein Getreide. Zu den Getreiden gehören zum Beispiel Reis, Mais, Weizen, Gerste, Hirse, Roggen, Triticale, Sorghum, Emmer, Dinkel, Secale, Einkorn, Zwerghirse, Mohrenhirse und Hafer.The methods of the invention can be advantageously applied to any plant. Plants which are particularly useful in the methods of the invention include any of the plants belonging to the superfamily Viridiplantae, in particular monocotyledonous and dicotyledonous plants, including forage or willow legumes, ornamental plants, food crops, trees or shrubs. According to a preferred embodiment of the present invention, the plant is a crop. The crops include, for example, soybean, sunflower, canola rape, alfalfa, rapeseed, linseed, cotton, tomato, potato and tobacco. More preferably, the plant is a monocotyledonous plant. The monocotyledonous plants include, for example, sugarcane. More preferably, the plant is a cereal. The cereals include, for example, rice, maize, wheat, barley, millet, rye, triticale, sorghum, emmer, spelled, secale, einkorn, millet, sorghum and oats.

Die Erfindung betrifft auch erntefähige Teile einer Pflanze, wie zum Beispiel, jedoch nicht ausschließlich, Samen, Blätter, Früchte, Blüten, Stängel, Wurzeln, Rhizome, Knollen und Zwiebeln, wobei die erntefähigen Teile eine rekombinante Nukleinsäure umfassen, die ein C3H-ähnliches Polypeptid, oder ein SPT-Polypeptid oder ein IDI2-Polypeptid oder ein eIF4F-ähnliche Proteinkomplex-Untereinheits-Polypeptid oder ein GR-RBP-Polypeptid kodiert. Die Erfindung betrifft weiterhin Produkte, die von einem erntefähigen Teil einer solchen Pflanze abstammen, vorzugsweise direkt abstammen, wie trockene Pellets oder Pulver, Öl, Fett und Fettsäuren, Stärke oder Proteins.The invention also relates to harvestable parts of a plant, such as, but not limited to, seeds, leaves, fruits, flowers, stems, roots, rhizomes, tubers and onions, the harvestable parts comprising a recombinant nucleic acid encoding a C3H-like polypeptide or an SPT polypeptide or an IDI2 polypeptide or an eIF4F-like protein complex subunit polypeptide or a GR-RBP polypeptide. The invention further relates to products derived from a harvestable part of such a plant, preferably derived directly, such as dry pellets or powders, oil, fat and fatty acids, starch or protein.

Gemäß einem bevorzugten Merkmal der Erfindung handelt es sich bei der modulierten Expression um erhöhte Expression. Verfahren zur Erhöhung der Expression von Nukleinsäuren oder Genen oder Genprodukten, sind im Fachgebiet gut beschrieben; und Beispiele sind im Abschnitt Definitionen gegeben.According to a preferred feature of the invention, the modulated expression is increased expression. Methods for increasing the expression of nucleic acids or genes or gene products are well described in the art; and examples are given in the Definitions section.

Wie vorstehend erwähnt, ist ein bevorzugtes Verfahren zum Modulieren, der Expression einer Nukleinsäuresequenz, die ein C3H-ähnliches Polypeptid, oder ein SPT-Polypeptid oder ein IDI2-Polypeptid oder ein eIF4F-ähnliches Proteinkomplex-Untereinheit-Polypeptid oder ein GR-RBP-Polypeptid kodiert, durch Einführen und Exprimieren einer Nukleinsäuresequenz, die ein C3H-ähnliches Polypeptid, oder ein SPT-Polypeptid oder ein IDI2-Polypeptid oder ein eIF4F-ähnliches Proteinkomplex-Untereinheit-Polypeptid oder ein GR-RBP-Polypeptid kodiert, in eine(r) Pflanze; die Wirkungen der Durchführung des Verfahrens, d. h. das Erhöhen der Ertragsmerkmale können auch unter Verwendung anderer bekannter Techniken erzielt werden, einschließlich, aber nicht beschränkt auf T-DNA-Activation-Tagging, TILLING, homologe Rekombination. Eine Beschreibung dieser Techniken findet sich im Abschnitt Definitionen.As mentioned above, a preferred method of modulating, expressing a nucleic acid sequence that is a C3H-like polypeptide, or an SPT polypeptide or an IDI2 polypeptide or an eIF4F-like protein complex subunit polypeptide or a GR-RBP polypeptide into a (r) by introducing and expressing a nucleic acid sequence encoding a C3H-like polypeptide, or an SPT polypeptide or an IDI2 polypeptide or an eIF4F-like protein complex subunit polypeptide or a GR-RBP polypeptide Plant; the effects of carrying out the process, d. H. Increasing the yield-related traits may also be achieved using other known techniques, including but not limited to T-DNA activation tagging, TILLING, homologous recombination. A description of these techniques can be found in the Definitions section.

Die vorliegende Erfindung umfasst auch die Verwendung von Nukleinsäuren, die C3H-ähnliche Polypeptide wie hier beschrieben kodieren, und die Verwendung dieser C3H-ähnlichen Polypeptide, oder SPT-Polypeptide oder IDI2-Polypeptide oder eIF4F-ähnlichen Proteinkomplex-Untereinheits-Polypeptide oder GR-RBP-Polypeptide zur Verbesserung eines der oben genannten Ertragsmerkmale in Pflanzen.The present invention also encompasses the use of nucleic acids encoding C3H-like polypeptides as described herein and the use of these C3H-like polypeptides, or SPT polypeptides or IDI2 polypeptides or eIF4F-like protein complex subunit polypeptides or GR-RBP Polypeptides for improving one of the above-mentioned yield-related traits in plants.

Nukleinsäuren, die ein C3H-ähnliches Polypeptid, oder ein SPT-Polypeptid oder ein IDI2-Polypeptid oder eine eIF4F-ähnliche Proteinkomplex-Untereinheit oder ein GR-RBP-Polypeptid wie hier beschrieben kodieren, oder die C3H-ähnlichen Polypeptide, oder SPT-Polypeptide oder IDI2-Polypeptide oder eIF4F-ähnlichen Proteinkomplex-Untereinheits-Polypeptide oder GR-RBP-Polypeptide selbst können Verwendung in Züchtungsprogrammen finden, in denen ein DNA-Marker identifiziert wird, der mit einem für ein C3H-ähnliches Polypeptid, oder ein SPT-Polypeptid oder ein IDI2-Polypeptid oder ein eIF4F-ähnliches Proteinkomplex-Untereinheits-Polypeptid oder ein GR-RBP-Polypeptid kodierenden Gen genetisch verknüpft sein kann. Die Nukleinsäuren/Gene oder die die C3H-ähnlichen Polypeptide, oder SPT-Polypeptide oder IDI2-Polypeptide oder eIF4F-ähnlichen Proteinkomplex-Untereinheits-Polypeptide oder GR-RBP-Polypeptide selbst können dazu verwendet werden, einen molekularen Marker zu bestimmen. Dieser DNA- oder Protein-Marker kann dann in Züchtungsprogrammen zur Selektion von Pflanzen mit verbesserten Ertragsmerkmalen, vorzugsweise verbesserten Samenertragsmerkmalen, verwendet werden, wie hier unter den erfindungsgemäßen Verfahren definiert. Nucleic acids encoding a C3H-like polypeptide, or an SPT polypeptide or IDI2 polypeptide, or an eIF4F-like protein complex subunit or a GR-RBP polypeptide as described herein, or the C3H-like polypeptides, or SPT polypeptides or IDI2 polypeptides or eIF4F-like protein complex subunit polypeptides or GR-RBP polypeptides themselves may find use in breeding programs in which a DNA marker identified with a C3H-like polypeptide, or an SPT polypeptide is identified or an IDI2 polypeptide or an eIF4F-like protein complex subunit polypeptide or gene encoding a GR-RBP polypeptide may be genetically linked. The nucleic acids / genes or the C3H-like polypeptides, or SPT polypeptides or IDI2 polypeptides or eIF4F-like protein complex subunit polypeptides or GR-RBP polypeptides themselves can be used to determine a molecular marker. This DNA or protein marker can then be used in breeding programs to select plants having improved yield-related traits, preferably improved seed yield traits, as defined herein by the methods of the invention.

Alleische Varianten einer Nukleinsäure/eines Gens, die/das ein CH3-ähnliches-Polypeptid kodiert, können auch Verwendung in Marker-unterstützten Züchtungsprogrammen finden. Bei solchen Züchtungsprogrammen ist manchmal das Einführen von allelischer Variation durch Mutagenbehandlung der Pflanzen erforderlich, wobei zum Beispiel EMS-Mutagenese verwendet wird; alternativ kann das Programm von einer Sammlung von allelischen Varianten so genannten ”natürlichen” Ursprungs ausgehen, die ohne Absicht hervorgerufen wurden. Dann erfolgt die Identifikation allelischer Varianten, zum Beispiel mittels PCR. Darauf folgt ein Schritt zur Selektion besserer allelischer Varianten der in Frage kommenden Sequenz, die einen besseren Ertrag liefern. Die Selektion wird gewöhnlich durchgeführt, indem man die Wachstumsleistung von Pflanzen verfolgt, die verschiedene allelische Varianten der in Frage kommenden Sequenz enthalten. Die Wachstumsleistung kann im Gewächshaus oder auf dem Feld verfolgt werden. Weitere Schritte sind gegebenenfalls u. a. das Kreuzen der Pflanzen, in denen die bessere allelische Variante identifiziert wurde, mit einer anderen Pflanze. Dies kann zum Beispiel zur Herstellung einer Kombination interessanter phänotypischer Merkmale verwendet werden.Allelic variants of a nucleic acid / gene encoding a CH3-like polypeptide may also find use in marker-assisted breeding programs. Such breeding programs sometimes require the introduction of allelic variation by mutagenic treatment of the plants using, for example, EMS mutagenesis; alternatively, the program may assume a collection of allelic variants of so-called "natural" origin, which were created without intention. Then the identification of allelic variants takes place, for example by means of PCR. This is followed by a step to select better allelic variants of the candidate sequence that will provide better yield. Selection is usually done by monitoring the growth performance of plants containing various allelic variants of the sequence of interest. The growth performance can be monitored in the greenhouse or in the field. Further steps may be necessary u. a. crossing the plants in which the better allelic variant has been identified with another plant. This can be used, for example, to produce a combination of interesting phenotypic features.

Nukleinsäuren, die C3H-ähnliche Polypeptide, oder SPT-Polypeptide oder IDI2-Polypeptide oder eIF4F-ähnliche Proteinkomplex-Untereinheits-Polypeptide oder GR-RBP-Polypeptide kodieren, können auch als Sonden zur genetischen und physikalischen Kartierung der Gene, von denen sie ein Teil sind, und als Marker für Merkmale, die mit diesen Genen verknüpft sind, verwendet werden. Diese Information kann für die Pflanzenzüchtung nützlich sein, um Linien mit gewünschten Phänotypen zu entwickeln. Eine solche Verwendung der Nukleinsäuren, die C3H-ähnliches Polypeptid, oder SPT-Polypeptid oder IDI2-Polypeptid oder eIF4F-ähnliches Proteinkomplex-Untereinheits-Polypeptid oder GR-RBP-Polypeptid kodieren, benötigt nur eine Nukleinsäuresequenz von mindestens 15 Nukleotiden Länge. Die Nukleinsäuren, die C3H-ähnliches Polypeptid, oder SPT-Polypeptid oder IDI2-Polypeptid oder eIF4F-ähnliches Proteinkomplex-Untereinheits-Polypeptid oder GR-RBP-Polypeptid kodieren, können als Restriktionsfragmentlängenpolymorphismus(RFLP)-Marker verwendet werden. Southern-Blots ( Sambrook J, Fritsch EF and Maniatis T (1989) Molecular Cloning, A Laboratory Manual ) von restriktions-gespaltener genomischer Pflanzen-DNA kann mit den Nukleinsäuren, die C3H-ähnliches Polypeptid, oder SPT-Polypeptid oder IDI2-Polypeptid oder eIF4F-ähnliches Proteinkomplex-Untereinheit-Polypeptid oder GR-RBP-Polypeptid PHDf-HD-kodieren, sondiert werden. Die erhaltenen Bandenmuster können dann genetischen Analysen mit Computerprogrammen unterworfen werden, wie MapMaker ( Lander et al. (1987) Genomics 1: 174–181 ), so dass man eine genetische Karte erhält. Die Nukleinsäuren können zudem zum Sondieren von Southern-Blots verwendet werden, die Restriktionsendonuklease behandelte genomische DNAs von einem Satz von Individuen enthalten, die die Eltern und die Nachfahren einer definierten genetischen Kreuzung repräsentieren. Die Segregation der DNA-Polymorphismen wird festgestellt und zur Berechnung der Position der Nukleinsäure, die C3H-ähnliches Polypeptid, oder SPT-Polypeptid oder IDI2-Polypeptid oder eIF4F-ähnliches Proteinkomplex-Untereinheit-Polypeptid oder ein GR-RBP-Polypeptid PHDf-HD-Polypeptid kodiert, in der genetischen Karte verwendet, die mit dieser Population erhalten wurde ( Botstein et al. (1980) Am. J. Hum. Genet. 32: 314–331 ).Nucleic acids encoding C3H-like polypeptides, or SPT polypeptides or IDI2 polypeptides or eIF4F-like protein complex subunit polypeptides or GR-RBP polypeptides may also be used as probes for genetically and physically mapping the genes of which they are a part are used as markers for traits associated with these genes. This information may be useful for plant breeding to develop lines of desired phenotypes. Such use of the nucleic acids encoding C3H-like polypeptide, or SPT polypeptide or IDI2 polypeptide or eIF4F-like protein complex subunit polypeptide or GR-RBP polypeptide only requires a nucleic acid sequence of at least 15 nucleotides in length. The nucleic acids encoding C3H-like polypeptide, or SPT polypeptide or IDI2 polypeptide or eIF4F-like protein complex subunit polypeptide or GR-RBP polypeptide may be used as Restriction Fragment Length Polymorphism (RFLP) markers. Southern blots ( Sambrook J, Fritsch EF and Maniatis T (1989) Molecular Cloning, A Laboratory Manual ) of restriction digested genomic plant DNA can be probed with the nucleic acids encoding C3H-like polypeptide, or SPT polypeptide or IDI2 polypeptide or eIF4F-like protein complex subunit polypeptide or GR-RBP polypeptide PHDf-HD become. The obtained band patterns can then be subjected to genetic analyzes with computer programs, such as MapMaker ( Lander et al. (1987) Genomics 1: 174-181 ), so that you get a genetic map. The nucleic acids may also be used to probe Southern blots containing restriction endonuclease-treated genomic DNAs from a set of individuals representing the parent and progeny of a defined genetic cross. Segregation of the DNA polymorphisms is determined and used to calculate the position of the nucleic acid, the C3H-like polypeptide, or SPT polypeptide or IDI2 polypeptide or eIF4F-like protein complex subunit polypeptide or a GR-RBP polypeptide PHDf-HD- Polypeptide used in the genetic map obtained with this population ( Botstein et al. (1980) Am. J. Hum. Genet. 32: 314-331 ).

