DE19950554A1 - Method of operating product information for managing product-specific information e.g. for department stores and building material supermarkets, involves use of product information system of controlling organization - Google Patents
Method of operating product information for managing product-specific information e.g. for department stores and building material supermarkets, involves use of product information system of controlling organizationInfo
- Publication number
- DE19950554A1 DE19950554A1 DE19950554A DE19950554A DE19950554A1 DE 19950554 A1 DE19950554 A1 DE 19950554A1 DE 19950554 A DE19950554 A DE 19950554A DE 19950554 A DE19950554 A DE 19950554A DE 19950554 A1 DE19950554 A1 DE 19950554A1
- Authority
- DE
- Germany
- Prior art keywords
- product
- information
- specific information
- transponder
- stored
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- G—PHYSICS
- G07—CHECKING-DEVICES
- G07G—REGISTERING THE RECEIPT OF CASH, VALUABLES, OR TOKENS
- G07G1/00—Cash registers
- G07G1/0036—Checkout procedures
-
- G—PHYSICS
- G06—COMPUTING; CALCULATING OR COUNTING
- G06Q—INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR ADMINISTRATIVE, COMMERCIAL, FINANCIAL, MANAGERIAL OR SUPERVISORY PURPOSES; SYSTEMS OR METHODS SPECIALLY ADAPTED FOR ADMINISTRATIVE, COMMERCIAL, FINANCIAL, MANAGERIAL OR SUPERVISORY PURPOSES, NOT OTHERWISE PROVIDED FOR
- G06Q10/00—Administration; Management
- G06Q10/06—Resources, workflows, human or project management; Enterprise or organisation planning; Enterprise or organisation modelling
-
- G—PHYSICS
- G07—CHECKING-DEVICES
- G07F—COIN-FREED OR LIKE APPARATUS
- G07F7/00—Mechanisms actuated by objects other than coins to free or to actuate vending, hiring, coin or paper currency dispensing or refunding apparatus
Abstract
Description
Die vorliegende Erfindung bezieht sich auf ein Verfahren zum Betreiben eines Pro duktinformationssytems zur Verwaltung produktspezifischer Informationen gemäß dem Oberbegriff des Patentanspruchs 1. Weiterhin betrifft die Erfindung ein Produk tinformationssystem zur Verwaltung produktspezifischer Informationen von Produk ten gemäß dem Oberbegriff des Patentanspruchs 12, einen Transponder zum Sen den, Empfangen und Speichern produktspezifischer Informationen gemäß dem Oberbegriff des Patentanspruchs 18 und einen Einkaufswagen gemäß dem Oberbe griff des Patentanspruchs 19.The present invention relates to a method of operating a pro Product information systems for managing product-specific information in accordance with the preamble of claim 1. The invention further relates to a product Information system for managing product-specific information from product ten according to the preamble of claim 12, a transponder for Sen , receive and store product-specific information according to the Preamble of claim 18 and a shopping cart according to the Oberbe handle of claim 19.
Zur Erfassung und Verwaltung produktspezifischer Informationen haben sich ver schiedene System parallel zueinander durchgesetzt, wobei jeweils verschiedene Systeme verschiedene Informationen aus verschiedenen Zeitabschnitten der Le bensdauer eines Produktes erfassen und verwalten. Hierbei unterscheidet man vor allem zwischen einem Überwachungs- und Qualitätssicherungssystem auf der Her stellerseite und einem Kassen- und Warenwirtschaftssystem und Warensicherungs system auf der Händlerseite.To collect and manage product-specific information, ver different systems enforced parallel to each other, each different Systems different information from different time periods of the Le Record and manage the life of a product. A distinction is made here everything between a monitoring and quality assurance system on the back operator side and a cash register and merchandise management system and goods security system on the dealer side.
Das Überwachungs- und Qualitätssicherungssystem auf der Herstellerseite beruht auf der Ermittlung von Fertigungs- und Prüfdaten bis zum Zeitpunkt von Freigabe und Versand eines Produktes, wobei die entsprechenden Daten jeweils im vernetz ten Rechnersystem des Herstellers gespeichert werden, um eine Produktrückver folgbarkeit zu gewährleisten.The monitoring and quality assurance system based on the manufacturer on the determination of manufacturing and test data until the time of release and shipping a product, the corresponding data in each case in the network The computer system of the manufacturer can be saved in order to return a product ensure traceability.
Des weiteren werden Produkte, Fertigungsstätten und Managementsysteme von Herstellern durch neutrale Stellen geprüft, zertifiziert und regelmäßig auf Konformität zu jeweils anwendbaren Normen überwacht. Hierbei können beispielsweise Prüfun gen und Zertifizierungen von Qualitätsmanagementsystemen auf eine Konformität zu internationalen Normen, wie z. B. ISO 9000, durchgeführt werden. In addition, manufacturers' products, production facilities and management systems are checked, certified and regularly monitored for conformity with the applicable standards by manufacturers. Here, for example, tests and certifications of quality management systems for conformity to international standards, such as B. ISO 9000 be carried out.
Weiterhin können Prüfungen und Zertifizierungen beispielsweise für Umweltmana gementsysteme bezüglich einer Konformität zu den internationalen Normen der Se rie ISO 14000 durchgeführt werden:Furthermore, exams and certifications for example for environmental mana systems regarding conformity with the international standards of the Se ISO 14000:
Zur Erfassung der Warenwirtschafts- und Kassendaten eines Produktes hat sich der Bar-Code (EAN-Code) einheitlich durchgesetzt, wobei der Bar-Code ein standardi siertes Waren-Identifiktionssystem darstellt. Dieses Waren-Identifikationssystem wird von der Vereinigung CCG (Zentrale für Koorganisation) in Köln gesteuert, wo bei sich der Handel und die Industrie zu je 50% an der Vereinigung beteiligen.For the acquisition of the merchandise management and cash register data of a product Bar code (EAN code) enforced uniformly, with the bar code a standard represents goods identification system. This goods identification system is controlled by the CCG association (head office for co-organization) in Cologne, where where trade and industry each have a 50% share in the association.
Von den Systemen zur Überwachung und Qualitätssicherung sowie zur Erfassung von Warenwirtschafts- und Kassendaten haben sich die Systeme zur Warensiche rung bzw. Diebstahlsicherung abgekoppelt und ohne einheitlichen technischen Standart entwickelt. Auf dem Gebiet der elektronischen Diebstahlsicherung findet man beispielsweise ein Bauelement, das auf akustischer Detektion beruht und sich nicht mit weiteren Informationen beschreiben läßt. Eine weitere Möglichkeit zur Wa rensicherung bietet ein kleiner akustomagnetischer Sender, der in ein Produkt- Etikett eingearbeitet werden kann und nicht erst im Warenhaus, sondern direkt beim Hersteller mit dem Etikett appliziert wird. Das verschafft dem Handel ein deutlich höheres Maß an Sicherheit sowie Kostenvorteile, wobei sich die jeweilige Dieb stahlsicherung bei einem Kauf des Produktes deaktivieren läßt.From the systems for monitoring and quality assurance as well as for recording The systems for goods security have become from inventory management and cash register data security or theft protection decoupled and without uniform technical Standard developed. In the field of electronic theft protection takes place for example, a component that is based on acoustic detection and itself cannot be described with further information. Another way to wa rensicherung offers a small acustomagnetic transmitter that is integrated into a product Label can be incorporated and not only in the department store, but directly at the Manufacturer is applied with the label. This gives the trade a clear higher level of security as well as cost advantages, whereby the respective thief steel lock can be deactivated when purchasing the product.
Alle Systeme zusammen organisieren, regeln und kontrollieren in ihrem Umfeld den Warenfluß vom Erzeuger über die häufig auch Ländergrenzen überschreitende Lo gistik-Kette bis hin zum Warenhaus, Baumarkt bzw. Einzelhändler, die den Endkun den bedienen.Organize, regulate and control all systems together in their environment Flow of goods from the producer across the Lo, which often also crosses national borders Gistik chain up to the department store, hardware store or retailer, the end customer operate the.
Ausgehend von dem bekannten Stand der Technik liegt der vorliegenden Erfindung die Aufgabe zugrunde, eine Möglichkeit zu schaffen, produktspezifische Informatio nen über Produkte einfacher und mit gesteigertere Zuverlässigkeit erfassen zu kön nen. The present invention is based on the known prior art based on the task of creating an opportunity for product-specific information to be able to grasp products more easily and with increased reliability nen.
Diese Aufgabe wird durch die Gegenstände der Patentansprüche 1, 12, 18 und 19 gelöst. Bevorzugte Ausgestaltungen der Erfindung sind Gegenstand der Unteran sprüche.This object is achieved by the subject matter of claims 1, 12, 18 and 19 solved. Preferred embodiments of the invention are the subject of the Unteran claims.
Gemäß einem besonderen Aspekt der vorliegenden Erfindung sind Transponder mit jeweils einer eigenen Energiequelle und Speichereinrichtungen vorgesehen, die vorzugsweise in Form von Aufklebern oder kartenförmigen Etiketten ausgebildet sind. Diese im folgenden als "Smart Marks" bezeichneten Transponder dienen zur Speicherung aller produkt- und qualitätsrelevanter Daten während des Herstellungs zyklus bis hin zum Versand sowie zur Speicherung relevanter Überwachungspara menter während der gesamten Logistikkette bis zum Eintreffen im Warenhaus, wo alle dort erforderlichen Daten, die für das Kassen- und Warenwirtschaftssystem so wie die Warensicherung verwendet werden, aufgenommen werden können.According to a particular aspect of the present invention, transponders are included each provided its own energy source and storage devices that preferably in the form of stickers or card-shaped labels are. These transponders, referred to below as "Smart Marks", are used for Storage of all product and quality-relevant data during production cycle to shipping and storage of relevant monitoring parameters during the entire logistics chain until it arrives at the department store, where all the data required there for the cash register and merchandise management system how goods security is used can be included.
Die Smart Mark wird bei der Herstellung eines Produktes derart mit dem Produkt verbunden, daß eine Trennung der jeweiligen Smart Mark von dem jeweiligen Pro dukt zu einer Schädigung der Funktionsfähigkeit des Smart Mark führen würde. Die se Schädigung kann sowohl eine Einschränkung der Funktionsfähigkeit als auch eine mechanische Zerstörung des Smart Mark oder eine elektronische Zerstörung der in dem Smart Mark gespeicherten Daten zur Folge haben.The Smart Mark is like this with the product when manufacturing a product connected that a separation of the respective Smart Mark from the respective Pro product would damage the functionality of the SmartMark. The This damage can be a limitation of functionality as well mechanical destruction of the Smart Mark or electronic destruction of the data stored in the Smart Mark.
Des weiteren wird jedem Produkt, das mit einer Smart Mark verbunden wird, eine eindeutige Produkt-Identifikationsnummer zugewiesen.In addition, each product that is linked to a Smart Mark will have one assigned unique product identification number.
Um eine Zuteilung und sichere Verwaltung eindeutiger Produkt- Identifikationsnummern zu gewährleisten, wird eine Kontroll-Organisation geschaf fen, die über entsprechende Einrichtungen verfügt.To allocate and securely manage unique product A control organization is created to ensure identification numbers fen, which has appropriate facilities.
Des weiteren wird eine Organisation mit Einrichtungen zur Prüfung und Überwa chung von Unternehmen auf Hersteller- bzw. Händlerseite geschaffen, die die Prü fung bzw. Überwachung der entsprechenden Hersteller bzw. Händler sicherstellen soll, wobei eine Prüfung von Herstellern bzw. Händlern zu einer Zertifizierung be züglich einer Konformität zu feststellbaren Normen und Standards führt. Des weite ren können auch Produkte selbst geprüft und zertifiziert werden, wobei eine fortwäh rende Produktqualität durch eine entsprechende Überwachung gewährleistet werden kann.Furthermore, an organization with facilities for testing and monitoring created by companies on the manufacturer or dealer side who Ensure that the relevant manufacturers or dealers are monitored should, an examination of manufacturers or dealers for certification with regard to conformity leads to determinable norms and standards. The far You can also test and certify products yourself, one of which is ongoing appropriate product quality can be guaranteed by appropriate monitoring can.
Zertifizierten Herstellern bzw. Produkten können Smart Marks zugeteilt werden, die dann von dem jeweiligen Hersteller mit den entsprechenden Produkten verbunden werden. Eine derart aufgebrachte Smart Mark kann in verschiedenen Phasen der Lebensdauer des jeweiligen Produktes zum Speichern verschiedener, produktspezi fischer Informationen verwendet werden. Diese produktspezifischen Informationen können jederzeit aus der Speichereinrichtung der Smart Mark ausgelesen und ver arbeitet werden.Certified manufacturers or products can be assigned Smart Marks that then connected to the corresponding products by the respective manufacturer become. Such a Smart Mark can be applied in different phases of the Lifetime of the respective product for storing different, product-spec fischer information are used. This product-specific information can be read out and stored at any time from the Smart Mark storage device be working.
Mittels der in der Smart Mark gespeicherten, produktspezifischen Informationen kann beispielsweise genau festgestellt werden, auf welcher Produktionsstraße eines Unternehmens das Produkt entstanden ist und ob es die in dem Qualitätsmanage mentsystem des jeweiligen Unternehmens vorgesehenen Prüfstationen durchlaufen hat. Darüber hinaus kann man den Transport und die jeweilige Lagerung vom Her steller bis zum Händler verfolgen, also den Warenausgang auf der einen und den Wareneingang auf der anderen Seite. Auch Beschädigungen oder Manipulationen an dem Produkt sind feststellbar.Using the product-specific information stored in the Smart Mark For example, it can be determined exactly on which production line one The company has created the product and whether it is in the quality management system of the respective company Has. In addition, you can transport and storage from the Her Follow the seller to the dealer, i.e. the goods issue on one and the other Goods receipt on the other side. Even damage or manipulation are detectable on the product.
Besonders erwähnenswert ist auch, daß sich bei Verwendung einer Smart Mark zur Speicherung produktspezifischer Informationen Plagiate in einfacher Weise erfassen ließen, da unseriösen Unternehmen die Teilnahme an dem beschriebenen System verweigert wird.It is also particularly worth mentioning that when using a Smart Mark Storage of product-specific information Capture plagiarism in a simple way let since dubious companies participate in the described system is denied.
Bevorzugte Ausführungsformen der vorliegenden Erfindung werden im folgenden unter Bezugnahme auf die beiliegenden Zeichnungen näher erläutert. Dabei zeigen die Zeichnungen im einzelnen:Preferred embodiments of the present invention are as follows explained in more detail with reference to the accompanying drawings. Show the drawings in detail:
Fig. 1 ein Blockdiagramm zur Illustration des Zusammenwirkens von einer Leit- Organisation und Unternehmen innerhalb eines Produktinformationssystems zur Verwaltung produktspezifischer Informationen, FIG. 1 is a block diagram illustrating the interaction between an organization and guiding companies within a product information system to manage product-specific information,
Fig. 2 eine schematische Ansicht eines bevorzugten Transponders; Fig. 2 is a schematic view of a preferred transponder;
Fig. 3 ein Flußdiagramm zur Illustration, wie über die Lebensdauer des jeweiligen Produktes hinweg Informationen in einen Transponder gespeichert werden; 3 is a flowchart illustrating how information is stored away in a transponder over the life of the individual product.
Fig. 4 ein Blockdiagramm eines Wareneinkaufssystems; Fig. 4 is a block diagram of a goods purchasing system;
Fig. 5 eine schematische Seitenansicht eines Einkaufswagens mit Lesegerät, und Fig. 5 is a schematic side view of a shopping cart with a reader, and
Fig. 6 ein Flußdiagramm bezüglich einer weiteren Anwendung des erfindungsgemä ßen Produktinformationssystems. Fig. 6 is a flow chart related to another application of the inventive SEN product information system.
Fig. 1 zeigt ein Blockdiagramm, mittels dem das Zusammenwirken von einer Leit- Organisation 100, 110, 120 und Unternehmen 200, 210, 220, 230 in einem Produk tinformationssystem zur Verwaltung produktspezifischer Informationen 300, 310, 320, 321, 330 von Produkten 400 dargestellt wird. Fig. 1 shows a block diagram, by means of which the interaction of a guiding organization 100, 110, 120 and company 200, 210, 220, 230 in a production tinformationssystem product specific to the management information 300, 310, 320, 321, 330 of products 400 is pictured.
Das Produktinformationssystem wird von der Leit-Organisation 100, 110, 120 gelei tet und weist eine Vielzahl von "Smart Marks" 500 auf, wobei jeweils eine Smart Mark 500 einem Transponder entspricht und zum Senden, Empfangen und Spei chern produktspezifischer Informationen 300, 310, 320, 321, 330 verwendet wird.The product information system is managed by the management organization 100 , 110 , 120 and has a large number of “Smart Marks” 500 , one Smart Mark 500 each corresponding to a transponder and for sending, receiving and storing product-specific information 300 , 310 , 320 , 321 , 330 is used.
Bei dem Produktinformationssystem gemäß Fig. 1 wird einem Produkt 400 jeweils eine Smart Mark 500 zugeordnet, die derart mit dem jeweiligen Produkt 400 verbun den wird, daß eine Trennung von Produkt 400 und Smart Mark 500 zu einer Schädi gung der Funktionsfähigkeit der Smart Mark 500 führen würde, wie nachstehend genauer beschrieben wird.In the product information system according to FIG. 1, a Smart Mark 500 is assigned to a product 400 , which is connected to the respective product 400 in such a way that a separation of product 400 and Smart Mark 500 leads to damage to the functionality of the Smart Mark 500 would, as described in more detail below.
Die Leit-Organisation 100, 110, 120 und die Unternehmen 200, 210, 220, 230 führen bezüglich der Smart Mark 500 verschiedene Aufgaben durch. Im folgenden werden die Aufgaben der Leit-Organisation 100, 110, 120 sowie der Unternehmen 200, 210, 220 und 230, die in das Produktionsinformationssystem integriert sind, beschrieben. The lead organization 100 , 110 , 120 and the companies 200 , 210 , 220 , 230 perform various tasks with regard to the Smart Mark 500 . The tasks of the lead organization 100 , 110 , 120 and of the companies 200 , 210 , 220 and 230 , which are integrated in the production information system, are described below.
Wie in Fig. 1 dargestellt, weist die Leit-Organisation 100, 110, 120 eine Schulungs- und Qualifizierungsorganisation 100, eine Prüf-, Überwachungs- und Zertifizie rungsorganisation 110 und eine Kontrollorganisation 120 auf. Die Funktionen der einzelnen Organisationen 100, 110, 120 in dem Produktinformationssystem werden in den nachstehenden Erläuterungen beschrieben.As shown in FIG. 1, the leading organization 100 , 110 , 120 has a training and qualification organization 100 , a testing, monitoring and certification organization 110 and a control organization 120 . The functions of the individual organizations 100 , 110 , 120 in the product information system are described in the explanations below.