Die Herstellung und Verwendung von Sonden, die von Pflanzengenen stammen, für die Verwendung bei der genetischen Kartierung ist in Bernatzky und Tanksley (1986) Plant Mol. Biol. Reporter 4: 37–41 beschrieben. Zahlreiche Veröffentlichungen beschreiben die genetische Kartierung spezifischer cDNA-Klone, wobei die vorstehend erläuterte Methodik oder Varianten davon verwendet werden. Für die Kartierung können zum Beispiel F2-Inzuchtpopulationen, Rückkreuzungspopulationen, zufallsgemäß gepaarte Populationen, nahezu isogene Linien und andere Sätze von Individuen verwendet werden. Diese Verfahren sind dem Fachmann sehr geläufig.The preparation and use of probes derived from plant genes for use in genetic mapping is described in US Pat Bernatzky and Tanksley (1986) Plant Mol. Biol. Reporter 4: 37-41 described. Numerous publications describe the genetic mapping of specific cDNA clones using the methodology or variants discussed above. For example, F2 inbred populations, backcrossing populations, randomly matched populations, near-isogenic lines, and other sets of individuals may be used for mapping. These methods are very familiar to the person skilled in the art.

Die Nukleinsäuresonden können auch zur physikalischen Kartierung (d. h. zum Anordnen von Sequenzen in physikalischen Karten; siehe Hoheisel et al. In: Non-mammalian Genomic Analysis: A Practical Guide, Academic Press 1996, S. 319–346 und darin genannte Literaturstellen) verwendet werden. The nucleic acid probes may also be used for physical mapping (ie, for arranging sequences in physical maps; Hoheisel et al. In: Non-mammalian Genomic Analysis: A Practical Guide, Academic Press 1996, pp. 319-346 and references cited therein).

In einer anderen Ausführungsform können die Nukleinsäuresonden zur Kartierung durch direkte Fluoreszenz-in-situ-Hybridisierung (FISH) ( Trask (1991) Trends Genet. 7: 149–154 ) verwendet werden. Zwar bevorzugen derzeitige FISH-Kartierungsverfahren die Verwendung großer Klone (mehrere kb bis mehrere Hundert kb; siehe Laan et al. (1995) Genome Res. 5: 13–20 ), aber durch Verbesserungen in der Empfindlichkeit kann die FISH-Kartierung auch unter Verwendung kürzerer Sonden durchgeführt werden.In another embodiment, the nucleic acid probes for direct fluorescence in situ hybridization (FISH) mapping (FISH) Trask (1991) Trends Genet. 7: 149-154 ) be used. Although current FISH mapping techniques favor the use of large clones (several kb to several hundred kb; Laan et al. (1995) Genome Res. 5: 13-20 ), but with improvements in sensitivity, FISH mapping can also be performed using shorter probes.

Eine Reihe von Verfahren auf Basis von Nukleinsäureamplifikation für die genetische und physikalische Kartierung kann unter Verwendung der Nukleinsäuresequenzen durchgeführt werden. Beispiele sind u. a. die allelspezifische Amplifikation ( Kazazian (1989) J. Lab. Clin. Med 11: 95–96 ), Polymorphismus PCR-amplifizierter Fragmente ( CAPS; Sheffield et al. (1993) Genomics 16: 325–332 ), allelspezifische Ligation ( Landegren et al. (1988) Science 241: 1077–1080 ), Nukleotidverlängerungsreaktionen ( Sokolov (1990) Nucleic Acid Res. 18: 3671 ), Radiation-Hybrid-Kartierung ( Walter et al. (1997) Nat. Genet. 7: 22–28 ) und Happy-Kartierung ( Dear und Cook (1989) Nucleic Acid Res. 17: 6795–6807 ). Bei diesen Verfahren wird die Sequenz einer Nukleinsäure dazu, Primer-Paare zu gestalten und zu erzeugen, die bei der Amplifikationsreaktion oder Primerverlängerungsreaktionen verwendet werden. Die Gestaltung dieser Primer ist dem Fachmann bekannt. Bei Verfahren, die eine genetische Kartierung auf PCR-Basis einsetzen, kann es notwendig sein, dass man DNA-Sequenz-Unterschiede zwischen den Eltern der Kartierungskreuzung in dem Bereich identifiziert, welcher der vorliegenden Nukleinsäuresequenz entspricht. Dies ist jedoch für Kartierungsverfahren nicht allgemein erforderlich.A number of methods based on nucleic acid amplification for genetic and physical mapping can be performed using the nucleic acid sequences. Examples include allele-specific amplification ( Kazazian (1989) J. Lab. Clin. Med. 11: 95-96 ), Polymorphism of PCR-amplified fragments ( CAPS; Sheffield et al. (1993) Genomics 16: 325-332 ), allele-specific ligation ( Landegren et al. (1988) Science 241: 1077-1080 ), Nucleotide extension reactions ( Sokolov (1990) Nucleic Acids Res. 18: 3671 ), Radiation hybrid mapping ( Walter et al. (1997) Nat. Genet. 7: 22-28 ) and happy mapping ( Dear and Cook (1989) Nucleic Acid Res. 17: 6795-6807 ). In these methods, the sequence of a nucleic acid becomes to design and generate primer pairs used in the amplification reaction or primer extension reactions. The design of these primers is known to the person skilled in the art. In methods employing PCR-based genetic mapping, it may be necessary to identify DNA sequence differences between the parents of the mapping cross in the region corresponding to the subject nucleic acid sequence. However, this is not generally required for mapping procedures.

Die erfindungsgemäßen Verfahren ergeben Pflanzen mit verbesserten Ertragsmerkmalen, wie hier vorstehend beschrieben. Diese Merkmale können auch mit anderen ökonomisch vorteilhaften Merkmalen kombiniert werden, wie weiteren Ertragsmerkmalen, Toleranz gegenüber anderen abiotischen und biotischen Stressbedingungen, Merkmalen, die verschiedene architektonische Merkmale und/oder biochemische und/oder physiologische Merkmale modifizieren.The methods of the present invention yield plants having improved yield-related traits, as described hereinabove. These features may also be combined with other economically advantageous features, such as other yield-related traits, tolerance to other abiotic and biotic stress conditions, features that modify various architectural features and / or biochemical and / or physiological features.