Die Prüf-, Überwachungs- und Zertifizierungsorganisation 110 prüft, zertifiziert und überwacht 111 Produktionsunternehmen 200, um die Integration von Produktionsun ternehmen 200 sowie von Produkten 400 der Produktionsunternehmen 200 in das Produktinformationssystem zu gewährleisten. Vorzugsweise werden nur Produk tionsunternehmen 200 in das Produktinformationssystem integriert, die von einer entsprechenden Prüf-, Überwachungs- und Zertifizierungsorganisation 110 geprüft, zertifiziert und regelmäßig überwacht 111 werden.The testing, monitoring and certification organization 110 tests, certifies and monitors 111 production companies 200 in order to ensure the integration of production companies 200 and of products 400 of the production companies 200 into the product information system. Preferably, only production companies 200 are integrated into the product information system that are checked, certified and regularly monitored 111 by a corresponding testing, monitoring and certification organization 110 .
In einer bevorzugten Ausführungsform der vorliegenden Erfindung werden Ferti gungsstätten und Managementsysteme, wie z. B. Qualitäts- oder Umweltmanage mentsysteme, sowie die Produkte 400 der Produktionsunternehmen 200 auf ihre Konformität bezüglich Kriterien des Produktinformationssystems geprüft, die von der Leit-Organisation 100, 110, 120 bestimmt werden, wobei die Kriterien auch interna tional anerkannte Normen, wie z. B. ISO Normen, umfassen können. Wird bei der Prüfung der Produktionsunternehmen 200 und der Produkte 400 eine Konformität zu den Kriterien des Produktinformationssystems festgestellt, so kann eine Zertifizie rung der Produktionsunternehmen 200 durch die Prüf-, Überwachungs- und Zertifi zierungsorganisation 110 erfolgen. Um eine beständige und fortwährende Konformi tät der Produktionsunternehmen 200 und der Produkte 400 zu gewährleisten, kön nen die entsprechenden Produktionsunternehmen 200 und die entsprechenden Pro dukte 400 von der Prüf-, Überwachungs- und Zertifizierungsorganisation 110 über wacht werden.In a preferred embodiment of the present invention, manufacturing facilities and management systems such. B. quality or environmental management systems, as well as the products 400 of the manufacturing companies 200 checked for their conformity with criteria of the product information system, which are determined by the lead organization 100 , 110 , 120 , the criteria also internationally recognized standards, such. B. ISO standards. If conformity to the criteria of the product information system is determined during the testing of the production companies 200 and the products 400 , the production companies 200 can be certified by the testing, monitoring and certification organization 110 . A stable and continuous Konformi the production company 200 and 400 products to ensure ty, Kings nen the corresponding manufacturing company 200 and the corresponding pro ducts 400 from the testing, inspection and certification organization 110 are monitored.
Des weiteren kann bei Feststellung der Konformität der Produktunternehmen 200 und der Produkte 400 zu den Kriterien des Produktinformationssystems die Teil nahme der Produktionsunternehmen 200 an dem Produktinformationssystem ermög licht werden, wobei jeweils einem Produkt 400 eine Smart Mark 500 mit einer ein deutigen Produkt-Identifikationsnummer 123 zugeordnet wird.Furthermore, if the conformity of the product company 200 and the product 400 to the criteria of the product information system is ascertained, the participation of the production company 200 in the product information system can be made possible, wherein a product 400 is assigned a Smart Mark 500 with a unique product identification number 123 becomes.
Die Prüf-, Überwachungs- und Zertifizierungsorganisation 110 kann aufgrund von Erkenntnissen, die beim Prüfen, Zertifizieren und Überwachen 111 von Produktions unternehmen 200 und Produkten 400 gewonnen werden, die Erteilung einer Smart Mark 500 und deren Zuordnung zu jeweils einem Produkt 400 regeln.The testing, monitoring and certification organization 110 can regulate the issuance of a Smart Mark 500 and its assignment to a product 400 on the basis of knowledge gained during the testing, certification and monitoring 111 of production companies 200 and products 400 .
Die Kontrollorganisation 120 hat die Aufgabe, die Vielzahl von Produkt- Identifikationsnummern 123 zu verwalten und den jeweiligen Produkten 400 eindeu tige Produkt-Identifikationsnummern 123 zuzuordnen.The control organization 120 has the task of managing the multiplicity of product identification numbers 123 and of assigning unique product identification numbers 123 to the respective products 400 .
Die jeweilige Produkt-Identifikationsnummer 123 wird derart in der zugeordneten Smart Mark 500 gespeichert, daß ein Abändern oder Entfernen der Produkt- Identifikationsnummer 123 ausgeschlossen wird. Des weiteren muß sichergestellt werden, daß die jeweilige eindeutige Produkt-Identifikationsnummer 123 nicht miß bräuchlich verwendet werden kann. Hierzu wird die Smart Mark 500 mit dem zuge ordneten Produkt 400 verbunden, wobei dies auf eine Weise erfolgt, daß eine Tren nung von Produkt 400 und Smart Mark 500 zu einer Schädigung der Funktionsfähig keit der Smart Mark 500 führt. Diese Schädigung kann von Systemteilnehmern de tektiert werden und beugt somit Manipulationsversuchen vor. Gemäß einer bevor zugten Ausführungsform führt die Trennung von Produkt 400 und Smart Mark 500 zu einer mechanischen Zerstörung der Smart Mark 500 oder alternativ zur Zerstörung der auf der Smart Mark 500 gespeicherten, produktspezifischen Informationen 300, 310, 320, 321, 330.The respective product identification number 123 is stored in the assigned Smart Mark 500 in such a way that changing or removing the product identification number 123 is excluded. Furthermore, it must be ensured that the respective unique product identification number 123 cannot be misused. For this purpose, the Smart Mark 500 is connected to the assigned product 400 , this being done in such a way that a separation of the product 400 and Smart Mark 500 leads to damage to the functionality of the Smart Mark 500 . This damage can be detected by system participants and thus prevents attempts at manipulation. According to a preferred embodiment, the separation of product 400 and smart mark 500 leads to mechanical destruction of the smart mark 500 or alternatively to the destruction of the product-specific information 300 , 310 , 320 , 321 , 330 stored on the smart mark 500 .
Eine andere Aufgabe der Kontrollorganisation 120 besteht darin, die Verwendung einer erteilten Smart Mark 500 über die gesamte Lebensdauer des zugeordneten Produkts 400 zu überwachen 122, um somit den größtmöglichen Schutz vor Miß brauch der auf der Smart Mark 500 gespeicherten, produktspezifischen Informatio nen 300, 310, 320, 321, 330 zu gewährleisten. Another task of the control organization 120 is to monitor 122 the use of an issued Smart Mark 500 over the entire life of the assigned product 400 , in order to thus ensure the greatest possible protection against misuse of the product-specific information 300 , 310 stored on the Smart Mark 500 , 320 , 321 , 330 to ensure.
Des weiteren weist die Leit-Organisation 100, 110, 120 eine Schulungs- und Quali fizierungsorganisation 100 auf, die Schulungen und Qualifizierungen von Personal 101 entsprechender Unternehmen 200, 210, 220, 230 durchführen kann, um somit ein sicheres und qualifiziertes Arbeiten mit den Smart Marks 500 sicherzustellen.Furthermore, the lead organization 100 , 110 , 120 has a training and qualification organization 100 , which can carry out training and qualifications of personnel 101 of corresponding companies 200 , 210 , 220 , 230 , in order to thus work safely and professionally with the Smart Ensure Marks 500 .
Die in Fig. 1 dargestellten Unternehmen 200, 210, 220, 230 weisen Produktionsun ternehmen 200, Logistikunternehmen 210, Verkaufsunternehmen 220 und Service- und Dienstleistungsunternehmen 230 auf. Die verschiedenen Unternehmen 200, 210, 220, 230 können mit dem jeweiligen Produkt 400 zu einem bestimmten Zeit punkt der Lebensdauer des Produktes 400 in Berührung kommen, die bestimmte produktspezifische Informationen 300, 310, 320, 321, 330 zur Folge haben.The companies 200 , 210 , 220 , 230 shown in FIG. 1 have production companies 200 , logistics companies 210 , sales companies 220 and service companies 230 . The various companies 200 , 210 , 220 , 230 can come into contact with the respective product 400 at a specific time in the life of the product 400 , which result in specific product-specific information 300 , 310 , 320 , 321 , 330 .
Bei der Herstellung 201 des Produkts durch das Produktionsunternehmen 200 kön nen produkt- und qualitätsrelevante Daten 300 anfallen, die beispielsweise Auskunft über das Produktionsunternehmen 200, das Herstellungsdatum, den Herstellungs ort, die durchgeführten Qualitätsprüfungen oder die Lagerbedingungen geben kön nen. Die jeweils angefallenen, produkt- und qualitätsrelevanten Daten 300 können vorzugsweise von dem Produktionsunternehmen 200 in die Smart Mark 500 einge speichert werden.During the production 201 of the product by the production company 200, product-relevant and quality-relevant data 300 may be obtained, which can, for example, provide information about the production company 200 , the date of manufacture, the place of manufacture, the quality tests carried out or the storage conditions. The data 300 relevant to product and quality can preferably be stored in the smart mark 500 by the production company 200 .
Die Auslieferung 211 des jeweiligen Produktes 400 mit Smart Mark 500 erfolgt durch das Logistikunternehmen 210, wobei überwachungs- und transportrelevante Daten 310 festgehalten werden können. Die überwachungs- und transportrelevanten Daten 310 können beispielsweise Auskunft über das Logistikunternehmen 210, den Trans portbeginn, die Transportbedingungen oder die angewendete Überwachung der je weiligen Produkte 400 geben. Die jeweils ermittelten überwachungs- und trans portrelevanten Daten 310 werden vorzugsweise von dem Logistikunternehmen 210 in der Smart Mark 500 abgespeichert.The delivery of the individual product to be 400 with Smart Mark 500 is performed by the logistics company 210, wherein monitoring and transport-related data 310 held 211th The monitoring and transport-relevant data 310 can, for example, provide information about the logistics company 210 , the start of the transport, the transport conditions or the monitoring used for the respective products 400 . The respectively determined monitoring and transport-relevant data 310 are preferably stored in the smart mark 500 by the logistics company 210 .