PunktePoints

1. C3H-ähnliche Polypeptide1. C3H-like polypeptides

• 1. Verfahren zum Verbessern der Ertragsmerkmale in Pflanzen im Vergleich zu Kontrollpflanzen, umfassend das Modulieren der Expression in einer Pflanze einer Nukleinsäure, die ein C3H-ähnliches Polypeptid kodiert, wobei das C3H-ähnliche Polypeptid Domäne 4 und eine oder mehrere der Domänen 1, 2, 3 und 5 umfasst: Domäne 1: C-X₂-C-X_12-23-C-X₂-C-X₂-G-F wobei X irgend eine Aminosäure ist, und die unterstrichenen Reste konserviert sind Domäne 2: Y-X_7-12-L-X₃-P-X₁₀-G wobei X irgend eine Aminosäure ist, und die unterstrichenen Reste konserviert sind Domäne 3: S-K-X₆-P wobei X irgend eine Aminosäure ist, und die unterstrichenen Reste konserviert sind Domäne 4: RING-C3H2C3 Typ Domäne 5: DUF1117 A method of enhancing yield-related traits in plants relative to control plants, comprising modulating expression in a plant of a nucleic acid encoding a C3H-like polypeptide, wherein the C3H-like polypeptide is domain 4 and one or more of domains 1, 2 , 3 and 5 comprises: domain 1: C - X ₂ - C - X _12-23 - C - X ₂ - C - X ₂ - G - F wherein X is any amino acid and the underlined residues are conserved domain 2: Y -X _7-12 - L -X ₃ - P -X ₁₀ - G where X is any amino acid, and the underlined residues are conserved domain 3: S - K -X ₆ - P where X is any amino acid, and the underlined residues are conserved domain 4: RING-C3H2C3 type domain 5: DUF1117
• 2. Verfahren nach Punkt 1, wobei Domäne 1 ist: CYSCTRFINLSDHTL----------IVCPHCDNGF, oder eine Domäne, umfassend die unterstrichenen konservierten Reste und mit in steigender Reihenfolge der Präferenz mindestens 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% oder mehr Sequenzidentität zu den nicht unterstrichenen Resten in Domäne 1, wobei ”-” eine Lücke oder irgend ein beliebiger Rest ist.2. The method of item 1, wherein domain 1 is: C YS C TRFINLSDHTL ---------- IV C PH C DN GF , or a domain comprising the underlined conserved residues and having in increasing order of preference at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more sequence identity to the non-underlined residues in domain 1, where "-" is a gap or any residue.
• 3. Verfahren nach Punkt 1 oder 2, wobei Domäne 2 ist: YDDGDG-----SGLRPLPPTVSEFLLGSG, oder eine Domäne, umfassend die unterstrichenen konservierten Reste und mit in steigender Reihenfolge der Präferenz mindestens 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% oder mehr Sequenzidentität zu den nicht unterstrichenen Resten in Domäne 2, wobei ”-” eine Lücke oder irgend ein beliebiger Rest ist.3. Method according to item 1 or 2, wherein domain 2 is: Y DDGDG ----- SG L RPL P PTVSEFLLGS G , or a domain comprising the underlined conserved residues and having in increasing order of preference at least 60%, 65% , 70%, 75%, 80%, 85%, 90%, 95% or more sequence identity to the non-underlined residues in domain 2, where "-" is a gap or any residue.
• 4. Verfahren nach einem der Punkte 1 bis 3, wobei Domäne 3 ist: SKAAIESMP, oder eine Domäne, umfassend die unterstrichenen konservierten Reste und mit in steigender Reihenfolge der Präferenz mindestens 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% oder mehr Sequenzidentität zu den nicht unterstrichenen Resten in Domäne 3.4. Method according to any one of items 1 to 3, wherein domain 3 is: SK AAIESM P , or a domain comprising the underlined conserved residues and having in increasing order of preference at least 60%, 65%, 70%, 75%, 80 %, 85%, 90%, 95% or more sequence identity to the non-underlined residues in domain 3.
• 5. Verfahren nach einem der Punkte 1 bis 4, wobei Domäne 4 ist: CAVCKEEFELHAEARELPCKHLYHSDCILPWLTVRNSCPVCR, oder eine Domäne, umfassend die unterstrichenen konservierten Reste und mit in steigender Reihenfolge der Präferenz mindestens 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% oder mehr Sequenzidentität zu den nicht unterstrichenen Resten in Domäne 4.5. The method according to any one of items 1 to 4, wherein the domain 4 is: CA VCKEEFELHAEAREL PC K H LY H SD C IL PW LTVRNSC P VCR, or a domain comprising the underlined conserved residues and having in increasing order of preference at least 60% , 65%, 70%, 75%, 80%, 85%, 90%, 95% or more sequence identity to the non-underlined residues in domain 4.
• 6. Verfahren nach einem der Punkte 1 bis 5, wobei die Domäne 5 ist: GLTIWRLPGGGFAVGRFSGGRSA-GESHFPVVYTEMDGGLN, oder eine Domäne mit in steigender Reihenfolge der Präferenz mindestens 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% oder mehr Sequenzidentität zu den nicht unterstrichenen Resten in Domäne 5, wobei ”-” eine Lücke oder irgend ein beliebiger Rest ist. 6. The method according to any one of items 1 to 5, wherein the domain is 5: GLTIWRLPGGGFAVGRFSGGRSA-GESHFPVVYTEMDGGLN, or a domain having in increasing order of preference at least 60%, 65%, 70%, 75%, 80%, 85%, 90 %, 95% or more sequence identity to the non-underlined residues in domain 5 where "-" is a gap or any residue.
• 7. Verfahren nach einem der Punkte 1 bis 6, wobei die modulierte Expression durch Einführen und Expression einer Nukleinsäure, die ein C3H-ähnliches Polypeptid kodiert, in eine(r) Pflanze erfolgt.7. Method according to any one of items 1 to 6, wherein said modulated expression is by introducing and expressing a nucleic acid encoding a C3H-like polypeptide into a plant.
• 8. Verfahren nach einem der Punkte 1 bis 7, wobei die Nukleinsäure, die ein C3H-ähnliches Polypeptid kodiert, irgend eines der Proteine kodiert, die in der Table A1 aufgeführt sind, oder ein Abschnitt einer solchen Nukleinsäure, oder eine Nukleinsäure ist, die an eine solche Nukleinsäure hybridisieren kann.8. The method according to any one of items 1 to 7, wherein the nucleic acid encoding a C3H-like polypeptide encodes any of the proteins listed in Table A1, or is a portion of such nucleic acid, or a nucleic acid, which can hybridize to such a nucleic acid.
• 9. Verfahren nach einem der Punkte 1 bis 8, wobei die Nukleinsäuresequenz ein Orthologon oder Paralogon von einem der in Tabelle A1 angegebenen Proteine kodiert.9. The method according to any one of items 1 to 8, wherein the nucleic acid sequence encodes an orthologue or paralogue of any of the proteins given in Table A1.
• 10. Verfahren nach einem vorhergehenden Punkt, wobei die verbesserten Ertragsmerkmale verbesserten Ertrag, vorzugsweise erhöhte Biomasse und/oder verbesserten Samenertrag im Vergleich zu Kontrollpflanzen umfassen.10. The method of any preceding item, wherein the improved yield-related traits comprise improved yield, preferably increased biomass and / or improved seed yield relative to control plants.
• 11. Verfahren nach einem der Punkte 1 bis 10, wobei die verbesserten Ertragsmerkmale unter Trockenheitsstressbedingungen erhalten werden.11. A method according to any one of items 1 to 10, wherein the improved yield-related traits are obtained under drought stress conditions.
• 12. Verfahren nach einem der Punkte 7 bis 11, wobei die Nukleinsäure funktionsfähig mit einem konstitutiven Promotor, vorzugsweise einem GOS2 Promotor, am stärksten bevorzugt einem GOS2 Promotor aus Reis verbunden ist.12. The method according to any one of items 7 to 11, wherein the nucleic acid is operably linked to a constitutive promoter, preferably a GOS2 promoter, most preferably a GOS2 promoter from rice.
• 13. Verfahren nach einem der Punkte 1 bis 12, wobei die Nukleinsäure, die ein C3H-ähnliches Polypeptid kodiert aus einer Pflanze stammt, vorzugsweise der Familie Medicago, stärker bevorzugt aus Medicago truncatula.13. The method according to any one of items 1 to 12, wherein the nucleic acid encoding a C3H-like polypeptide is derived from a plant, preferably the family Medicago, more preferably from Medicago truncatula.
• 14. Pflanze oder Teil davon, einschließlich Samen, erhältlich durch ein Verfahren nach einem der Punkte 1 bis 13, wobei die Pflanze oder der Teil davon eine rekombinante Nukleinsäure umfasst, die ein C3H-ähnliches Polypeptid kodiert.14. Plant or part thereof, including seeds, obtainable by a method according to any one of items 1 to 13, wherein the plant or part thereof comprises a recombinant nucleic acid encoding a C3H-like polypeptide.
• 15. Konstrukt, umfassend: (i) Nukleinsäure, die ein C3H-ähnliches Polypeptid nach einem der Punkte 1 bis 6 kodiert; (ii) eine oder mehrere Kontrollsequenzen, die die Expression der Nukleinsäuresequenz von (a) steuern können; und gegebenenfalls (iii) eine Transkriptionsterminationssequenz.15. Construct comprising: (i) nucleic acid encoding a C3H-like polypeptide according to any one of items 1 to 6; (ii) one or more control sequences capable of directing the expression of the nucleic acid sequence of (a); and optionally (iii) a transcription termination sequence.
• 16. Konstrukt nach Punkt 15, wobei eine der Kontrollsequenzen ein konstitutiver Promotor, vorzugsweise ein GOS2 Promotor, am stärksten bevorzugt ein GOS2 Promotor aus Reis ist.16. Construct according to item 15, wherein one of the control sequences is a constitutive promoter, preferably a GOS2 promoter, most preferably a GOS2 promoter from rice.
• 17. Verwendung eines Konstrukts nach Punkt 15 oder 16 in einem Verfahren zur Herstellung von Pflanzen mit verbessertem Ertrag, insbesondere erhöhter Biomasse und/oder verbessertem Samenertrag im Vergleich zu Kontrollpflanzen.17. Use of a construct according to item 15 or 16 in a process for the production of plants with improved yield, in particular increased biomass and / or improved seed yield in comparison to control plants.
• 18. Pflanze, Pflanzenteil oder Pflanzenzelle, transformiert mit einem Konstrukt nach Punkt 15 oder 16.18. Plant, plant part or plant cell transformed with a construct according to item 15 or 16.
• 19. Verfahren zur Herstellung einer transgenen Pflanze mit verbessertem Ertrag, insbesondere erhöhter Biomasse und/oder verbessertem Samenertrag im Vergleich zu Kontrollpflanzen, umfassend: (i) Einführen und Exprimieren einer Nukleinsäure, die ein C3H-ähnliches Polypeptid nach einem oder mehreren der Punkte 1 bis 6 kodiert, in eine(r) Pflanze; und (ii) Züchten der Pflanzenzelle unter Bedingungen, die das Pflanzenwachstum und die Entwicklung fördern.19. A method for producing a transgenic plant with improved yield, in particular increased biomass and / or improved seed yield in comparison to control plants, comprising: (i) introducing and expressing in a plant a nucleic acid encoding a C3H-like polypeptide according to one or more of items 1 to 6; and (ii) growing the plant cell under conditions that promote plant growth and development.
• 20. Transgene Pflanze mit verbessertem Ertrag, insbesondere erhöhter Biomasse und/oder verbessertem Samenertrag im Vergleich zu Kontrollpflanzen, die sich aus der modulierten Expression einer Nukleinsäure, die ein C3H-ähnliches Polypeptid nach einem der Punkte 1 bis 6 kodiert, ergeben, oder eine transgene Pflanzenzelle, die aus der transgenen Pflanze hergeleitet ist.20. A transgenic plant with improved yield, in particular increased biomass and / or improved seed yield compared to control plants, resulting from the modulated expression of a nucleic acid encoding a C3H-like polypeptide according to any one of items 1 to 6, or a transgenic Plant cell derived from the transgenic plant.
• 21. Transgene Pflanze nach Punkt 14, 18 oder 20, oder eine davon hergeleitete transgene Pflanzenzelle, wobei die Pflanze eine Kulturpflanze oder eine Monokotyle oder ein Getreide ist, wie Reis, Mais, Weizen, Gerste, Hirse, Roggen, Triticale, Sorghum, Emmer, Dinkel, Secale, Einkorn, Zwerghirse, Mohrenhirse und Hafer.21. A transgenic plant according to item 14, 18 or 20, or a transgenic plant cell derived therefrom, the plant being a crop plant or a monocot or a cereal such as rice, maize, wheat, barley, millet, rye, triticale, sorghum, emmer , Spelled, Secale, Einkorn, Zwerghirse, Mohrenhirse and oats.
• 22. Erntefähige Teile einer Pflanze nach Punkt 21, wobei die erntefähigen Teile vorzugsweise Sprossbiomasse und/oder Samen sind.22. Harvestable parts of a plant according to item 21, wherein the harvestable parts are preferably shoot biomass and / or seeds.
• 23. Produkte hergeleitet von einer Pflanze nach Punkt 21 und/oder von erntefähigen Teilen einer Pflanze nach Punkt 22.23. Products derived from a plant according to item 21 and / or from harvestable parts of a plant according to item 22.
• 24. Verwendung einer Nukleinsäure, die ein C3H-ähnliches Polypeptid kodiert bei der Verbesserung des Ertrags, insbesondere bei der Verbesserung des Samenertrags und/oder der Sprossbiomasse in Pflanzen, im Vergleich zu Kontrollpflanzen.24. Use of a nucleic acid encoding a C3H-like polypeptide in enhancing yield, especially in enhancing seed yield and / or shoot biomass in plants, as compared to control plants.

2. SPATULA-ähnliche (SPT) Polypeptide 2. SPATULA-like (SPT) polypeptides

• 1. Verfahren zum Verbessern der Ertragsmerkmale in Pflanzen im Vergleich zu Kontrollpflanzen, umfassend das Modulieren der Expression in einer Pflanze einer Nukleinsäure, die ein SPT-ähnliches Polypeptid kodiert, umfassend vorzugsweise vom N-Terminus zum C-Terminus jeweils die folgenden: Motiv I: eine amphipathische Helix, umfassend EEISTFLHQLLH, oder ein Motiv mit in steigender Reihenfolge der Präferenz mindestens 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% oder mehr Sequenzidentität zu Motiv I. Motiv II: eine saure Domäne, umfassend DLGDFSCDSEK, oder ein Motiv mit in steigender Reihenfolge der Präferenz mindestens 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% oder mehr Sequenzidentität zu Motiv II; und Motiv III: eine bHLH Domäne, umfassend: AAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEYLKQL, oder ein Motiv mit in steigender Reihenfolge der Präferenz mindestens 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% oder mehr Sequenzidentität zu Motiv III.A method of enhancing yield-related traits in plants relative to control plants comprising modulating expression in a plant of a nucleic acid encoding an SPT-like polypeptide, preferably comprising from N-terminus to C-terminus each of the following: Motif I: an amphipathic helix comprising EEISTFLHQLLH, or a motif having in increasing order of preference at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more sequence identity to motif I. Motif II: an acidic domain comprising DLGDFSCDSEK or a motif having in increasing order of preference at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more sequence identity to motif II; and Motif III: a bHLH domain comprising: AAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEYLKQL, or a motif having in increasing order of preference at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more sequence identity to motif III ,
• 2. Verfahren nach Punkt 1, wobei das SPT-ähnliche Polypeptid zudem eine oder mehrere serinreiche Regionen umfasst.2. The method of item 1, wherein the SPT-like polypeptide further comprises one or more serine-rich regions.
• 3. Verfahren nach Punkt 1 oder 2, wobei die bHLH Domäne zudem ein oder mehrere Kernlokalisationssignale (NLS) umfasst.3. Method according to item 1 or 2, wherein the bHLH domain additionally comprises one or more nuclear localization signals (NLS).
• 4. Verfahren nach einem der Punkte 1 bis 3, wobei das SPT-ähnliche Polypeptid einen beta Strang neben der bHLH Domäne nächst der C-terminalen Region aufweist, wobei der beta-Strang vorzugsweise QLQVQMLTM umfasst.4. The method of any one of items 1 to 3, wherein the SPT-like polypeptide has a beta strand adjacent to the bHLH domain next to the C-terminal region, wherein the beta strand preferably comprises QLQVQMLTM.
• 5. Verfahren nach einem der Punkte 1 bis 4, wobei die modulierte Expression durch Einführen und Exprimieren einer Nukleinsäure, die ein SPT-ähnliches Polypeptid kodiert, in eine(r) Pflanze erfolgt.5. The method of any one of items 1 to 4, wherein the modulated expression is by introducing and expressing a nucleic acid encoding an SPT-like polypeptide into a plant.
• 6. Verfahren nach einem der Punkte 1 bis 5, wobei die Nukleinsäure, die ein SPT-ähnliches Polypeptid kodiert, irgend eines der Proteine kodiert, die in der Table A2 aufgeführt sind, oder ein Abschnitt einer solchen Nukleinsäure, oder eine Nukleinsäure ist, die an eine solche Nukleinsäure hybridisieren kann.6. The method according to any one of items 1 to 5, wherein the nucleic acid encoding an SPT-like polypeptide encodes any of the proteins listed in Table A2, or is a portion of such a nucleic acid, or a nucleic acid, which can hybridize to such a nucleic acid.
• 7. Verfahren nach einem der Punkte 1 bis 6, wobei die Nukleinsäuresequenz ein Orthologon oder Paralogon von einem der in Tabelle A2 angegebenen Proteine kodiert.7. The method according to any one of items 1 to 6, wherein the nucleic acid sequence encodes an orthologue or paralogue of one of the proteins indicated in Table A2.
• 8. Verfahren nach einem vorhergehenden Punkt, wobei die verbesserten Ertragsmerkmale verbesserten Ertrag, vorzugsweise erhöhte Biomasse und/oder verbesserten Samenertrag im Vergleich zu Kontrollpflanzen umfassen.8. The method of any preceding item, wherein the improved yield-related traits comprise improved yield, preferably increased biomass and / or improved seed yield relative to control plants.
• 9. Verfahren nach einem der Punkte 1 bis 8, wobei die verbesserten Ertragsmerkmale unter Nichtstressbedingungen erhalten werden.9. Method according to any one of items 1 to 8, wherein the improved yield-related traits are obtained under non-stress conditions.
• 10. Verfahren nach einem der Punkte 1 bis 9, wobei die verbesserten Ertragsmerkmale unter Bedingungen von Trockenheitsstress, Salzstress oder Stickstoffmangel erhalten werden.10. A method according to any one of items 1 to 9, wherein the improved yield-related traits are obtained under conditions of drought stress, salt stress or nitrogen deficiency.
• 11. Verfahren nach einem der Punkte 3 bis 8, wobei die Nukleinsäure funktionsfähig mit einem konstitutiven Promotor, vorzugsweise einem GOS2 Promotor, am stärksten bevorzugt einem GOS2 Promotor aus Reis verbunden ist.11. The method according to any one of items 3 to 8, wherein the nucleic acid is operably linked to a constitutive promoter, preferably a GOS2 promoter, most preferably a GOS2 promoter from rice.
• 12. Verfahren nach einem der Punkte 1 bis 11, wobei die Nukleinsäure, die ein SPT-ähnliches Polypeptid kodiert, pflanzlichen Ursprungs ist, vorzugsweise aus der Familie Salicaceae, stärker bevorzugt aus der Gattung Populus, am stärksten bevorzugt aus Populus trichocarpa.12. Method according to any one of items 1 to 11, wherein the nucleic acid encoding an SPT-like polypeptide is of plant origin, preferably from the family Salicaceae, more preferably from the genus Populus, most preferably from Populus trichocarpa.
• 13. Pflanze oder Teil davon, einschließlich Semen, erhältlich durch ein Verfahren nach einem der Punkte 1 bis 12, wobei die Pflanze oder das Teil davon eine rekombinante Nukleinsäure, die ein SPT-ähnliches Polypeptid kodiert nach einem der Punkte 1 bis 4 umfasst.13. Plant or part thereof, including Semen, obtainable by a method according to any one of items 1 to 12, wherein said plant or part thereof comprises a recombinant nucleic acid encoding an SPT-like polypeptide according to any one of items 1 to 4.
• 14. Konstrukt umfassend: (i) Nukleinsäure, die ein SPT-ähnliches Polypeptid nach einem der Punkte 1 bis 4 kodiert; (ii) eine oder mehrere Kontrollsequenzen, die die Expression der Nukleinsäuresequenz von (a) steuern können; und gegebenenfalls (iii) eine Transkriptionsterminationssequenz.14. Construct comprising: (i) nucleic acid encoding an SPT-like polypeptide according to any one of items 1 to 4; (ii) one or more control sequences capable of directing the expression of the nucleic acid sequence of (a); and optionally (iii) a transcription termination sequence.
• 15. Konstrukt nach Punkt 14, wobei eine der Kontrollsequenzen ein konstitutiver Promotor, vorzugsweise ein GOS2 Promotor, am stärksten bevorzugt ein GOS2 Promotor aus Reis ist.15. Construct according to item 14, wherein one of the control sequences is a constitutive promoter, preferably a GOS2 promoter, most preferably a GOS2 promoter from rice.
• 16. Verwendung eine Konstrukts nach Punkt 14 oder 15 in einem Verfahren zur Herstellung von Pflanzen mit verbessertem Ertrag, insbesondere erhöhter Biomasse und/oder verbessertem Samenertrag im Vergleich zu Kontrollpflanzen.16. Use of a construct according to item 14 or 15 in a process for the production of plants with improved yield, in particular increased biomass and / or improved seed yield in comparison to control plants.
• 17. Pflanze, Pflanzenteil oder Pflanzenzelle, transformiert mit einem Konstrukt nach Punkt 14 oder 15.17. Plant, plant part or plant cell transformed with a construct according to item 14 or 15.
• 18. Verfahren zur Herstellung einer transgenen Pflanze mit verbessertem Ertrag, insbesondere erhöhter Biomasse und/oder verbessertem Samenertrag im Vergleich zu Kontrollpflanzen, umfassend: (i) Einführen und Exprimieren einer Nukleinsäure, die ein SPT-ähnliches Polypeptid nach einem der Punkte 1 bis 4 kodiert, in eine(r) Pflanze; und (ii) Züchten der Pflanzenzelle unter Bedingungen, die das Pflanzenwachstum und die Entwicklung fördern. 18. A method for producing a transgenic plant with improved yield, in particular increased biomass and / or improved seed yield in comparison to control plants, comprising: (i) introducing and expressing a nucleic acid encoding an SPT-like polypeptide of any one of items 1 to 4 into a plant; and (ii) growing the plant cell under conditions that promote plant growth and development.
• 19. Transgene Pflanze mit verbessertem Ertrag, insbesondere erhöhter Biomasse und/oder verbessertem Samenertrag im Vergleich zu Kontrollpflanzen, die sich aus der modulierten Expression einer Nukleinsäure, die ein SPT-ähnliches Polypeptid nach einem der Punkte 1 bis 4 kodiert, ergeben, oder eine transgene Pflanzenzelle, die aus der transgenen Pflanze hergeleitet ist.19. A transgenic plant with improved yield, in particular increased biomass and / or improved seed yield compared to control plants, resulting from the modulated expression of a nucleic acid encoding an SPT-like polypeptide according to any one of items 1 to 4, or a transgenic Plant cell derived from the transgenic plant.
• 20. Transgene Pflanze nach Punkt 13, 17 oder 19, oder eine davon hergeleitete transgene Pflanzenzelle, wobei die Pflanze eine Kulturpflanze oder eine Monokotyle oder ein Getreide ist, wie Reis, Mais, Weizen, Gerste, Hirse, Roggen, Triticale, Sorghum, Emmer, Dinkel, Secale, Einkorn, Zwerghirse, Mohrenhirse und Hafer.20. Transgenic plant according to item 13, 17 or 19, or a transgenic plant cell derived therefrom, the plant being a crop or a monocot or a cereal, such as rice, maize, wheat, barley, millet, rye, triticale, sorghum, emmer , Spelled, Secale, Einkorn, Zwerghirse, Mohrenhirse and oats.
• 21. Erntefähige Teile einer Pflanze nach Punkt 20, wobei die erntefähigen Teile vorzugsweise Sprossbiomasse und/oder Samen sind.21. Harvestable parts of a plant according to item 20, wherein the harvestable parts are preferably shoot biomass and / or seeds.
• 22. Produkte hergeleitet von einer Pflanze nach Punkt 20 und/oder von erntefähigen Teilen einer Pflanze nach Punkt 21.22. Products derived from a plant according to item 20 and / or from harvestable parts of a plant according to item 21.
• 23. Verwendung einer Nukleinsäure, die ein SPT-ähnliches Polypeptid nach einem der Punkte 1 bis 4 kodiert bei der Verbesserung des Ertrags, insbesondere bei der Verbesserung des Samenertrags und/oder der Sprossbiomasse in Pflanzen, im Vergleich zu Kontrollpflanzen.23. Use of a nucleic acid encoding a SPT-like polypeptide according to any one of items 1 to 4 in improving the yield, in particular in improving the seed yield and / or shoot biomass in plants, compared to control plants.