Ist die Auslieferung 211 des jeweiligen Produktes 400 mit Smart Mark 500 erfolgt, so kann das jeweilige Produkt 400 durch das Verkaufsunternehmen 220 verkauft wer den 221. Für den Verkauf des jeweiligen Produktes 400 können Daten für ein Kas sen- und Warenwirtschaftssystem 320 ermittelt werden; des weiteren können Daten für eine Warensicherung 321 bereitgestellt werden. Die Daten für das Kassen- und Warenwirtschaftssystem 320 können beispielsweise Auskunft über das Verkaufsun ternehmen 220, den Preis des jeweiligen Produktes 400 oder den genauen Ver kaufsort geben. Die Daten für das Kassen- und Warenwirtschaftssystem 320 sowie die Daten für die Warensicherung 321 werden vorzugsweise von dem Verkaufsun ternehmen 220 in die Smart Mark 500 eingespeichert.If the delivery of the particular product takes 211,400 with Smart Mark 500 so that product can be 400 sold by the sales company 220 who the 221st For the sale of the respective product 400 , data can be determined for a cash register and inventory management system 320 ; furthermore, data can be provided for an article surveillance 321 . The data for the cash register and merchandise management system 320 can, for example, provide information about the sales company 220 , the price of the respective product 400 or the exact sales location. The data for the cash register and merchandise management system 320 and the data for the goods security 321 are preferably stored in the smart mark 500 by the sales company 220 .
Wird das jeweilige Produkt 400 verkauft und enthält die zugeordnete Smart Mark 500 Daten für die Warensicherung 321, so kann die jeweilige Warensicherung durch das Verkaufsunternehmen 220 vorzugsweise beim Zeitpunkt der Bezahlung des Produktes 400 deaktiviert werden 222. Somit kann verhindert werden, daß die je weilige Smart Mark 500 einen Diebstahlalarm auslöst, wenn der Käufer mit dem je weiligen Produkt 400 das Verkaufsunternehmen 220 verläßt.If the respective product 400 is sold and the associated Smart Mark 500 contains data for the article security 321 , the respective article security can preferably be deactivated 222 by the sales company 220 when the product 400 is paid for. It can thus be prevented that the respective Smart Mark 500 triggers a theft alarm when the buyer with the respective product 400 leaves the sales company 220 .
Das Service- und Dienstleistungsunternehmen 230 kann Service- und Dienstleistun gen 231 an dem jeweiligen Produkt 400 durchführen, wobei service- und dienstlei stungsrelevante Daten 330 ermittelt werden können. Die service- und dienstlei stungsrelevanten Daten 330 können beispielsweise Auskunft über das Serviceun ternehmen 230, den Zeitpunkt einer Serviceleistung, die Art der Serviceleistung oder den Preis der Serviceleistung geben. Die service- und dienstleistungsrelevanten Daten 330 werden vorzugsweise von dem Service- und Dienstleistungsunternehmen 230 in der Smart Mark 500 abgespeichert.The service company 230 can perform services 231 on the respective product 400 , wherein service-relevant data 330 can be determined. The service and service-relevant data 330 can, for example, provide information about the service company 230 , the time of a service, the type of service or the price of the service. The service and service-relevant data 330 are preferably stored by the service and service company 230 in the Smart Mark 500 .
Die in dem Produktinformationssystem gemäß Fig. 1 verwendeten Smart Marks 500 werden zum gesicherten Speichern von Produkt-Identifikationsnummern 123 sowie zum Speichern produktspezifischer Informationen 300, 310, 320, 321, 330 verwen det, wobei das Einspeichern von Informationen jeweils von den Produktionsunter nehmen 200, den Logistikunternehmen 210, den Verkaufsunternehmen 220 oder den Service- und Dienstleistungsunternehmen 230 vorgenommen wird. Die weiteren Bestandteile einer Smart Mark 500, die das Senden, Empfangen und Speichern pro duktspezifischer Informationen 300, 310, 320, 321, 330 ermöglichen, werden im fol genden beschrieben. The smart marks 500 used in the product information system according to FIG. 1 are used for the secure storage of product identification numbers 123 and for storing product-specific information 300 , 310 , 320 , 321 , 330 , the storage of information in each case by the production companies 200 , the logistics company 210 , the sales company 220 or the service company 230 . The other components of a Smart Mark 500 that enable sending, receiving and storing product-specific information 300 , 310 , 320 , 321 , 330 are described in the following.
Fig. 2 zeigt eine schematische Ansicht einer Smart Mark 500 mit Speichereinrich tungen 510 und 560, Energiequelle 520, Sende- und Empfangseinheit 530, Anten nenspule 540 sowie Steuereinheit 550. Fig. 2 shows a schematic view of a Smart Mark 500 with storage devices 510 and 560 , energy source 520 , transmitting and receiving unit 530 , antenna coil 540 and control unit 550 .
Eine erste Speichereinrichtung 560 wird zum Speichern der jeweiligen Produkt- Identifikationsnummer 123 verwendet, wobei die jeweilige Produkt- Identifikationsnummer 123 eine eindeutige Identifikation des jeweiligen Produktes 400 ermöglichen soll. Um die Eindeutigkeit der jeweiligen Produkt- Identifikationsnummer 123 zu gewährleisten, kann die erste Speichereinrichtung 560 beispielsweise als ROM-Speicher oder als EPROM-Speicher ausgeführt werden, wodurch auch ein unbeabsichtigtes Ändern oder Löschen der jeweiligen Produkt- Identifikationsnummer 123 vermieden werden kann.A first storage device 560 is used to store the respective product identification number 123 , the respective product identification number 123 being intended to enable the respective product 400 to be clearly identified. In order to ensure the uniqueness of the respective product identification number 123 , the first storage device 560 can be designed, for example, as a ROM memory or as an EPROM memory, as a result of which unintentional changing or deletion of the respective product identification number 123 can also be avoided.
Eine zweite Speichereinrichtung 510 wird zum Speichern produktspezifischer Infor mationen 300, 310, 320, 321, 330 verwendet, wobei vorzugsweise produkt- und qualitätsrelevante Daten 300, überwachungs- und transportrelevante Daten 310, kassen- und warenwirtschaftssystemrelevante Daten 320, Warensicherungsdaten 321 und service- und dienstleistungsrelevante Daten 330 gespeichert werden.A second storage device 510 is used to store product-specific information 300 , 310 , 320 , 321 , 330 , preferably product and quality-relevant data 300 , monitoring and transport-relevant data 310 , checkout and goods management system-related data 320 , goods security data 321 and service and service-relevant data 330 are stored.
Für den Fall, daß das Speichern produktspezifischer Informationen 300, 310, 320, 321, 330 als gesichertes Speichern ausgeführt werden soll, um somit die gespei cherten produktspezifischen Informationen 300, 310, 320, 321, 330 vor Modifikation oder Mißbrauch zu schützen, kann die zweite Speichereinrichtung 510 als ROM- Speicher oder EPROM-Speicher ausgeführt werden.In the event that the storage of product-specific information 300 , 310 , 320 , 321 , 330 is to be carried out as secure storage, in order to protect the stored product-specific information 300 , 310 , 320 , 321 , 330 from modification or misuse, the second memory device 510 can be designed as ROM memory or EPROM memory.
Die Energiequelle 520 der Smart Mark 500 kann beispielsweise als Akkumulator oder Batterie ausgeführt werden, wobei die Energiequelle 520 verwendet wird, um die Beschreibbarkeit der Smart Mark 500 sicherzustellen. Hierzu kann die Energie quelle 520 derart ausgeführt werden, daß sie eine Lebensdauer aufweist, die der Lebensdauer des zugeordneten Produktes 400 entspricht.The energy source 520 of the Smart Mark 500 can be embodied , for example, as an accumulator or battery, the energy source 520 being used to ensure that the Smart Mark 500 can be written on. For this purpose, the energy source 520 can be designed such that it has a lifespan that corresponds to the lifespan of the assigned product 400 .
Insbesondere können die in den Speicherelementen 510 und 560 der Smart Mark 500 gespeicherten Informationen 123, 300, 310, 320, 321, 330 noch lesbar sein, wenn die Energiequelle 520 nicht mehr funktionsfähig ist, so daß die Lesbarkeit der Daten über die gesamte Lebensdauer des jeweiligen Produktes 400 garantiert ist.In particular, the information 123 , 300 , 310 , 320 , 321 , 330 stored in the storage elements 510 and 560 of the Smart Mark 500 can still be readable when the energy source 520 is no longer functional, so that the readability of the data over the entire life of the respective product 400 is guaranteed.
Die Steuereinheit 550 wird verwendet, um das Senden und Empfangen sowie das Speichern von Informationen 123, 300, 310, 320, 321, 330 zu steuern. Vorzugsweise kann die Steuereinheit 550 durch einen Mikroprozessor oder eine festverdrahtete Logik ausgeführt sein.The control unit 550 is used to control the sending and receiving as well as the storage of information 123 , 300 , 310 , 320 , 321 , 330 . Control unit 550 may preferably be implemented by a microprocessor or hard-wired logic.
Die Sende- und Empfangseinheit 530 wird zum Senden bzw. Empfangen von Infor mationen 123, 300, 310, 320, 321, 330 verwendet, wobei die Informationen 123, 300, 310, 320, 321, 330 mittels der Antennenspule 540 gesendet bzw. empfangen werden.The transmitting and receiving unit 530 is used to send or receive information 123 , 300 , 310 , 320 , 321 , 330 , the information 123 , 300 , 310 , 320 , 321 , 330 being sent or received by means of the antenna coil 540 become.