3. IDI2 (Eisenmangel-induziert 2) Polypeptide3. IDI2 (iron deficiency-induced 2) polypeptides

• 1. Verfahren zum Verbessern der Ertragsmerkmale in Pflanzen im Vergleich zu Kontrollpflanzen, umfassend das Modulieren der Expression in einer Pflanze einer Nukleinsäure, die ein IDI2-Polypeptid kodiert, wobei das IDI2-Polypeptid eine IF-2B-Domäne umfasst.A method of enhancing yield-related traits in plants relative to control plants, comprising modulating expression in a plant of a nucleic acid encoding an IDI2 polypeptide, wherein the IDI2 polypeptide comprises an IF-2B domain.
• 2. Verfahren nach Punkt 1, wobei das IDI2 Polypeptid ein oder mehrere der Motive nach SEQ ID NO: 141 bis SEQ ID NO: 146 umfasst.2. The method of item 1, wherein the IDI2 polypeptide comprises one or more of the motifs of SEQ ID NO: 141 to SEQ ID NO: 146.
• 3. Verfahren nach Punkt 1 oder 2, wobei die modulierte Expression durch Einführen und Expression einer Nukleinsäure, die ein IDI2-Polypeptid kodiert, in eine(r) Pflanze erfolgt.3. Method according to item 1 or 2, wherein the modulated expression is performed by introducing and expressing a nucleic acid encoding an IDI2 polypeptide into a plant.
• 4. Verfahren nach einem der Punkte 1 bis 3, wobei die Nukleinsäure, die ein IDI2-Polypeptid kodiert, irgend eines der Proteine kodiert, die in der Table A3 aufgeführt sind, oder ein Abschnitt einer solchen Nukleinsäure, oder eine Nukleinsäure ist, die an eine solche Nukleinsäure hybridisieren kann.4. The method according to any one of items 1 to 3, wherein the nucleic acid encoding an IDI2 polypeptide encodes any of the proteins listed in Table A3, or is a portion of such nucleic acid, or nucleic acid, to such a nucleic acid can hybridize.
• 5. Verfahren nach einem der Punkte 1 bis 4, wobei die Nukleinsäuresequenz ein Orthologon oder Paralogon von einem der in Tabelle A3 angegebenen Proteine kodiert.5. The method according to any one of items 1 to 4, wherein the nucleic acid sequence encodes an orthologue or paralogue of any of the proteins given in Table A3.
• 6. Verfahren nach einem vorhergehenden Punkt, wobei die verbesserten Ertragsmerkmale verbesserten Ertrag, vorzugsweise verbesserten Samenertrag im Vergleich zu Kontrollpflanzen umfassen.6. The method of any preceding item, wherein the improved yield-related traits comprise improved yield, preferably improved seed yield relative to control plants.
• 7. Verfahren nach einem der Punkte 1 bis 6, wobei die verbesserten Ertragsmerkmale unter Stickstoffmangelbedingungen erhalten werden.7. Method according to any one of items 1 to 6, wherein the improved yield-related traits are obtained under nitrogen deficiency conditions.
• 8. Verfahren nach einem der Punkte 3 bis 7, wobei die Nukleinsäure funktionsfähig mit einem konstitutiven Promotor, vorzugsweise einem GOS2 Promotor, am stärksten bevorzugt einem GOS2 Promotor aus Reis verbunden ist.8. Method according to any one of items 3 to 7, wherein the nucleic acid is operably linked to a constitutive promoter, preferably a GOS2 promoter, most preferably a GOS2 promoter from rice.
• 9. Verfahren nach einem der Punkte 1 bis 8, wobei die Nukleinsäure, die ein IDI2-Polypeptid kodiert aus einer Pflanze stammt, vorzugsweise einer monokotyledonen Pflanze, vorzugsweise der Familie Poaceae, stärker bevorzugt aus der Gattung Saccharum, am stärksten bevorzugt aus Saccharum officinarum.9. Method according to any one of items 1 to 8, wherein the nucleic acid encoding an IDI2 polypeptide is from a plant, preferably a monocotyledonous plant, preferably the family Poaceae, more preferably from the genus Saccharum, most preferably from Saccharum officinarum.
• 10. Pflanze oder Teil davon, einschließlich Samen, erhältlich durch ein Verfahren nach einem der Punkte 1 bis 9, wobei die Pflanze oder der Teil davon eine rekombinante Nukleinsäure umfasst, die ein IDI2-Polypeptid kodiert.A plant or part thereof, including seeds, obtainable by a method according to any one of items 1 to 9, wherein the plant or part thereof comprises a recombinant nucleic acid encoding an IDI2 polypeptide.
• 11. Konstrukt, umfassend: (i) Nukleinsäure, die ein IDI2-Polypeptid nach den Punkten 1 oder 2 kodiert; (ii) eine oder mehrere Kontrollsequenzen, die die Expression der Nukleinsäuresequenz von (a) steuern können; und gegebenenfalls (iii) eine Transkriptionsterminationssequenz.11. Construct comprising: (i) nucleic acid encoding an IDI2 polypeptide according to items 1 or 2; (ii) one or more control sequences capable of directing the expression of the nucleic acid sequence of (a); and optionally (iii) a transcription termination sequence.
• 12. Konstrukt nach Punkt 11, wobei eine der Kontrollsequenzen ein konstitutiver Promotor, vorzugsweise ein GOS2 Promotor, am stärksten bevorzugt ein GOS2 Promotor aus Reis ist.12. Construct according to item 11, wherein one of the control sequences is a constitutive promoter, preferably a GOS2 promoter, most preferably a GOS2 promoter from rice.
• 13. Verwendung eines Konstrukts nach Punkt 11 oder 12 in einem Verfahren zur Herstellung von Pflanzen mit verbessertem Ertrag, insbesondere verbessertem Samenertrag im Vergleich zu Kontrollpflanzen.13. Use of a construct according to item 11 or 12 in a process for the production of plants with improved yield, in particular improved seed yield compared to control plants.
• 14. Pflanze, Pflanzenteil oder Pflanzenzelle, transformiert mit einem Konstrukt nach Punkt 11 oder 12.14. Plant, plant part or plant cell transformed with a construct according to item 11 or 12.
• 15. Verfahren zur Herstellung einer transgenen Pflanze mit verbessertem Ertrag, verbessertem Samenertrag im Vergleich zu Kontrollpflanzen, umfassend: (i) Einführen und Exprimieren einer Nukleinsäure, die ein IDI2-Polypeptid nach Punkt 1 oder 6 kodiert, in eine(r) Pflanze; und (ii) Züchten der Pflanzenzelle unter Bedingungen, die das Pflanzenwachstum und die Entwicklung fördern.15. A method of producing a transgenic plant having improved yield, improved seed yield relative to control plants, comprising: (i) introducing and expressing a nucleic acid encoding an IDI2 polypeptide according to item 1 or 6 into a plant; and (ii) growing the plant cell under conditions that promote plant growth and development.
• 16. Transgene Pflanze mit verbessertem Ertrag, insbesondere erhöhter Biomasse und/oder verbessertem Samenertrag im Vergleich zu Kontrollpflanzen, die sich aus der modulierten Expression einer Nukleinsäure, die ein IDI2-Polypeptid nach Punkt 1 oder 2 kodiert, ergeben, oder eine transgene Pflanzenzelle, die aus der transgenen Pflanze hergeleitet ist.16. Transgenic plant with improved yield, in particular increased biomass and / or improved seed yield compared to control plants, resulting from the modulated expression of a nucleic acid encoding an IDI2 polypeptide according to item 1 or 2, or a transgenic plant cell, the derived from the transgenic plant.
• 17. Transgene Pflanze nach Punkt 10, 14 oder 16, oder eine davon hergeleitete transgene Pflanzenzelle, wobei die Pflanze eine Kulturpflanze oder eine Monokotyle oder ein Getreide ist, wie Reis, Mais, Weizen, Gerste, Hirse, Roggen, Triticale, Sorghum, Emmer, Dinkel, Secale, Einkorn, Zwerghirse, Mohrenhirse und Hafer.17. A transgenic plant according to item 10, 14 or 16, or a transgenic plant cell derived therefrom, the plant being a crop plant or a monocot or a cereal such as rice, corn, wheat, barley, millet, rye, triticale, sorghum, emmer , Spelled, Secale, Einkorn, Zwerghirse, Mohrenhirse and oats.
• 18. Erntefähige Teile einer Pflanze nach Punkt 17, wobei die erntefähigen Teile vorzugsweise Samen sind.18. Harvestable parts of a plant according to item 17, wherein the harvestable parts are preferably seeds.
• 19. Produkte hergeleitet von einer Pflanze nach Punkt 17 und/oder von erntefähigen Teilen einer Pflanze nach Punkt 18.19. Products derived from a plant according to item 17 and / or from harvestable parts of a plant according to item 18.
• 20. Verwendung einer Nukleinsäure, die ein IDI2-Polypeptid kodiert bei der Verbesserung des Ertrags, insbesondere bei der Verbesserung des Samenertrags in Pflanzen, im Vergleich zu Kontrollpflanzen.20. Use of a nucleic acid encoding an IDI2 polypeptide in improving yield, particularly in enhancing seed yield in plants, as compared to control plants.
• 21. Isoliertes Nukleinsäuremolekül, ausgewählt aus: (i) einer Nukleinsäure nach einer von SEQ ID NO: 139, 157, 164, 169, 171, 186; (ii) das Komplement einer Nukleinsäure nach einer von SEQ ID NO: 139, 157, 164, 169, 171, 186; (iii) eine Nukleinsäure, die ein IDI2 Polypeptid kodiert mit in steigender Reihenfolge der Präferenz mindestens 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% oder mehr Sequenzidentität zu den Aminosäuresequenzen nach einer von SEQ ID NO: 140, 202, 209, 214, 216, 231, und umfassend ein oder mehrere der Motive 1 bis 6.21. An isolated nucleic acid molecule selected from: (i) a nucleic acid according to any one of SEQ ID NOs: 139, 157, 164, 169, 171, 186; (ii) the complement of a nucleic acid of any one of SEQ ID NOs: 139, 157, 164, 169, 171, 186; (iii) a nucleic acid encoding an IDI2 polypeptide having in increasing order of preference at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96% , 97%, 98%, 99% or more sequence identity to the amino acid sequences of any of SEQ ID NO: 140, 202, 209, 214, 216, 231, and comprising one or more of motifs 1 to 6.
• 22. Isoliertes Polypeptid, ausgewählt aus: (i) einer Aminosäuresequenz nach einer von SEQ ID NO: 140, 202, 209, 214, 216, 231; (ii) einer Aminosäuresequenz mit in steigender Reihenfolge der Präferenz 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% oder mehr Sequenzidentität zu den Aminosäuresequenzen nach einer von SEQ ID NO: 140, 202, 209, 214, 216, 231, und umfassend ein oder mehrere der Motive 1 bis 6; Derivate von einer der in (i) oder (ii) oben angegebenen Aminosäuresequenzen.22. Isolated polypeptide selected from: (i) an amino acid sequence according to any one of SEQ ID NO: 140, 202, 209, 214, 216, 231; (ii) an amino acid sequence with in increasing order of preference 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more sequence identity to the amino acid sequences of any one of SEQ ID NO: 140, 202, 209, 214, 216, 231, and comprising one or more of motifs 1 to 6; Derivatives of any of the amino acid sequences given in (i) or (ii) above.