Die oben beschriebenen Bestandteile 510, 520, 530, 540, 550, 560 einer Smart Mark 500 werden vorzugsweise auf jeweils einem einzigen Transponderchip inte griert und können gemäß einer bevorzugten Ausführungsform der vorliegenden Er findung in Form eines Aufklebers oder kartenförmig ausgeführt werden, so daß die jeweilige Smart Mark 500 flexibel einsetzbar ist.The above-described components 510 , 520 , 530 , 540 , 550 , 560 of a Smart Mark 500 are preferably integrated on a single transponder chip and can, according to a preferred embodiment of the present invention, be carried out in the form of a sticker or in card form, so that the Smart Mark 500 can be used flexibly.
Die Smart Mark 500 könnte vorzugsweise mit einer ihrer Größe entsprechenden, dünnen Abdeckfolie 570 zum Schutz vor Umwelteinflüssen abgedeckt werden, wobei auf die Abdeckfolie 570 vorzugsweise die Bezeichnung "Smart Mark" aufgedruckt werden kann, was in Fig. 2a angedeutet ist. Ein entscheidender Vorteil des Aufbrin gens der Bezeichnung "Smart Mark" auf die Abdeckfolie 570 besteht darin, daß bei einer weit verbreiteten Anwendung des in Fig. 1 beschriebenen Produktinforma tionssystems die Bezeichnung "Smart Mark" von den Verbrauchern als Siegel für geprüfte und kontrollierte Produktqualität erkannt werden kann.The Smart Mark 500 could preferably be covered with a thin cover film 570 corresponding to its size for protection against environmental influences, wherein the designation "Smart Mark" can preferably be printed on the cover film 570 , which is indicated in FIG. 2a. A decisive advantage of applying the designation "Smart Mark" to the cover film 570 is that, in a widespread use of the product information system described in FIG. 1, the designation "Smart Mark" is recognized by consumers as a seal for tested and controlled product quality can be.
Ziel des in Fig. 1 gezeigten Produktinformationssystems ist es, eine Produkt- Identifikationsnummer 123 und produktspezifische Informationen 300, 310, 320, 321, 330 in der Smart Mark 500 zu speichern, wobei jede Smart Mark 500 jeweils einem Produkt 400 zugeordnet wird. Im folgenden soll beispielhaft an einem Verfahrensab lauf dargestellt werden, wie das Speichern der genannten Informationen 123, 300, 310, 320, 321, 330 erreicht werden kann.The aim of the product information system shown in FIG. 1 is to store a product identification number 123 and product-specific information 300 , 310 , 320 , 321 , 330 in the Smart Mark 500 , each Smart Mark 500 being assigned to a product 400 . In the following, an example of a process sequence is used to show how the aforementioned information 123 , 300 , 310 , 320 , 321 , 330 can be stored.
Fig. 3 zeigt ein Flußdiagramm, das veranschaulicht, wie über die Lebensdauer eines Produktes 400 hinweg Informationen 123, 300, 310, 320, 321, 330 in der Smart Mark 500 gespeichert werden können. FIG. 3 shows a flow chart that illustrates how information 123 , 300 , 310 , 320 , 321 , 330 can be stored in the Smart Mark 500 over the life of a product 400 .
In einem ersten Schritt 450 wird die Smart Mark mit dem Produkt 400 derart verbun den, daß eine Trennung von Produkt 400 und Smart Mark 500 zu einer Schädigung der Funktionsfähigkeit der Smart Mark 500 führt. Die dem Produkt 400 zugeordnete Produkt-Identifikationsnummer 123 wird derart in der Smart Mark 500 gespeichert, daß ein Abändern oder Entfernen der Produkt-Identifikationsnummer 123 ausge schlossen ist.In a first step 450 , the smart mark is connected to the product 400 in such a way that a separation of product 400 and smart mark 500 leads to damage to the functionality of the smart mark 500 . The product identification number 123 assigned to the product 400 is stored in the smart mark 500 such that a modification or removal of the product identification number 123 is excluded.
In weiteren Schritten werden nun verschiedene, produktspezifische Informationen 300, 310, 320, 321, 330 von verschiedenen Unternehmen 200, 210, 220, 230 bereit gestellt und in der Smart Mark 500 gespeichert.In further steps, different, product-specific information 300 , 310 , 320 , 321 , 330 from different companies 200 , 210 , 220 , 230 are made available and stored in the Smart Mark 500 .
Die von dem Produktionsunternehmen 200 bereitgestellten, produkt- und qualitätsre levanten Daten 300 werden in Schritt 452 von dem Produktionsunternehmen 200 in der Smart Mark 500 gespeichert.The product and quality-relevant data 300 provided by the production company 200 are stored in step 452 by the production company 200 in the smart mark 500 .
Die von dem Logistikunternehmen 210 bereitgestellten, überwachungs- und trans portrelevanten Daten 310 werden in Schritt 453 von dem Logistikunternehmen 210 in dem Smart Mark 500 gespeichert.The provided, monitoring and trans port relevant of the logistics company 210 data 310 are stored in step 453 of the logistics company 210 in the Smart Mark 500th
Die von dem Verkaufsunternehmen 220 bereitgestellten Daten für das Kassen- und Warenwirtschaftssystem 320 sowie die Daten für die Warensicherung 321 werden in Schritt 454 von dem Verkaufsunternehmen 220 in der Smart Mark 500 gespeichert. Da die gespeicherten Daten für die Warensicherung 321, beispielsweise zur Dieb stahlsicherung, verwendet werden, kann in Schritt 454 ein Löschen dieser Daten durch das Verkaufsunternehmen 220 erfolgen, um somit die Warensicherung zu de aktivieren. The data provided by the sales company 220 for the cash register and merchandise management system 320 and the data for the goods security 321 are stored in step 454 by the sales company 220 in the Smart Mark 500 . Since the stored data is used for the security device 321 , for example for anti-theft protection, this data can be deleted in step 454 by the sales company 220 in order to de-activate the security device.
Die von dem Service- und Dienstleistungsunternehmen 230 bereitgestellten, ser vice- und dienstleistungsrelevanten Daten 330 werden in Schritt 456 von dem Ser vice- und Dienstleistungsunternehmen 230 in die Smart Mark 500 gespeichert.The service and service-related data 330 provided by the service and service company 230 are stored in step 456 by the service and service company 230 in the Smart Mark 500 .
Gemäß dem in den Fig. 1 bis 3 dargestellten Produktinformationssystem erhält die Smart Mark 500 eine eindeutige Produkt-Identifikationsnummer 123 sowie pro duktspezifische Informationen 300, 310, 320, 321, 330. Die gespeicherten Informa tionen 123, 300, 310, 320, 321, 330 können auch außerhalb des Produktinforma tionssystems breite Anwendung finden. Beispielsweise kann eine Verwendung pro duktspezifischer Informationen 300, 310, 320, 321, 330 zur Steuerung eines Wa reneinkaufssystems verwendet werden, wobei die in der Smart Mark 500 gespei cherten Daten für das Kassen- und Warenwirtschaftssystem 320 mittels eines Lese gerätes von einem Wareneinkaufswagen gelesen und ausgewertet werden, können somit den Prozeß des Wareneinkaufens vereinfachen, wie im folgenden beschrie ben wird.According to the product information system shown in FIGS . 1 to 3, the Smart Mark 500 receives a unique product identification number 123 and product-specific information 300 , 310 , 320 , 321 , 330 . The stored information 123 , 300 , 310 , 320 , 321 , 330 can also be widely used outside of the product information system. For example, use of product-specific information 300 , 310 , 320 , 321 , 330 can be used to control a goods purchasing system, the data stored in the Smart Mark 500 for the checkout and goods management system 320 being read by a goods shopping cart using a reader and evaluated, can thus simplify the process of purchasing goods, as will be described below.
Fig. 4 zeigt ein Verfahren zum Betreiben eines Wareneinkaufssystems, indem eine Ware 401, 402, 403, die jeweils mit einer Smart Mark 500 versehen ist, von einem Käufer ausgewählt werden kann. Der Käufer entnimmt die Ware 401, 402, 403 von ihrem Verkaufsort innerhalb eines Verkaufsunternehmens 220 und bringt sie in einen Wareneinkaufswagen ein. FIG. 4 shows a method for operating a goods purchasing system, in that a goods 401 , 402 , 403 , which are each provided with a Smart Mark 500 , can be selected by a buyer. The buyer removes the goods 401 , 402 , 403 from their point of sale within a sales company 220 and places them in a goods shopping cart.
Der Wareneinkaufswagen selbst ist in Fig. 5 dargestellt und mit der Bezugsziffer 800 bezeichnet. An dem Griff des Wareneinkaufswagens 800 befindet sich ein Lesegerät 600, das wiederum in Fig. 4 genauer dargestellt ist.The goods shopping cart itself is shown in FIG. 5 and is designated by the reference number 800 . On the handle of the shopping cart 800 there is a reader 600 , which in turn is shown in more detail in FIG. 4.
Das Lesegerät 600 weist vorzugsweise eine Recheneinrichtung 601, 602, 603, 604, 605 auf, wobei die Recheneinrichtung 601, 602, 603, 604, 605 vorzugsweise eine Anzeige 601, eine Einzelpreis-Taste 602, eine Listen-Taste 603, eine Gesamtpreis- Taste 604 und eine Auswahl-Taste 605 umfaßt. The reading device 600 preferably has a computing device 601 , 602 , 603 , 604 , 605 , the computing device 601 , 602 , 603 , 604 , 605 preferably having a display 601 , a single price button 602 , a list button 603 , a total price Button 604 and a select button 605 .
Das Einbringen einer Ware 401, 402 und 403 in den Wareneinkaufswagen 800 wird von dem Lesegerät 600 erkannt, wobei das Lesegerät 600 aus der Smart Mark 500 der Ware 401, 402, 403 kassen- und warenwirtschaftssystemrelevante Daten 320 ausliest.The introduction of a product 401 , 402 and 403 into the goods shopping trolley 800 is recognized by the reading device 600 , the reading device 600 reading data 320 relevant to the cash register and goods management system from the Smart Mark 500 of the goods 401 , 402 , 403 .
Das Erkennen des Einbringens einer Ware 401, 402, 403 in den Wareneinkaufswa gen 800 kann beispielsweise mittels eines statischen Magnetfeldes erfolgen. Hierbei würde das statische Magnetfeld über die Öffnung des Wareneinkaufswagens 800 gelegt, so daß bei Einbringen einer Ware 401, 402, 403 ein elektromagnetischer Impuls. von der Smart Mark 500 der jeweiligen Ware 401, 402, 403 erzeugt werden könnte, der die Smart Mark 500 zum Senden relevanter Daten 320 anregen.The detection of the introduction of goods 401 , 402 , 403 into the Wareneinkaufswa gene 800 can take place, for example, by means of a static magnetic field. In this case, the static magnetic field would be placed over the opening of the goods shopping trolley 800 , so that when goods 401 , 402 , 403 are introduced, an electromagnetic pulse is generated. could be generated by the Smart Mark 500 of the respective goods 401 , 402 , 403 , which stimulate the Smart Mark 500 to send relevant data 320 .
Alternativ könnte das Lesegerät 600 des Wareneinkaufswagens 800 kontinuierlich Signale aussenden, die von der jeweiligen Waren 401, 402, 403 bei Einbringen in den Wareneinkaufswagen 800 empfangen würden und diese zum Senden relevanter Daten 320 anregt.Alternatively, the reading device 600 of the goods shopping trolley 800 could continuously send out signals which would be received by the respective goods 401 , 402 , 403 when introduced into the goods shopping trolley 800 and which would encourage them to send relevant data 320 .
Die von der Smart Mark 500 gesendeten Daten 320 werden von dem Lesegerät 600 empfangen und von der Recheneinrichtung 601, 602, 603, 604, 605 ausgewertet.The data 320 sent by the Smart Mark 500 are received by the reading device 600 and evaluated by the computing device 601 , 602 , 603 , 604 , 605 .
In einer bevorzugten Ausführungsform der vorliegenden Erfindung könnten die rele vanten Daten 320 der letzten in den Wareneinkaufswagen eingebrachten Ware 401, 402, 403 von der Rechenrichtung 601, 602, 603, 604, 605 auf der Anzeige 601 an gezeigt werden, wobei die relevanten Daten 320 insbesondere den Preis der Ware 401, 402, 403 repräsentieren könnten.In a preferred embodiment of the present invention, the relevant data 320 of the last goods 401 , 402 , 403 placed in the shopping cart could be shown on the display 601 from the computing direction 601 , 602 , 603 , 604 , 605 , with the relevant data 320 in particular could represent the price of the goods 401 , 402 , 403 .
Für den Fall, daß mehrere Waren 401, 402, 403 in den Wareneinkaufswagen 800 eingebracht werden, speichert die Recheneinrichtung 601, 602, 603, 604, 605 des Lesegerätes 600 die relevanten Daten 320 der jeweiligen Waren 401, 402, 403 in einer nicht gezeigten Speichereinrichtung, vorzugsweise in Listenform. Die ver schiedenen Bedientasten 602, 603, 604, 605 der Recheneinrichtung 601, 602, 603, 604, 605 gestatten dann eine selektive Auswahl und Anzeige relevanter Daten 320 aus dieser Liste. In the event that several goods 401 , 402 , 403 are introduced into the goods shopping cart 800 , the computing device 601 , 602 , 603 , 604 , 605 of the reading device 600 stores the relevant data 320 of the respective goods 401 , 402 , 403 in a not shown Storage device, preferably in list form. The various control buttons 602 , 603 , 604 , 605 of the computing device 601 , 602 , 603 , 604 , 605 then allow a selective selection and display of relevant data 320 from this list.
Wird beispielsweise die Einzelpreis-Taste 602 bedient, so könnten in der Anzeige 601 die relevanten Daten 320 der letzten, in den Wareneinkaufswagen 800 einge brachten Ware 401, 402, 403 angezeigt werden.If, for example, the unit price button 602 is operated, the relevant data 320 of the last goods 401 , 402 , 403 brought into the shopping cart 800 could be displayed 601 .
Mit der Gesamtpreis-Taste 604 kann eine Aufsummierung der Preise aller in dem Wareneinkaufswagen 800 enthaltenen Waren 401, 402, 403 erreicht werden.With the total price key 604 , a summation of the prices of all goods 401 , 402 , 403 contained in the goods shopping trolley 800 can be achieved.
Am Ende eines Einkaufsvorganges bezahlt der Käufer die ausgewählten Waren 401, 402, 403, die sich in dem Wareneinkaufswagen 800 befinden, an einer Kassen schleuse des Verkaufsunternehmens 220.At the end of a shopping process, the buyer pays the selected goods 401 , 402 , 403 , which are located in the goods shopping trolley 800 , at a checkout gate of the sales company 220 .
Die Kassenschleuse enthält ein Lese- und Schreibgerät 700 mit Recheneinrichtung 701, 702, 703, wobei das Lese- und Schreibgerät 700 bei einem Vorbeifahren eines Wareneinkaufswagens 800 kassen- und warenwirtschaftssystemrelevante Daten 320 aus den Smart Marks 500 der verschiedenen Waren 401, 402, 403 ausliest. Diese Daten 320 werden von der Recheneinrichtung 701, 702, 703 des Lese- und Schreibgerätes 700 ausgewertet, wobei die Auswertung beispielsweise in einem Aufsummieren der Einzelpreise bestehen könnte.The POS lock includes a read and write device 700 with computing device 701, 702, 703, wherein the read and write device 700 POS at a passage of a goods shopping trolley 800 and inventory control system relevant data 320 from the smart cord 500 of the various goods 401, 402, 403 reads . This data 320 is evaluated by the computing device 701 , 702 , 703 of the reading and writing device 700 , wherein the evaluation could consist, for example, of adding up the individual prices.
Nachdem der Käufer die in dem Wareneinkaufswagen 800 enthaltenen Waren 401, 402, 403 bezahlt hat, deaktiviert die Kassenschleuse die Warensicherungsdaten 321 aus den Smart Marks 500 der jeweiligen Waren 401, 402, 403. Die Deaktivie rung kann nach erfolgter Bezahlung automatisch oder manuell durch Betätigung einer Deaktivierungstaste 703 erfolgen.After the buyer has paid for the goods 401 , 402 , 403 contained in the goods shopping trolley 800 , the cash register lock deactivates the goods security data 321 from the smart marks 500 of the respective goods 401 , 402 , 403 . The deactivation can take place automatically after the payment has been made or manually by pressing a deactivation key 703 .
Gemäß einer weiteren bevorzugten Ausführungsform der vorliegenden Erfindung könnte das Produktinformationssystem in Produktionsstätten, insbesondere in der Automobilindustrie Anwendung finden. Das System könnte hierbei für Vollständig keitskontrollen oder zur Diebstahlvorbeugung dienen, wie im folgenden näher erläu tert. According to a further preferred embodiment of the present invention could the product information system in production facilities, especially in the Automotive industry find application. The system could do this for complete security checks or to prevent theft, as explained in more detail below tert.
Die in Fig. 6 gezeigten verschiedenen Produkte 901, 902, 903, die zusammen ein Endprodukt 900 ergeben, weisen jeweils eine Smart Mark 500 auf.The various products 901 , 902 , 903 shown in FIG. 6, which together produce an end product 900 , each have a Smart Mark 500 .
Für den Fall, daß es sich, wie in Fig. 6 angedeutet, bei den verschiedenen Produk ten 901, 902, 903 um Automobilteile, wie z. B. Autotür, Lenkrad oder Motorhaube handelt, könnte zusätzlich zu einer Produkt-Identifikationsnummer 123 eine zweite für alle Teile gleiche Identifikationsnummer gespeichert werden, die beispielsweise der Fahrgestellnummer des Autos entsprechen könnte.In the event that, as indicated in Fig. 6, the various products 901 , 902 , 903 to automotive parts such. B. car door, steering wheel or hood, in addition to a product identification number 123, a second identification number that is the same for all parts could be stored, which could correspond, for example, to the chassis number of the car.
Das Produktionsunternehmen 200 kann somit am Ende des Produktionsprozesses überprüfen, ob die zu einem Produkt 900 zusammengefaßten Produkte 901, 902, 903 auch tatsächlich einheitlich für das Produkt 900 vorgesehen waren.The production company 200 can thus check at the end of the production process whether the products 901 , 902 , 903 combined to form a product 900 were actually intended uniformly for the product 900 .
Darüber hinaus kann bei routinemäßigen polizeilichen Verkehrsüberwachungskon trollen bzw. Diebstahlrecherchen mittels eines speziellen Lesegeräts (nicht darge stellt) beim bloßen Vorbeigehen an dem entsprechenden Fahrzeug festgestellt wer den, ob es sich bei den einzelnen Komponenten tatsächlich um die Originalteile handelt.In addition, in routine police traffic monitoring con trolling or theft research using a special reader (not shown poses) when walking past the corresponding vehicle whether the individual components are actually the original parts acts.