4. eIF4F-ähnlicher Proteinkomplex4. eIF4F-like protein complex

• 1. Verfahren zum Verbessern der Ertragsmerkmale in Pflanzen im Vergleich zu Kontrollpflanzen, umfassend das Modulieren der Aktivität des eIF4F-ähnlichen Proteinkomplexes durch Modulation und Expression seiner Untereinheits-Polypeptide und/oder Isoformen davon und/oder durch Modulieren des Spiegels des eIF4F-ähnlichen Proteinkomplexes, wobei der eIF4F-ähnliche Proteinkomplex die Untereinheiten eIF4G, eIF4A und eIF4F oder Isoformen davon umfasst, umfassend jeweils die folgenden CC Domänen mit den PFam Zugangsnummern: (i) für eIF4G Polypeptide: MA3 (PFam Zugangsnummer: PF02847) und MIF4G (PFam Zugangsnummer: PF02854); (ii) für eIF4A Polypeptide: DEAD (PFam Zugangsnummer: PF00270) und Helicase_C (PFam Zugangsnummer: PF00271); (iii) für eIF4F Polypeptide: IF4E (PFam Zugangsnummer: PF01652).A method for enhancing yield-related traits in plants relative to control plants, comprising modulating the activity of the eIF4F-like protein complex by modulation and expression of its subunit polypeptides and / or isoforms thereof and / or by modulating the level of the eIF4F-like protein complex, wherein the eIF4F-like protein complex comprises the subunits eIF4G, eIF4A and eIF4F or isoforms thereof, each comprising the following CC domains having the PFam accession numbers: (i) for eIF4G polypeptides: MA3 (PFam accession number: PF02847) and MIF4G (PFam accession number: PF02854); (ii) for eIF4A polypeptides: DEAD (PFam accession number: PF00270) and Helicase_C (PFam accession number: PF00271); (iii) for eIF4F polypeptides: IF4E (PFam accession number: PF01652).
• 2. Verfahren nach Punkt 1, wobei das eIF4G Untereinheits-Polypeptid eine CC-Domäne umfasst (i) nach SEQ ID NO: 240, und/oder (ii) vorzugsweise mit mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% Sequenzidentität zu eIF4G Polypeptiden nach SEQ ID NO: 241.2. The method of item 1, wherein the eIF4G subunit polypeptide comprises a CC domain (i) of SEQ ID NO: 240, and / or (ii) preferably of at least 50%, 51%, 52%, 53%, 54 %, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97% , 98%, or 99% sequence identity to eIF4G polypeptides according to SEQ ID NO: 241.
• 3. Verfahren nach Punkt 1, wobei das eIF4A Untereinheits-Polypeptid eine CC-Domäne umfasst (i) nach SEQ ID NO: 300, und/oder (ii) vorzugsweise mit mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% Sequenzidentität zu eIF4G Polypeptiden nach SEQ ID NO: 301.3. The method of item 1, wherein the eIF4A subunit polypeptide comprises a CC domain (i) according to SEQ ID NO: 300, and / or (ii) preferably at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64% , 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to eIF4G polypeptides according to SEQ ID NO: 301.
• 4. Verfahren nach Punkt 1, wobei das eIF4E Untereinheits-Polypeptid eine CC-Domäne umfasst (i) nach SEQ ID NO: 560, und/oder (ii) vorzugsweise mit mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% Sequenzidentität zu eIF4G Polypeptiden nach SEQ ID NO: 561.4. The method of item 1, wherein the eIF4E subunit polypeptide comprises a CC domain (i) according to SEQ ID NO: 560, and / or (ii) preferably at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64% , 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to eIF4G polypeptides according to SEQ ID NO: 561.
• 5. Verfahren nach den Punkten 1 oder 2, wobei die eIF4G Untereinheits-Polypeptide die folgenden Motive umfassen: Motiv 7: KAV[LF]EPTFCPMYA[QL]LCSDLNEKLP[PS]FPS[ED]EPGGKEITFKRVLLN[NI]CQEAF oder ein Motiv mit in steigender Reihenfolge der Präferenz mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% oder mehr Sequenzidentität zu Motiv 7; Motiv 8: CP[AE]EENVEAIC[QH]FFNTIGKQLDE[SN]PKSRRIND[MVT]YF[SIN][RQ]LKEL[TS][TS]NPQLAPR oder ein Motiv mit in steigender Reihenfolge der Präferenz mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% oder mehr Sequenzidentität zu Motiv 8. Motiv 9: T[AG]P[DE]QE[ML]ERRDKERLVKLRTLGNIRLIGELLKQKMVPEKIVHHIVQELLG oder ein Motiv mit in steigender Reihenfolge der Präferenz mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% oder mehr Sequenzidentität zu Motiv 9; oder Motiv 10: TPQNF[ED][KR]LFEQVKAVNIDN[AV]VTL[TN]GVISQIF[DE]KALMEPTFCEMYANFCFH oder ein Motiv mit in steigender Reihenfolge der Präferenz mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% oder mehr Sequenzidentität zu Motiv 10; Motiv 11: IGELYKK[RK]MLTERIMHECIKKLLGQYQ[DN]PDEE[DN][IV]E[AS]LCKLMSTIGEMIDH oder ein Motiv mit in steigender Reihenfolge der Präferenz mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% oder mehr Sequenzidentität zu Motiv 11; Motiv 12: LSNN[MQ][KN]LSSRVRFMLKD[ASV]IDLRKNKWQQRRKVEGPKKIEEVHRDAAQERQ oder ein Motiv mit in steigender Reihenfolge der Präferenz mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% oder mehr Sequenzidentität zu Motiv 12.5. Method according to item 1 or 2, wherein the eIF4G subunit polypeptides comprise the following motifs: Motif 7: KAV [LF] EPTFCPMYA [QL] LCSDLNEKLP [PS] FPS [ED] EPGGKEITFKRVLLN [NI] CQEAF or a motif with in increasing order of preference at least 50%, 51%, 52%, 53%, 54%, 55 %, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88% , 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more sequence identity to motif 7; Motive 8: CP [AE] EENVEAIC [QH] FFNTIGKQLDE [SN] PKSRRIND [MVT] YF [SIN] [RQ] LKEL [TS] [TS] NPQLAPR or a motif with in increasing order of preference at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68% , 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85 %, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more Sequence identity to motif 8 , Motif 9: T [AG] P [DE] QE [ML] ERRDKERLVKLRTLGNIRLIGELLKQKMVPEKIVHHIVQELLG or a motif with in increasing order of preference at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74% , 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more sequence identity to motif 9; or Motif 10: TPQNF [ED] [KR] LFEQVKAVNIDN [AV] VTL [TN] GVISQIF [DE] KALMEPTFCEMYANFCFH or a subject with in increasing order of preference at least 50%, 51%, 52%, 53%, 54%, 55% 56% 57% 58% 59% 60% 61% 62% 63% 64% 65% 66% 67% 68% 69% 70% 71% 72 %, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more sequence identity to motif 10; Motif 11: IGELYKK [RK] MLTERIMHECIKKLLGQYQ [DN] PDEE [DN] [IV] E [AS] LCKLMSTIGEMIDH or a subject with in increasing order of preference at least 50%, 51%, 52%, 53%, 54%, 55% 56% 57% 58% 59% 60% 61% 62% 63% 64% 65% 66% 67% 68% 69% 70% 71% 72 %, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more sequence identity to motif 11; Motive 12: LSNN [MQ] [KN] LSSRVRFMLKD [ASV] IDLRKNKWQQRRKVEGPKKIEEVHRDAAQERQ or a subject with in increasing order of preference at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58 %, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91% , 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more sequence identity to motif 12.
• 6. Verfahren nach Punkt 5, wobei die eIF4G Untereinheits-Polypeptide vorzugsweise ein eIF4isoG Polypeptid sind und die folgenden Motive umfassen: Motiv 7: KAV[LF]EPTFCPMYA[QL]LCSDLNEKLP[PS]FPS[ED]EPGGKEITFKRVLLN[NI]CQEAF oder ein Motiv mit in steigender Reihenfolge der Präferenz mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% oder mehr Sequenzidentität zu Motiv 7; Motiv 8: CP[AE]EENVEAIC[QH]FFNTIGKQLDE[SN]PKSRRIND[MVT]YF[SIN][RQ]LKEL[TS][TS]NPQLAPR oder ein Motiv mit in steigender Reihenfolge der Präferenz mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% oder mehr Sequenzidentität zu Motiv 8. Motiv 9: T[AG]P[DE]QE[ML]ERRDKERLVKLRTLGNIRLIGELLKQKMVPEKIVHHIVQELLG oder ein Motiv mit in steigender Reihenfolge der Präferenz mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% oder mehr Sequenzidentität zu Motiv 9.6. The method of item 5, wherein the eIF4G subunit polypeptides are preferably an eIF4isoG polypeptide and include the following motifs: Motif 7: KAV [LF] EPTFCPMYA [QL] LCSDLNEKLP [PS] FPS [ED] EPGGKEITFKRVLLN [NI] CQEAF or a motif with in increasing order of preference at least 50%, 51%, 52%, 53%, 54%, 55 %, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88% , 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more sequence identity to motif 7; Motive 8: CP [AE] EENVEAIC [QH] FFNTIGKQLDE [SN] PKSRRIND [MVT] YF [SIN] [RQ] LKEL [TS] [TS] NPQLAPR or a motif with in increasing order of preference at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68% , 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85 %, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more Sequence identity to motif 8 , Motif 9: T [AG] P [DE] QE [ML] ERRDKERLVKLRTLGNIRLIGELLKQKMVPEKIVHHIVQELLG or a motif with in increasing order of preference at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74% , 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more sequence identity to motif 9.
• 7. Verfahren nach Punkt 1 oder 3, wobei die eIF4A Untereinheits-Polypeptide die folgenden Motive umfassen: Motiv 13: RDELTLEGIKQF[YF]V[NA]V[ED][KR]EEWK[LF][DE]TLCDLY[ED]TL[AT]ITQ[SA]VIF oder ein Motiv mit in steigender Reihenfolge der Präferenz mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% oder mehr Sequenzidentität zu Motiv 13. Motiv 14: SLVINYDLP[TN][QN][PR]E[NL]Y[LI]HRIGRSGRFGRKGVAINF oder ein Motiv mit in steigender Reihenfolge der Präferenz mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% oder mehr Sequenzidentität zu Motiv 14. Motiv 15: MG[LI][QK]E[ND]LLRGIYAYGFEKPSAIQQR[GA][IV]VP[FI][CI]KG[LR]DVI[QA]QAQSGTGKT[AS][TM][FI] oder ein Motiv mit in steigender Reihenfolge der Präferenz mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% oder mehr Sequenzidentität zu Motiv 15. 7. Method according to item 1 or 3, wherein the eIF4A subunit polypeptides comprise the following motifs: motif 13: RDELTLEGIKQF [YF] V [NA] V [ED] [KR] EEWK [LF] [DE] TLCDLY [ED] TL [AT] ITQ [SA] VIF or a motive with in ascending order of preference at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60% , 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77 %, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more Sequence identity to motif 13. Motif 14: SLVINYDLP [TN] [QN] [PR] E [NL] Y [LI] HRIGRSGRFGRKGVAINF or a motif with in order of preference at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64 %, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97% , 98%, or 99% or more sequence identity to motif 14. Motif 15: MG [LI] [QK] E [ ND] LLRGIYAYGFEKPSAIQQR [GA] [IV] VP [FI] [CI] KG [LR] DVI [QA] QAQSGTGKT [AS] [TM] [FI] or a motif with in increasing order of preference at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68% , 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85 %, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more Sequence identity to motif 15 ,
• 8. Verfahren nach Punkt 1 oder 4, wobei die eIF4E Untereinheits-Polypeptide die folgenden Motive umfassen: Motiv 16: YTFSTVE[ED]FW[SG]LYNNIH[HR]PSKLAVGADF[HY]CFK[NH]KIEPKWEDP[VI]CANGGKW oder ein Motiv mit in steigender Reihenfolge der Präferenz mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% oder mehr Sequenzidentität zu Motiv 16; Motiv 17: T[SC]WLYTLLA[ML]IGEQFD[HY]GD[ED]ICGAVV[NS]VR oder ein Motiv mit in steigender Reihenfolge der Präferenz mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% oder mehr Sequenzidentität zu Motiv 17; Motiv 18: E[KR]I[AS][LI]WTKNA[AS]NE[AST]AQ[VL]SIGKQWKEFLDYN[DE][TS]IGFIFH[ED]DA oder ein Motiv mit in steigender Reihenfolge der Präferenz mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% oder mehr Sequenzidentität zu Motiv 18; oder Motiv 19: WCLYDQ[IV]F[KR]PSKLP[GA]NADFHLFKAG[VI]EPKWEDPECANGGKW oder ein Motiv mit in steigender Reihenfolge der Präferenz mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% oder mehr Sequenzidentität zu Motiv 19; Motiv 20: L[ED]TMWLETLMALIGEQFD[ED][AS][DE][ED]ICGVVASVR oder ein Motiv mit in steigender Reihenfolge der Präferenz mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% oder mehr Sequenzidentität zu Motiv 20; Motiv 21: QDKL[SA]LWT[KR][TN]A[AS]NEA[AV]QM[SG]IG[RK]KWKE[IV]ID oder ein Motiv mit in steigender Reihenfolge der Präferenz mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% oder mehr Sequenzidentität zu Motiv 21.8. Method according to item 1 or 4, wherein the eIF4E subunit polypeptides comprise the following motifs: Motif 16: YTFSTVE [ED] FW [SG] LYNNIH [HR] PSKLAVGADF [HY] CFK [NH] KIEPKWEDP [VI] CANGGKW or a motif with in increasing order of preference at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70% 71% 72% 73% 74% 75% 76% 77% 78% 79% 80% 81% 82% 83% 84% 85% 86% 87 %, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more Sequence identity to motif 16; Motif 17: T [SC] WLYTLLA [ML] IGEQFD [HY] GD [ED] ICGAVV [NS] VR or a motive with in increasing order of preference at least 50%, 51%, 52%, 53%, 54%, 55 %, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88% , 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more sequence identity to motif 17; Motif 18: E [KR] I [AS] [LI] WTKNA [AS] NE [AST] AQ [VL] SIGKQWKEFLDYN [DE] [TS] IGFIFH [ED] DA or a subject with at least 50% in increasing order of preference , 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67 %, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 or more Sequence identity to motif 18; or Motive 19: WCLYDQ [IV] F [KR] PSKLP [GA] NADFHLFKAG [VI] EPKWEDPECANGGKW or a motive with in increasing order of preference at least 50%, 51%, 52%, 53%, 54%, 55%, 56% 57% 58% 59% 60% 61% 62% 63% 64% 65% 66% 67% 68% 69% 70% 71% 72% 73 %, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more sequence identity to motif 19; Subject 20: L [ED] TMWLETLMALIGEQFD [ED] [AS] [DE] [ED] ICGVVASVR or a subject with increasing order of preference of at least 50%, 51%, 52%, 53%, 54%, 55%, 56 %, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89% , 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more sequence identity to motif 20; Motive 21: QDKL [SA] LWT [KR] [TN] A [AS] NEA [AV] QM [SG] IG [RK] KWKE [IV] ID or a motive with in increasing order of preference at least 50%, 51% , 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68 %, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% or more Sequence identity to subject 21st