Claims (26)
Zuordnen eines Transponders (500) zu einem Produkt (400) und Zuordnen einer Produktnummer zu dem jeweiligen Produkt (400),
Aufbringen des jeweiligen Transponders (500) auf das zugeordnete Produkt (400) und Speichern der jeweiligen Produktnummer in einer ersten Speichereinrichtung (560) des jeweiligen Transponders (500), und
Speichern produktspezifischer Informationen (300, 310, 320, 321, 330) des zuge ordneten Produktes (400) in einer zweiten Speichereinrichtung (510) des jeweiligen Transponders (500), dadurch gekennzeichnet, daß
die Produktnummer, die dem jeweiligen Produkt (400) zugeordnet wird, eine eindeu tige Produkt-Identifikationsnummer (123) ist, die von der Leit-Organisation (100, 110, 120) zugewiesen wird,
die Produkt-Identifikationsnummer (123) derart in der ersten Speichereinrichtung (560) des jeweiligen Transponders (500) gespeichert wird, daß ein Abändern oder Entfernen der Produkt-Identifikationsnummer (123) ausgeschlossen wird,
der jeweilige Transponder (500) von dem Unternehmen (200), das das jeweilige Produkt (400) herstellt, derart mit dem jeweiligen Produkt (400) verbunden wird, daß eine Trennung von Produkt (400) und Transponder (500) zu einer Schädigung der Funktionsfähigkeit des Transponders (500) führt,
die produktspezifischen Informationen (300, 310, 320, 321, 330) von mindestens zwei verschiedenen Unternehmen (200, 210, 220, 230) bereitgestellt werden, die mit dem jeweiligen Produkt (400) in Berührung kommen, und
die produktspezifischen Informationen (300, 310, 320, 321, 330) von den minde stens zwei verschiedenen Unternehmen (200, 210, 220, 230) in der zweiten Spei chereinrichtung (510) des jeweiligen Transponders (500) gespeichert werden.1. A method for operating a product information system for managing product-specific information ( 300 , 310 , 320 , 321 , 330 ) of products ( 400 ), where the product information system is managed by a leading organization ( 100 , 110 , 120 ) and one Has a plurality of transponders ( 500 ), the transpose of ( 500 ) each having energy source ( 520 ) and storage devices ( 510 , 560 ) and serving for sending, receiving and storing product-specific information ( 300 , 310 , 320 , 321 , 330 ) , and the method comprises the following steps:
Assigning a transponder ( 500 ) to a product ( 400 ) and assigning a product number to the respective product ( 400 ),
Applying the respective transponder ( 500 ) to the assigned product ( 400 ) and storing the respective product number in a first memory device ( 560 ) of the respective transponder ( 500 ), and
Storage of product-specific information ( 300 , 310 , 320 , 321 , 330 ) of the assigned product ( 400 ) in a second storage device ( 510 ) of the respective transponder ( 500 ), characterized in that
the product number assigned to the respective product ( 400 ) is a unique product identification number ( 123 ) assigned by the lead organization ( 100 , 110 , 120 ),
the product identification number ( 123 ) is stored in the first storage device ( 560 ) of the respective transponder ( 500 ) in such a way that the product identification number ( 123 ) cannot be changed or removed,
the respective transponder ( 500 ) from the company ( 200 ) that produces the respective product ( 400 ) is connected to the respective product ( 400 ) in such a way that a separation of product ( 400 ) and transponder ( 500 ) leads to damage to the Functionality of the transponder ( 500 ) leads,
the product-specific information ( 300 , 310 , 320 , 321 , 330 ) is provided by at least two different companies ( 200 , 210 , 220 , 230 ) that come into contact with the respective product ( 400 ), and
the product-specific information ( 300 , 310 , 320 , 321 , 330 ) from the at least two different companies ( 200 , 210 , 220 , 230 ) are stored in the second storage device ( 510 ) of the respective transponder ( 500 ).
die Leit-Organisation (100, 110, 120) Einrichtungen aufweist, die dem jeweiligen Produkt (400) die Produktnummer zuordnen und sicherstellen, daß die Pro duktnummer jeweils eine eindeutige Produkt-Identifikationsnummer (123) ist,
das Unternehmen (200), das das jeweilige Produkt (400) herstellt, Einrichtungen aufweist um die Produkt-Identifikationsnummer (123) derart in der ersten Spei chereinrichtung (560) des jeweiligen Transponders (500) zu speichern, daß ein Än dern oder Entfernen der Produkt-Identifikationsnummer (123) ausgeschlossen wird,
das Unternehmen (200), das das jeweilige Produkt (400) herstellt, Einrichtungen aufweist um die Verbindung des jeweiligen Transponders (500) mit dem jeweiligen Produkt (400) derart zu gestalten, daß eine Trennung von Produkt (400) und Trans ponder (500) zu einer Schädigung der Funktionsfähigkeit des jeweiligen Transpon ders (500) führt,
mindestens zwei verschiedene Unternehmen (200, 210, 220, 230), die mit dem je weiligen Produkt (400) in Berührung kommen, Einrichtungen aufweisen um pro duktspezifische Informationen (300, 310, 320, 321, 330) bereitzustellen, und
die mindestens zwei verschiedenen Unternehmen (200, 210, 220, 230) Einrichtun gen aufweisen, um die produktspezifischen Informationen (300, 310, 320, 321, 330) in der zweiten Speichereinrichtung (510) des jeweiligen Transponders (500) zu spei chern. 12. Product information system for managing product-specific information ( 300 , 310 , 320 , 321 , 330 ) of products ( 400 ), the product information system being managed by a management organization ( 100 , 110 , 120 ) and a large number of transponders ( 500 ) The transponders ( 500 ) each have an energy source ( 520 ) and storage devices ( 510 , 560 ) and are used for sending, receiving and storing product-specific information ( 300 , 310 , 320 , 321 , 330 ), each having a transponder ( 500 ) and a product number can be assigned to each product ( 400 ), the respective transponder ( 500 ) being applied to the respective assigned product ( 400 ) and the product number being stored in a first storage device ( 560 ) of the respective transponder ( 500 ) and wherein product-specific information ( 300 , 310 , 320 , 321 , 330 ) is stored in a second memory device ( 510 ) of the respective transponder ( 50 0 ) are stored, characterized in that
the lead organization ( 100 , 110 , 120 ) has facilities which assign the product number to the respective product ( 400 ) and ensure that the product number is a unique product identification number ( 123 ),
the company ( 200 ) which manufactures the respective product ( 400 ) has means for storing the product identification number ( 123 ) in the first memory means ( 560 ) of the respective transponder ( 500 ) in such a way that a change or removal of the Product identification number ( 123 ) is excluded,
the company ( 200 ), which manufactures the respective product ( 400 ), has devices for designing the connection of the respective transponder ( 500 ) with the respective product ( 400 ) in such a way that a separation of product ( 400 ) and trans ponder ( 500 ) leads to damage to the functionality of the respective transponder ( 500 ),
at least two different companies ( 200 , 210 , 220 , 230 ) that come into contact with the respective product ( 400 ) have facilities to provide product-specific information ( 300 , 310 , 320 , 321 , 330 ), and
the at least two different companies ( 200 , 210 , 220 , 230 ) have devices for storing the product-specific information ( 300 , 310 , 320 , 321 , 330 ) in the second storage device ( 510 ) of the respective transponder ( 500 ).
mindestens einer ersten Speichereinrichtung (560) zum gesicherten Speichern von eindeutigen, produktidentifizierenden Informationen (123),
mindestens einer zweiten Speichereinrichtung (510) zum Speichern produktspezifi scher Informationen (300, 310, 320, 321, 330),
einer Energiequelle (520) zur Energieversorgung des Transponders (500),
einer Sende- und Empfangseinheit (530) mit Antenne (540) zum Senden und Emp fangen produktspezifischer Informationen (300, 310, 320, 321, 330),
einer Steuereinheit (550) zum Steuern des Sendens und des Empfangens, sowie des Speicherns produktspezifischer Informationen (300, 310, 320, 321, 330), und
einer bedruckten Abdeckfolie (570) zum Schutz vor Umwelteinflüssen und als Siegel für geprüfte und kontrollierte Produktqualität.18. Transponder ( 500 ) for sending, receiving and storing product-specific information ( 300 , 310 , 320 , 321 , 330 ) with:
at least one first storage device ( 560 ) for the secure storage of unique, product-identifying information ( 123 ),
at least one second storage device ( 510 ) for storing product-specific information ( 300 , 310 , 320 , 321 , 330 ),
an energy source ( 520 ) for supplying energy to the transponder ( 500 ),
a transmitting and receiving unit ( 530 ) with antenna ( 540 ) for sending and receiving product-specific information ( 300 , 310 , 320 , 321 , 330 ),
a control unit ( 550 ) for controlling the transmission and reception, and the storage of product-specific information ( 300 , 310 , 320 , 321 , 330 ), and
a printed cover film ( 570 ) for protection against environmental influences and as a seal for tested and controlled product quality.
einem Lesegerät (600), das aus dem Transponder (500) jeder Ware (401, 402, 403), die in den Einkaufswagen (800) eingebracht wird, relevante Informationen (123, 300, 310, 320, 321) ausliest,
einer Recheneinrichtung (601, 602, 603, 604, 605), die die relevanten Informationen (123, 300, 310, 320, 321) verarbeitet und speichert, und
einer Anzeigeeinrichtung (601), mittels der die gespeicherten Informationen (123, 300, 310, 320, 321) anzeigt werden können.19. Shopping cart (800) for receiving goods (401, 402, 403), said Wa ren (401, 402, 403) are associated with transponders (500) on which INFORMATIO (123, 300, 310, 320, 321 ) are saved with:
a reading device ( 600 ) which reads relevant information ( 123 , 300 , 310 , 320 , 321 ) from the transponder ( 500 ) of each item ( 401 , 402 , 403 ) that is placed in the shopping cart ( 800 ),
a computing device ( 601 , 602 , 603 , 604 , 605 ) which processes and stores the relevant information ( 123 , 300 , 310 , 320 , 321 ), and
a display device ( 601 ) by means of which the stored information ( 123 , 300 , 310 , 320 , 321 ) can be displayed.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
DE19950554A DE19950554A1 (en) | 1999-10-20 | 1999-10-20 | Method of operating product information for managing product-specific information e.g. for department stores and building material supermarkets, involves use of product information system of controlling organization |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
DE19950554A DE19950554A1 (en) | 1999-10-20 | 1999-10-20 | Method of operating product information for managing product-specific information e.g. for department stores and building material supermarkets, involves use of product information system of controlling organization |
Publications (1)
Publication Number | Publication Date |
---|---|
DE19950554A1 true DE19950554A1 (en) | 2001-04-26 |
Family
ID=7926300
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
DE19950554A Withdrawn DE19950554A1 (en) | 1999-10-20 | 1999-10-20 | Method of operating product information for managing product-specific information e.g. for department stores and building material supermarkets, involves use of product information system of controlling organization |
Country Status (1)
Country | Link |
---|---|
DE (1) | DE19950554A1 (en) |
Cited By (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2004011992A1 (en) * | 2002-07-25 | 2004-02-05 | Dirk Reulecke | Goods identification system for the optical industry |
DE10249414A1 (en) * | 2002-10-23 | 2004-05-13 | Siemens Ag | Electronic communications-compatible pluggable connector unit e.g. for product data handling, has component-specific information electronically stored by data carrier |
DE10323168A1 (en) * | 2003-05-22 | 2004-12-09 | Conti Temic Microelectronic Gmbh | Labeling element for an electronic component, e.g. for storage of component specific information, comprises a memory and antenna that permits reading from or writing to the memory via electromagnetic waves |
DE10334462A1 (en) * | 2003-07-29 | 2005-03-03 | Recaro Aircraft Seating Gmbh & Co. Kg | Seat with data storage, in particular passenger seat, and associated reader |
DE102004031844A1 (en) * | 2004-06-30 | 2006-01-26 | Burghard Dr. Herrmann | Reproduction of article-specific information involves maintaining wireless connection between detector and identification arrangement for permanent tracking by controller |
Citations (13)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP0513456A1 (en) * | 1991-04-30 | 1992-11-19 | Ludwig Kipp | Checkout system |
DE4312180A1 (en) * | 1993-04-14 | 1994-10-20 | Ultrakust Electronic Gmbh | Process for disposing of manufactured items and disposal system for manufactured items |
WO1995011501A1 (en) * | 1993-10-22 | 1995-04-27 | Brandenburg, Jacobus, Gerhardus, Maria | System for nationally and internationally identifying motor vehicles |
DE4341880A1 (en) * | 1993-12-08 | 1995-06-14 | Dinkel Doris | Objects e.g. clothing item control system |
DE29512330U1 (en) * | 1995-07-31 | 1995-09-28 | Siemens Ag | Product data storage facility |
EP0680012A2 (en) * | 1994-04-28 | 1995-11-02 | NCR International, Inc. | Multiple function interactive product label |
US5469363A (en) * | 1994-05-19 | 1995-11-21 | Saliga; Thomas V. | Electronic tag with source certification capability |
US5729697A (en) * | 1995-04-24 | 1998-03-17 | International Business Machines Corporation | Intelligent shopping cart |
DE19646153A1 (en) * | 1996-11-08 | 1998-05-14 | Siemens Nixdorf Inf Syst | Shopping cart scanner |
DE19711521A1 (en) * | 1997-03-19 | 1998-09-24 | Elsdale Ltd | Identification device for vehicle parking or road use management system |
GB2329301A (en) * | 1997-09-16 | 1999-03-17 | Nigel Howard Petty | Merchandise security tag with data storage |
WO1999039980A1 (en) * | 1998-02-09 | 1999-08-12 | Premark Feg L.L.C. | Apparatus for applying security tags to labels |
DE19809574A1 (en) * | 1998-03-05 | 1999-09-09 | Brosow | Security identification system for objects |
-
1999
- 1999-10-20 DE DE19950554A patent/DE19950554A1/en not_active Withdrawn
Patent Citations (13)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP0513456A1 (en) * | 1991-04-30 | 1992-11-19 | Ludwig Kipp | Checkout system |
DE4312180A1 (en) * | 1993-04-14 | 1994-10-20 | Ultrakust Electronic Gmbh | Process for disposing of manufactured items and disposal system for manufactured items |
WO1995011501A1 (en) * | 1993-10-22 | 1995-04-27 | Brandenburg, Jacobus, Gerhardus, Maria | System for nationally and internationally identifying motor vehicles |
DE4341880A1 (en) * | 1993-12-08 | 1995-06-14 | Dinkel Doris | Objects e.g. clothing item control system |
EP0680012A2 (en) * | 1994-04-28 | 1995-11-02 | NCR International, Inc. | Multiple function interactive product label |
US5469363A (en) * | 1994-05-19 | 1995-11-21 | Saliga; Thomas V. | Electronic tag with source certification capability |
US5729697A (en) * | 1995-04-24 | 1998-03-17 | International Business Machines Corporation | Intelligent shopping cart |
DE29512330U1 (en) * | 1995-07-31 | 1995-09-28 | Siemens Ag | Product data storage facility |
DE19646153A1 (en) * | 1996-11-08 | 1998-05-14 | Siemens Nixdorf Inf Syst | Shopping cart scanner |
DE19711521A1 (en) * | 1997-03-19 | 1998-09-24 | Elsdale Ltd | Identification device for vehicle parking or road use management system |
GB2329301A (en) * | 1997-09-16 | 1999-03-17 | Nigel Howard Petty | Merchandise security tag with data storage |
WO1999039980A1 (en) * | 1998-02-09 | 1999-08-12 | Premark Feg L.L.C. | Apparatus for applying security tags to labels |
DE19809574A1 (en) * | 1998-03-05 | 1999-09-09 | Brosow | Security identification system for objects |
Cited By (9)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2004011992A1 (en) * | 2002-07-25 | 2004-02-05 | Dirk Reulecke | Goods identification system for the optical industry |
DE10233965A1 (en) * | 2002-07-25 | 2004-02-19 | Dirk Reulecke | Product identification system for the optical industry |
DE10233965B4 (en) * | 2002-07-25 | 2008-05-08 | Dirk Reulecke | Goods identification system for the optical industry |
DE10249414A1 (en) * | 2002-10-23 | 2004-05-13 | Siemens Ag | Electronic communications-compatible pluggable connector unit e.g. for product data handling, has component-specific information electronically stored by data carrier |
DE10323168A1 (en) * | 2003-05-22 | 2004-12-09 | Conti Temic Microelectronic Gmbh | Labeling element for an electronic component, e.g. for storage of component specific information, comprises a memory and antenna that permits reading from or writing to the memory via electromagnetic waves |
DE10334462A1 (en) * | 2003-07-29 | 2005-03-03 | Recaro Aircraft Seating Gmbh & Co. Kg | Seat with data storage, in particular passenger seat, and associated reader |
US7695065B2 (en) | 2003-07-29 | 2010-04-13 | Recaro Aircraft Seating Gmbh & Co. Kg | Seat, especially an aircraft passenger seat, with a data storage device and associated reading device |
DE102004031844A1 (en) * | 2004-06-30 | 2006-01-26 | Burghard Dr. Herrmann | Reproduction of article-specific information involves maintaining wireless connection between detector and identification arrangement for permanent tracking by controller |
DE102004031844B4 (en) * | 2004-06-30 | 2010-11-18 | Herrmann, Burghard, Dr. | Arrangement for the variable reproduction of article-specific information |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
DE4341880A1 (en) | Objects e.g. clothing item control system | |
DE69838960T2 (en) | Electronic inventory system and procedures | |
DE4335316C2 (en) | Arrangement and method for the identification, identification and verification of vehicles | |
DE10055602A1 (en) | Exit control system for supermarket or department store, produces receipt based on contactlessly received information and updates payment status | |
EP0387972B1 (en) | Vending machine controlling method | |
DE102005051595A1 (en) | File security system and article security system | |
WO1996036936A1 (en) | Method of dispensing smart cards | |
EP0433756A2 (en) | System for the supervision and surveillance of the distribution of goods | |
CH693756A5 (en) | Apparatus for monitoring of entrance and exit. | |
EP1386293B1 (en) | Marking a deposit item | |
DE10358981A1 (en) | Portable autonomous rental device | |
DE60217749T2 (en) | System and method for displaying article information with electronic signs | |
DE3721170A1 (en) | PORTABLE STORAGE MEDIUM | |
DE19921748A1 (en) | Monitoring and controlling system for automated, unattended supermarkets, department stores or libraries, comprises reading device for detecting objects marked with identification elements in check-in and check-out zones | |
DE19950554A1 (en) | Method of operating product information for managing product-specific information e.g. for department stores and building material supermarkets, involves use of product information system of controlling organization | |
CN109509003A (en) | Supply chain system for tracing and managing based on RFID technique | |
DE10330321B4 (en) | Plant for managing a parking space for vehicles | |
EP0915439B1 (en) | Method and device for identfying and deactivating a security tag | |
EP0907143A2 (en) | System for providing security information disposed on an article | |
DE102005002748B4 (en) | Container and method for automatically checking the completeness of the contents of the container | |
DE102011108705B4 (en) | Inventory monitoring system | |
DE3711031C1 (en) | Inventory setup and procedure | |
WO2003058563A2 (en) | Method for carrying out the product-accompanying or manufacturing-accompanying documentation and/or characterization of transportable objects as well as the subsequent identification thereof | |
DE10233965B4 (en) | Goods identification system for the optical industry | |
DE1774984B2 (en) | Control device for an output device excretion from: 1574250 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
OM8 | Search report available as to paragraph 43 lit. 1 sentence 1 patent law | ||
8139 | Disposal/non-payment of the annual fee |