• 9. Verfahren nach einem der Punkte 1 bis 8, wobei das Modulieren der Expression von mindestens einer der Untereinheiten eIF4E, eIF4G und eIF4A durch Einführen und Exprimieren von mindestens einer Nukleinsäure, die eines der eIF4F Untereinheits-Polypeptide oder eines Abschnitts von mindestens diesen Nukleinsäuren, oder einer Nukleinsäure, die mit einer solchen Nukleinsäure hybridisieren kann, erfolgt.9. The method of any one of items 1 to 8, wherein modulating the expression of at least one of the subunits eIF4E, eIF4G and eIF4A by introducing and expressing at least one of Nucleic acid which is one of the eIF4F subunit polypeptides or a portion of at least these nucleic acids, or a nucleic acid capable of hybridizing with such nucleic acid.
• 10. Verfahren nach den Punkten 1, 2, 5 oder 6, wobei die Nukleinsäure das eIF4G Untereinheits-Polypeptid und/oder seine Isoformen kodiert, oder einen Abschnitt einer solchen Nukleinsäure, oder eine Nukleinsäure, die mit einer solchen Nukleinsäure hybridisieren kann, wobei das eIF4F Untereinheits-Polypeptid vorzugsweise die eIF4isoG Untereinheit ist.10. The method according to items 1, 2, 5 or 6, wherein the nucleic acid encodes the eIF4G subunit polypeptide and / or its isoforms, or a portion of such a nucleic acid, or a nucleic acid that can hybridize with such a nucleic acid, wherein the eIF4F subunit polypeptide is preferably the eIF4isoG subunit.
• 11. Verfahren nach Punkt 1, 3 oder 7, wobei die Nukleinsäure das eIF4A Untereinheits-Polypeptid und/oder seine Isoformen kodiert, oder einen Abschnitt einer solchen Nukleinsäure, oder eine Nukleinsäure, die mit einer solchen Nukleinsäure hybridisieren kann, wobei das eIF4F Untereinheits-Polypeptid vorzugsweise die eIF4A Untereinheit ist.11. Method according to item 1, 3 or 7, wherein the nucleic acid encodes the eIF4A subunit polypeptide and / or its isoforms, or a portion of such a nucleic acid, or a nucleic acid which can hybridize with such a nucleic acid, wherein the eIF4F subunit Polypeptide is preferably the eIF4A subunit.
• 12. Verfahren nach Punkt 1, 4 oder 8, wobei die Nukleinsäure das eIF4E Untereinheits-Polypeptid und/oder seine Isoformen kodiert, oder einen Abschnitt einer solchen Nukleinsäure, oder eine Nukleinsäure, die mit einer solchen Nukleinsäure hybridisieren kann, wobei das eIF4F Untereinheits-Polypeptid vorzugsweise die eIF4isoE Untereinheit ist.12. Method according to item 1, 4 or 8, wherein the nucleic acid encodes the eIF4E subunit polypeptide and / or its isoforms, or a portion of such a nucleic acid, or a nucleic acid which can hybridize with such a nucleic acid, wherein the eIF4F subunit Polypeptide is preferably the eIF4isoE subunit.
• 13. Verfahren einem der Punkte 1 bis 12, wobei die Nukleinsäuren, oder ein Abschnitt einer solchen Nukleinsäure, oder eine Nukleinsäure, die mit einer solchen Nukleinsäure, die eIF4F Untereinheits-Polypeptide kodiert, überexprimiert werden, vorzugsweise solche, die eIF4G und/oder eIF4A und/oder Isoformen kodieren, insbesondere solche, die eIF4isoG und/oder eIF4A kodieren.13. Method one of items 1 to 12, wherein the nucleic acids, or a portion of such a nucleic acid, or a nucleic acid, which are overexpressed with such a nucleic acid encoding eIF4F subunit polypeptides, preferably those which eIF4G and / or eIF4A and / or isoforms, especially those encoding eIF4isoG and / or eIF4A.
• 14. Verfahren einem der Punkte 1 bis 13, wobei die Nukleinsäuresequenz ein Orthologon oder Paralogon von einem der in den Tabellen A4 angegebenen Polypeptide kodiert.14. A method of any one of items 1 to 13, wherein the nucleic acid sequence encodes an orthologue or paralogue of any of the polypeptides set forth in Tables A4.
• 15. Verfahren einem der Punkte 1 bis 14, wobei die verbesserten Ertragsmerkmale verbesserten Ertrag, vorzugsweise erhöhte Biomasse und/oder verbesserten Samenertrag im Vergleich zu Kontrollpflanzen umfassen.15. The method of any one of items 1 to 14, wherein the improved yield-related traits comprise improved yield, preferably increased biomass and / or improved seed yield relative to control plants.
• 16. Verfahren einem der Punkte 1 bis 15, wobei die verbesserten Ertragsmerkmale unter Nichtstressbedingungen erhalten werden.16. The method of any one of items 1 to 15, wherein the improved yield-related traits are obtained under non-stress conditions.
• 17. Verfahren einem der Punkte 1 bis 16, wobei die verbesserten Ertragsmerkmale unter Bedingungen von Trockenheitsstress, Salzstress oder Stickstoffmangel erhalten werden.17. A method of any one of items 1 to 16, wherein the improved yield-related traits are obtained under conditions of drought stress, salt stress or nitrogen deficiency.
• 18. Verfahren einem der Punkte 3 bis 17, wobei die Nukleinsäure funktionsfähig mit einem konstitutiven Promotor, vorzugsweise einem GOS2 Promoter, am stärksten bevorzugt einem GOS2 Promotor aus Reis verbunden ist.18. Method according to any one of items 3 to 17, wherein the nucleic acid is operably linked to a constitutive promoter, preferably a GOS2 promoter, most preferably a GOS2 promoter from rice.
• 19. Verfahren einem der Punkte 1 bis 18, wobei die Nukleinsäure, die mindestens eine eIF4F Polypeptid-Untereinheit kodiert, pflanzlichen Ursprungs ist, vorzugsweise aus einer dicotyledonen Pflanze, weiter bevorzugt aus der Familie Brassicaceae, stärker bevorzugt aus der Gattung Arabidopsis, am stärksten bevorzugt aus Arabidopsis thaliana.19. Method one of items 1 to 18, wherein the nucleic acid encoding at least one eIF4F polypeptide subunit is of plant origin, preferably from a dicotyledonous plant, more preferably from the family Brassicaceae, more preferably from the genus Arabidopsis, most preferably from Arabidopsis thaliana.
• 20. Pflanze oder Teil davon, einschließlich Samen, erhältlich durch ein Verfahren nach einem der Punkte 1 bis 19, wobei die Pflanze oder der Teil davon mindestens eine rekombinante Nukleinsäure umfasst, die eine eIF4F Polypeptid-Untereinheit kodiert.A plant or part thereof, including seeds, obtainable by a method according to any one of items 1 to 19, wherein the plant or part thereof comprises at least one recombinant nucleic acid encoding an eIF4F polypeptide subunit.
• 21. Konstrukt, umfassend: (i) Nukleinsäure, die mindestens eine eIF4F Polypeptid-Untereinheit nach Punkt 1 oder 2 kodiert; (ii) eine oder mehrere Kontrollsequenzen, die die Expression der Nukleinsäuresequenz von (a) steuern können; und gegebenenfalls (iii) eine Transkriptionsterminationssequenz.21. Construct comprising: (i) nucleic acid encoding at least one eIF4F polypeptide subunit according to item 1 or 2; (ii) one or more control sequences capable of directing the expression of the nucleic acid sequence of (a); and optionally (iii) a transcription termination sequence.
• 22. Konstrukt nach Punkt 21, wobei eine der Kontrollsequenzen ein konstitutiver Promotor, vorzugsweise ein GOS2 Promotor, am stärksten bevorzugt ein GOS2 Promotor aus Reis ist.22. Construct according to item 21, wherein one of the control sequences is a constitutive promoter, preferably a GOS2 promoter, most preferably a GOS2 promoter from rice.
• 23. Verwendung eines Konstrukts nach Punkt 21 oder 22 in einem Verfahren zur Herstellung von Pflanzen mit verbessertem Ertrag, insbesondere erhöhter Biomasse und/oder verbessertem Samenertrag im Vergleich zu Kontrollpflanzen.23. Use of a construct according to item 21 or 22 in a process for the production of plants with improved yield, in particular increased biomass and / or improved seed yield compared to control plants.
• 24. Pflanze, Pflanzenteil oder Pflanzenzelle, transformiert mit einem Konstrukt nach Punkt 21 oder 22.24. Plant, plant part or plant cell transformed with a construct according to item 21 or 22.
• 25. Verfahren zur Herstellung einer transgenen Pflanze mit verbessertem Ertrag, insbesondere erhöhter Biomasse und/oder verbessertem Samenertrag im Vergleich zu Kontrollpflanzen, umfassend: (i) Einführen und Exprimieren einer Nukleinsäure, die mindestens eine eIF4F-Polypeptid-Untereinheit nach Punkte 1 oder 2 kodiert, in eine(r) Pflanze; und (ii) Züchten der Pflanzenzelle unter Bedingungen, die das Pflanzenwachstum und die Entwicklung fördern.25. A method for producing a transgenic plant with improved yield, in particular increased biomass and / or improved seed yield in comparison to control plants, comprising: (i) introducing and expressing a nucleic acid encoding at least one eIF4F polypeptide subunit according to items 1 or 2 into a plant; and (ii) growing the plant cell under conditions that promote plant growth and development.
• 26. Transgene Pflanze mit verbessertem Ertrag, insbesondere erhöhter Biomasse und/oder verbessertem Samenertrag im Vergleich zu Kontrollpflanzen, die sich aus der modulierten Expression von mindestens einer Nukleinsäure, die eine eIF4F-Polypeptid-Untereinheit nach Punkt 1 oder 2 kodiert, ergeben, oder eine transgene Pflanzenzelle, die aus der transgenen Pflanze hergeleitet ist.26. Transgenic plant with improved yield, in particular increased biomass and / or improved seed yield compared to control plants, resulting from the modulated expression of at least one nucleic acid encoding an eIF4F polypeptide subunit according to item 1 or 2, or a transgenic plant cell derived from the transgenic plant.
• 27. Transgene Pflanze nach Punkt 20, 24 oder 26, oder eine davon hergeleitete transgene Pflanzenzelle, wobei die Pflanze eine Kulturpflanze oder eine Monokotyle oder ein Getreide ist, wie Reis, Mais, Weizen, Gerste, Hirse, Roggen, Triticale, Sorghum, Emmer, Dinkel, Secale, Einkorn, Zwerghirse, Mohrenhirse und Hafer.27. Transgenic plant according to item 20, 24 or 26, or a transgenic plant cell derived therefrom, the plant being a crop plant or a monocot or a cereal, such as rice, maize, wheat, Barley, millet, rye, triticale, sorghum, emmer, spelled, secale, einkorn, millet, sorghum and oats.
• 28. Erntefähige Teile einer Pflanze nach Punkt 27, wobei die erntefähigen Teile vorzugsweise Sprossbiomasse und/oder Samen sind.28. Harvestable parts of a plant according to item 27, wherein the harvestable parts are preferably shoot biomass and / or seeds.
• 29. Produkte hergeleitet von einer Pflanze nach Punkt 27 und/oder von erntefähigen Teilen einer Pflanze nach Punkt 28.29. Products derived from a plant according to item 27 and / or from harvestable parts of a plant according to item 28.
• 30. Verwendung einer Nukleinsäure, die mindestens eine eIF4F-Polypeptid-Untereinheit kodiert bei der Verbesserung des Ertrags, insbesondere bei der Verbesserung des Samenertrags und/oder der Sprossbiomasse in Pflanzen, im Vergleich zu Kontrollpflanzen.30. Use of a nucleic acid encoding at least one eIF4F polypeptide subunit in improving yield, especially in enhancing seed yield and / or shoot biomass in plants, as compared to control plants.
• 31. Isoliertes Nukleinsäuremolekül, ausgewählt aus: (i) einer Nukleinsäure nach SEQ ID NO: 306; (ii) dem Komplement einer Nukleinsäure nach SEQ ID NO: 306; (iii) einer Nukleinsäure, die das Polypeptid nach einer von SEQ ID NO: 307 kodiert, vorzugsweise als Ergebnis der Degeneration des genetischen Codes, wobei die isolierte Nukleinsäure hergeleitet werden kann von einer Polypeptidsequenz nach SEQ ID NO: 307 und zudem vorzugsweise verbesserte Ertragsmerkmale im Vergleich zu Kontrollpflanzen verleiht; (iv) Nukleinsäure mit in steigender Reihenfolge der Präferenz mindestens 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% Sequenzidentität zu einer der Nukleinsäuresequenzen der Tabellen A4 und die vorzugsweise verbesserte Ertragsmerkmale im Vergleich zu Kontrollpflanzen verleiht; (v) ein Nukleinsäuremolekül, das mit einem Nukleinsäuremolekül von (i) bis (iv) unter stringenten Hybridisierungsbedingungen hybridisiert und die vorzugsweise verbesserte Ertragsmerkmale im Vergleich zu Kontrollpflanzen verleiht; (vi) Nukleinsäure, die mindestens ein eIF4F Untereinheits-Polypeptid kodiert mit in steigender Reihenfolge der Präferenz mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% Sequenzidentität zu der Aminosäuresequenz nach SEQ ID NO: 307 und eine der anderen Aminosäuresequenzen in den Tabellen A4 und die vorzugsweise verbesserte Ertragsmerkmale im Vergleich zu Kontrollpflanzen verleiht.31. Isolated nucleic acid molecule selected from: (i) a nucleic acid according to SEQ ID NO: 306; (ii) the complement of a nucleic acid of SEQ ID NO: 306; (iii) a nucleic acid encoding the polypeptide of any one of SEQ ID NO: 307, preferably as a result of the degeneracy of the genetic code, wherein the isolated nucleic acid can be derived from a polypeptide sequence of SEQ ID NO: 307 and also preferably improved yield-related traits in the Confers comparison with control plants; (iv) nucleic acid having in increasing order of preference at least 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59% , 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76 %, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% confer sequence identity to any of the nucleic acid sequences of Tables A4 and which preferably provides improved yield-related traits relative to control plants; (v) a nucleic acid molecule which hybridizes to a nucleic acid molecule of (i) to (iv) under stringent hybridization conditions and which preferably confers improved yield-related traits relative to control plants; (vi) nucleic acid encoding at least one eIF4F subunit polypeptide having in increasing order of preference at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76% , 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93 %, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 307 and one of the other amino acid sequences in Tables A4, conferring preferably improved yield-related traits relative to control plants.
• 32. Isoliertes Polypeptid, ausgewählt aus: (i) einer Aminosäuresequenz nach SEQ ID NO: 307; (ii) einer Aminosäuresequenz mit in steigender Reihenfolge der Präferenz mindestens 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, oder 99% Sequenzidentität zu der Aminosäuresequenz nach SEQ ID NO: 307 und eine der anderen Aminosäuresequenzen in den Tabellen A4 und die vorzugsweise verbesserte Ertragsmerkmale im Vergleich zu Kontrollpflanzen verleiht. (iii) Derivate von einer der in (i) oder (ii) oben angegebenen Aminosäuresequenzen.32. Isolated polypeptide selected from: (i) an amino acid sequence of SEQ ID NO: 307; (ii) an amino acid sequence with, in order of preference, at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62% 63% 64% 65% 66% 67% 68% 69% 70% 71% 72% 73% 74% 75% 76% 77% 78% 79 %, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to the amino acid sequence of SEQ ID NO: 307 and one of the other amino acid sequences in Tables A4, and conferring preferably improved yield-related traits relative to control plants. (iii) derivatives of any of the amino acid sequences given in (i) or (ii) above.

5. GR-RBP (Glycin-reiches-RNA Bindungsprotein) Polypeptide5. GR-RBP (glycine-rich RNA binding protein) polypeptides

• 1. Verfahren zum Verbessern der Ertragsmerkmale in Pflanzen im Vergleich zu Kontrollpflanzen, umfassend das Modulieren der Expression in einer Pflanze einer Nukleinsäure, die ein Glycin-reiches-RNA Bindungsprotein (GR-RBP-Polypeptid) kodiert, wobei das GR-RBP Polypeptid ein RNA Erkennungsmotiv 1 (PFam Zugangsnummer PF00076, RRM_1) umfasst.A method of enhancing yield-related traits in plants relative to control plants, comprising modulating expression in a plant of a nucleic acid encoding a glycine-rich RNA binding protein (GR-RBP polypeptide), wherein the GR-RBP polypeptide is an RNA Recognition motif 1 (PFam accession number PF00076, RRM_1).
• 2. Verfahren nach Punkt 1, wobei das GR-RBP Polypeptid eine oder mehrere der in SEQ ID NO: 828 bis SEQ ID NO: 837 angegebenen Signatursequenzen umfasst.2. The method of item 1, wherein the GR-RBP polypeptide comprises one or more of the signature sequences set forth in SEQ ID NO: 828 through SEQ ID NO: 837.
• 3. Verfahren nach Punkt 1 oder 2, wobei die modulierte Expression durch Einführen und Expression einer Nukleinsäure, die ein GR-RBP Polypeptid kodiert, in eine(r) Pflanze erfolgt.3. The method of item 1 or 2, wherein the modulated expression is by introducing and expressing a nucleic acid encoding a GR-RBP polypeptide into a plant.
• 4. Verfahren nach einem der Punkte 1 bis 3, wobei die Nukleinsäure, die ein GR-RBP-Polypeptid kodiert, irgend eines der Proteine kodiert, die in der Table A5 aufgeführt sind, oder ein Abschnitt einer solchen Nukleinsäure, oder eine Nukleinsäure ist, die an eine solche Nukleinsäure hybridisieren kann.4. The method according to any one of items 1 to 3, wherein the nucleic acid encoding a GR-RBP polypeptide encodes any of the proteins listed in Table A5, or is a portion of such nucleic acid, or nucleic acid, which can hybridize to such a nucleic acid.
• 5. Verfahren nach einem der Punkte 1 bis 4, wobei die Nukleinsäuresequenz ein Orthologon oder Paralogon von einem der in Tabelle A5 angegebenen Proteine kodiert.5. The method according to any one of items 1 to 4, wherein the nucleic acid sequence encodes an orthologue or paralogue of any of the proteins given in Table A5.
• 6. Verfahren nach einem vorhergehenden Punkt, wobei die verbesserten Ertragsmerkmale erhöhte Jungpflanzenvitalität und/oder verbesserten Ertrag, vorzugsweise erhöhte Biomasse und/oder verbesserten Samenertrag im Vergleich zu Kontrollpflanzen umfassen.6. The method of any preceding item, wherein the enhanced yield-related traits comprise increased early vigor and / or improved yield, preferably increased biomass, and / or improved seed yield relative to control plants.
• 7. Verfahren nach einem der Punkte 1 bis 6, wobei die verbesserten Ertragsmerkmale unter Trockenheitsstressbedingungen erhalten werden. 7. A method according to any one of items 1 to 6, wherein the improved yield-related traits are obtained under drought stress conditions.
• 8. Verfahren nach einem der Punkte 1 bis 6, wobei die verbesserten Ertragsmerkmale unter Nichtstressbedingungen erhalten werden.8. Method according to any one of items 1 to 6, wherein the improved yield-related traits are obtained under non-stress conditions.
• 9. Verfahren nach einem der Punkte 3 bis 8, wobei die Nukleinsäure funktionsfähig mit einem konstitutiven Promotor, vorzugsweise einer GOS2 Promotor, am stärksten bevorzugt einem GOS2 Promotor aus Reis verbunden ist.9. Method according to any one of items 3 to 8, wherein the nucleic acid is operably linked to a constitutive promoter, preferably a GOS2 promoter, most preferably a GOS2 promoter from rice.
• 10. Verfahren nach einer der Punkte 1 bis 9, wobei die Nukleinsäure, die ein GR-RBP Polypeptid kodiert, aus einer Pflanze stammt, vorzugsweise aus einer monokotyledonen Pflanze, stärker bevorzugt aus der Familie Poaceae, stärker bevorzugt aus der Gattung Oryza, am stärksten bevorzugt aus Oryza sativa.10. The method according to any one of items 1 to 9, wherein the nucleic acid encoding a GR-RBP polypeptide is derived from a plant, preferably from a monocotyledonous plant, more preferably from the family Poaceae, more preferably from the genus Oryza preferably from Oryza sativa.
• 11. Pflanze oder Teil davon, einschließlich Samen, erhältlich durch ein Verfahren nach einem der Punkte 1 bis 10, wobei die Pflanze oder der Teil davon eine rekombinante Nukleinsäure umfasst, die ein GR-RBP-Polypeptid kodiert.A plant or part thereof, including seeds, obtainable by a method according to any one of items 1 to 10, wherein the plant or part thereof comprises a recombinant nucleic acid encoding a GR-RBP polypeptide.
• 12. Konstrukt, umfassend: (i) Nukleinsäure, die ein GR-RBP-Polypeptid nach den Punkten 1 oder 2 kodiert; (ii) eine oder mehrere Kontrollsequenzen, die die Expression der Nukleinsäuresequenz von (a) steuern können; und gegebenenfalls (iii) eine Transkriptionsterminationssequenz.12. Construct comprising: (i) nucleic acid encoding a GR-RBP polypeptide according to items 1 or 2; (ii) one or more control sequences capable of directing the expression of the nucleic acid sequence of (a); and optionally (iii) a transcription termination sequence.
• 13. Konstrukt nach Punkt 12, wobei eine der Kontrollsequenzen ein konstitutiver Promotor, vorzugsweise ein GOS2 Promotor, am stärksten bevorzugt ein GOS2 Promotor aus Reis ist.13. Construct according to item 12, wherein one of the control sequences is a constitutive promoter, preferably a GOS2 promoter, most preferably a GOS2 promoter from rice.
• 14. Verwendung eines Konstrukts nach Punkt 12 oder 13 in einem Verfahren zur Herstellung von Pflanzen mit verbessertem Ertrag, insbesondere erhöhter Biomasse und/oder verbessertem Samenertrag im Vergleich zu Kontrollpflanzen.14. Use of a construct according to item 12 or 13 in a process for the production of plants with improved yield, in particular increased biomass and / or improved seed yield compared to control plants.
• 15. Pflanze, Pflanzenteil oder Pflanzenzelle, transformiert mit einem Konstrukt nach Punkt 12 oder 13.15. Plant, plant part or plant cell transformed with a construct according to item 12 or 13.
• 16. Verfahren zur Herstellung einer transgenen Pflanze mit verbessertem Ertrag, insbesondere erhöhter Biomasse und/oder verbessertem Samenertrag im Vergleich zu Kontrollpflanzen, umfassend: (i) Einführen und Exprimieren einer Nukleinsäure, die ein GR-RBP-Polypeptid nach Punkt 1 oder 2 kodiert, in eine(r) Pflanze; und (ii) Züchten der Pflanzenzelle unter Bedingungen, die das Pflanzenwachstum und die Entwicklung fördern.16. A method for producing a transgenic plant with improved yield, in particular increased biomass and / or improved seed yield compared to control plants, comprising: (i) introducing and expressing a nucleic acid encoding a GR-RBP polypeptide according to item 1 or 2 into a plant; and (ii) growing the plant cell under conditions that promote plant growth and development.
• 17. Transgene Pflanze mit verbessertem Ertrag, insbesondere erhöhter Jungpflanzenvitalität, erhöhter Biomasse und/oder verbessertem Samenertrag im Vergleich zu Kontrollpflanzen, die sich aus der modulierten Expression einer Nukleinsäure, die ein GR-RBP Polypeptid nach Punkt 1 oder 2 kodiert, ergeben, oder eine transgene Pflanzenzelle, die aus der transgenen Pflanze hergeleitet ist.17. Transgenic plant with improved yield, in particular increased early vigor, increased biomass and / or improved seed yield compared to control plants resulting from the modulated expression of a nucleic acid encoding a GR-RBP polypeptide according to item 1 or 2, or a transgenic plant cell derived from the transgenic plant.
• 18. Transgene Pflanze nach Punkt 14, 15 oder 17, oder eine davon hergeleitete transgene Pflanzenzelle, wobei die Pflanze eine Kulturpflanze oder eine Monokotyle oder ein Getreide ist, wie Reis, Mais, Weizen, Gerste, Hirse, Roggen, Triticale, Sorghum, Emmer, Dinkel, Secale, Einkorn, Zwerghirse, Mohrenhirse und Hafer.18. Transgenic plant according to item 14, 15 or 17, or a transgenic plant cell derived therefrom, wherein the plant is a crop or a monocot or a cereal such as rice, maize, wheat, barley, millet, rye, triticale, sorghum, emmer , Spelled, Secale, Einkorn, Zwerghirse, Mohrenhirse and oats.
• 19. Erntefähige Teile einer Pflanze nach Punkt 18, wobei die erntefähigen Teile vorzugsweise Sprossbiomasse und/oder Samen sind.19. Harvestable parts of a plant according to item 18, wherein the harvestable parts are preferably shoot biomass and / or seeds.
• 20. Produkte hergeleitet von einer Pflanze nach Punkt 18 und/oder von erntefähigen Teilen einer Pflanze nach Punkt 19.20. Products derived from a plant according to item 18 and / or from harvestable parts of a plant according to item 19.
• 21. Verwendung einer Nukleinsäure, die ein GR-RBP Polypeptid kodiert bei der Verbesserung des Ertrags, insbesondere bei der Verbesserung des Samenertrags und/oder der Sprossbiomasse in Pflanzen, im Vergleich zu Kontrollpflanzen.21. Use of a nucleic acid encoding a GR-RBP polypeptide in enhancing yield, particularly in enhancing seed yield and / or shoot biomass in plants, as compared to control plants.
• 22. Isoliertes Nukleinsäuremolekül, ausgewählt aus: (i) einer Nukleinsäure nach einer von SEQ ID NO: 848, 849, 851, 852, 853, 854, 857, 862, 873, 874, 875, 876, 878, 879, 893, 897, 898, 900, 901, 905, 928, 931, 932, 933, 934, 937; (ii) dem Komplement einer Nukleinsäure nach einer von SEQ ID NO: 848, 849, 851, 852, 853, 854, 857, 862, 873, 874, 875, 876, 878, 879, 893, 897, 898, 900, 901, 905, 928, 931, 932, 933, 934, 937; (iii) einer Nukleinsäure, die ein GR-RBP Polypeptid kodiert mit in steigender Reihenfolge der Präferenz mindestens 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% oder mehr Sequenzidentität zu der Aminosäuresequenz nach einer von SEQ ID NO: 945, 946, 948, 949, 950, 951, 854, 959, 970, 971, 972, 973, 975, 976, 990, 994, 995, 997, 998, 1002, 1025, 1028, 1029, 1030, 1031, 1034, und umfassend die Signatursequenz 3 (SEQ ID NO: 830) und Signatursequenz 4 (SEQ ID NO: 831).22. An isolated nucleic acid molecule selected from: (i) a nucleic acid according to any one of SEQ ID NOs: 848, 849, 851, 852, 853, 854, 857, 862, 873, 874, 875, 876, 878, 879, 893, 897, 898, 900, 901, 905, 928, 931, 932, 933, 934, 937; (ii) the complement of a nucleic acid according to any one of SEQ ID NOs: 848, 849, 851, 852, 853, 854, 857, 862, 873, 874, 875, 876, 878, 879, 893, 897, 898, 900, 901, 905, 928, 931, 932, 933, 934, 937; (iii) a nucleic acid encoding a GR-RBP polypeptide having in increasing order of preference at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more sequence identity to the Amino acid sequence according to one of SEQ ID NO: 945, 946, 948, 949, 950, 951, 854, 959, 970, 971, 972, 973, 975, 976, 990, 994, 995, 997, 998, 1002, 1025, 1028, 1029, 1030, 1031, 1034, and includes the signature sequence 3 (SEQ ID NO: 830) and signature sequence 4 (SEQ ID NO: 831).
• 23. Isoliertes Polypeptid, ausgewählt aus: (i) einer Aminosäuresequenz nach einer von SEQ ID NO: 945, 946, 948, 949, 950, 951, 854, 959, 970, 971, 972, 973, 975, 976, 990, 994, 995, 997, 998, 1002, 1025, 1028, 1029, 1030, 1031, 1034; (ii) einer Aminosäuresequenz mit in steigender Reihenfolge der Präferenz mindestens 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% oder mehr Sequenzidentität zu der Aminosäuresequenz nach einer von SEQ ID NO: 945, 946, 948, 949, 950, 951, 854, 959, 970, 971, 972, 973, 975, 976, 990, 994, 995, 997, 998, 1002, 1025, 1028, 1029, 1030, 1031, 1034, und umfassend Signatursequenz 3 (SEQ ID NO: 830) und Signatursequenz 4 (SEQ ID NO: 831); (iii) Derivate von einer der in (i) oder (ii) oben angegebenen Aminosäuresequenz.23. Isolated polypeptide selected from: (i) an amino acid sequence according to one of SEQ ID NO: 945, 946, 948, 949, 950, 951, 854, 959, 970, 971, 972, 973, 975, 976, 990, 994, 995, 997, 998, 1002, 1025, 1028, 1029, 1030, 1031, 1034; (ii) an amino acid sequence having, in order of preference, at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% , 99% or more sequence identity to the amino acid sequence of any one of SEQ ID NOs: 945, 946, 948, 949, 950, 951, 854, 959, 970, 971, 972, 973, 975, 976, 990, 994, 995, 997, 998, 1002, 1025, 1028, 1029, 1030, 1031, 1034, and comprising signature sequence 3 (SEQ ID NO: 830) and signature sequence 4 (SEQ ID NO: 831); (iii) Derivatives of any of the amino acid sequence given in (i) or (ii) above.