US20030220258A1 - Treatment of ischemic events - Google Patents

Treatment of ischemic events Download PDF

Info

Publication number
US20030220258A1
US20030220258A1 US10/409,642 US40964203A US2003220258A1 US 20030220258 A1 US20030220258 A1 US 20030220258A1 US 40964203 A US40964203 A US 40964203A US 2003220258 A1 US2003220258 A1 US 2003220258A1
Authority
US
United States
Prior art keywords
seq
subject
peptide
gene
cells
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US10/409,642
Inventor
Robbert Benner
Nisar Khan
Bartholomeus Jacobs
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Biotempt BV
Original Assignee
Biotempt BV
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from US10/028,075 external-priority patent/US20030113733A1/en
Application filed by Biotempt BV filed Critical Biotempt BV
Priority to US10/409,642 priority Critical patent/US20030220258A1/en
Assigned to BIOTEMPT B.V. reassignment BIOTEMPT B.V. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: JACOBS, BARTHOLOMEUS CASPAR J., BENNER, ROBBERT, KHAN, NISAR AHMED
Publication of US20030220258A1 publication Critical patent/US20030220258A1/en
Priority to US11/593,329 priority patent/US8216998B2/en
Priority to US12/074,020 priority patent/US20090042807A1/en
Abandoned legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K5/00Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/04Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
    • C07K5/08Tripeptides
    • C07K5/0802Tripeptides with the first amino acid being neutral
    • C07K5/0804Tripeptides with the first amino acid being neutral and aliphatic
    • C07K5/0808Tripeptides with the first amino acid being neutral and aliphatic the side chain containing 2 to 4 carbon atoms, e.g. Val, Ile, Leu
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575Hormones
    • C07K14/59Follicle-stimulating hormone [FSH]; Chorionic gonadotropins, e.g. HCG; Luteinising hormone [LH]; Thyroid-stimulating hormone [TSH]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K5/00Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/04Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
    • C07K5/06Dipeptides
    • C07K5/06008Dipeptides with the first amino acid being neutral
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K5/00Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/04Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
    • C07K5/06Dipeptides
    • C07K5/06008Dipeptides with the first amino acid being neutral
    • C07K5/06017Dipeptides with the first amino acid being neutral and aliphatic
    • C07K5/06026Dipeptides with the first amino acid being neutral and aliphatic the side chain containing 0 or 1 carbon atom, i.e. Gly or Ala
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K5/00Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/04Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
    • C07K5/08Tripeptides
    • C07K5/0802Tripeptides with the first amino acid being neutral
    • C07K5/0804Tripeptides with the first amino acid being neutral and aliphatic
    • C07K5/0806Tripeptides with the first amino acid being neutral and aliphatic the side chain containing 0 or 1 carbon atoms, i.e. Gly, Ala
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K5/00Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/04Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
    • C07K5/08Tripeptides
    • C07K5/0802Tripeptides with the first amino acid being neutral
    • C07K5/0804Tripeptides with the first amino acid being neutral and aliphatic
    • C07K5/081Tripeptides with the first amino acid being neutral and aliphatic the side chain containing O or S as heteroatoms, e.g. Cys, Ser
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K5/00Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/04Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
    • C07K5/10Tetrapeptides
    • C07K5/1002Tetrapeptides with the first amino acid being neutral
    • C07K5/1005Tetrapeptides with the first amino acid being neutral and aliphatic
    • C07K5/1008Tetrapeptides with the first amino acid being neutral and aliphatic the side chain containing 0 or 1 carbon atoms, i.e. Gly, Ala
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K5/00Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/04Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
    • C07K5/10Tetrapeptides
    • C07K5/1002Tetrapeptides with the first amino acid being neutral
    • C07K5/1005Tetrapeptides with the first amino acid being neutral and aliphatic
    • C07K5/101Tetrapeptides with the first amino acid being neutral and aliphatic the side chain containing 2 to 4 carbon atoms, e.g. Val, Ile, Leu
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K5/00Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/04Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
    • C07K5/10Tetrapeptides
    • C07K5/1002Tetrapeptides with the first amino acid being neutral
    • C07K5/1005Tetrapeptides with the first amino acid being neutral and aliphatic
    • C07K5/1013Tetrapeptides with the first amino acid being neutral and aliphatic the side chain containing O or S as heteroatoms, e.g. Cys, Ser
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K7/00Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04Linear peptides containing only normal peptide links
    • C07K7/06Linear peptides containing only normal peptide links having 5 to 11 amino acids
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K7/00Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04Linear peptides containing only normal peptide links
    • C07K7/08Linear peptides containing only normal peptide links having 12 to 20 amino acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy

Definitions

  • the current invention relates to the body's innate way of modulation of important physiological processes and builds on insights reported in PCT International Publications WO99/59617 and WO01/72831 and PCT International Application PCT/NL02/00639, the contents of the entirety of all of which are incorporated by this reference.
  • small gene-regulatory peptides are described that are present naturally in pregnant women and are derived from proteolytic breakdown of placental gonadotropins such as human chorionic gonadotropin (hCG) produced during pregnancy. These peptides (in their active state often only at about 4 to 6 amino acids long) were shown to have unsurpassed immunological activity that they exert by regulating expression of genes encoding inflammatory mediators such as cytokines. Surprisingly, it was found that breakdown of hCG provides a cascade of peptides that help maintain a pregnant woman's immunological homeostasis. These peptides are nature's own substances that balance the immune system to assure that the mother stays immunologically sound while her fetus does not get prematurely rejected during pregnancy but instead is safely carried through its time of birth.
  • hCG human chorionic gonadotropin
  • the immuno-modulatory and gene-regulatory activity of the peptides should by no means only be thought to occur during pregnancy and in the placenta; man and women alike produce hCG, for example in their pituitaries, and nature certainly utilizes the gene-regulatory activities of peptides in a larger whole.
  • hCG derived gene-regulatory peptides offer significant potential for the treatment of a variety of human and animal diseases, thereby tapping the pharmaceutical potential of the exact substances that help balance the mother's immune system such that her pregnancy is safely maintained.
  • the invention in particular relates to the treatment of an ischemic event such as a stroke or myocardial infarction.
  • An ischemic event refers to an event in which the blood supply to a tissue is obstructed. Due to this obstruction, the endothelial tissue lining the affected blood vessels becomes “sticky” and begins to attract circulating white blood cells. The white cells bound to the endothelium eventually migrate into the affected tissue, causing significant tissue destruction. Although neither acute myocardial infarction nor stroke is directly caused by inflammation, much of the underlying pathology and the damage that occurs after an acute ischemic event are caused by acute inflammatory responses during reperfusion, the restoration of blood flow to the affected organ. Early restitution of blood flow to ischemic tissues is essential to halt the progression of cellular injury associated with decrease of oxygen supply and nutrient delivery.
  • ischemia—reperfusion injury are most frequently observed in the lung and (cardio- or cerebro-)vascular system, and can result in the development of the systemic inflammatory response syndrome (SIRS) and multiple organ dysfunction syndrome (MODS), both of which account for 30-40% of the mortality in tertiary referral intensive care units (ICUs).
  • SIRS systemic inflammatory response syndrome
  • MODS multiple organ dysfunction syndrome
  • ICUs tertiary referral intensive care units
  • PCT International Publication WO01/72831 a method and a pharmaceutical composition are provided for modulating cardiovascular or circulatory disorders, such as heart failure, brain infarctions, Alzheimer's disease, thrombosis, arteriosclerosis, pregnancy-related cardiovascular or circulatory disorders and the like. It has been found that an immunoregulator as described in the application has a very beneficial effect on animals, including humans, suffering from a cardiovascular disorder. The immunoregulator according to PCT International Publication WO01/72831 also widens the scope of possibilities of dotter treatments.
  • the current invention provides additional modes and means of treatment.
  • the invention provides a method for modulating an ischemic event in a subject believed to be in need thereof comprising providing the subject with a signaling molecule comprising a short gene-regulatory peptide or functional analogue thereof, wherein the signaling molecule is administered in an amount sufficient to modulate the ischemic event.
  • the signal molecule is preferably a short peptide, preferably of at most 30 amino acids long, or a functional analogue or derivative thereof.
  • the peptide is an oligopeptide of from about 3 to about 15 amino acids long, preferably 4 to 12, more preferably 4 to 9, most preferably 4 to 6 amino acids long, or a functional analogue or derivative thereof.
  • such signaling molecule can be longer, for example by extending it (N- and/or C-terminally), with more amino acids or other side groups, which can for example be (enzymatically) cleaved off when the molecule enters the place of final destination.
  • the signaling molecule modulates translocation and/or activity of a gene transcription factor. It is particularly useful when the gene transcription factor comprises an NF- ⁇ B/Rel protein or an AP-1 protein. Ischemia induces increased expression of inflammatory cytokines due to activation of NF- ⁇ B and AP-1, and in a preferred embodiment the invention provides a method translocation and/or activity of the NF- ⁇ B/Rel protein is inhibited.
  • the peptide is selected from the group of peptides LQG, AQG, LQGV (SEQ ID NO: 1 of the hereby incorporated accompanying SEQUENCE LISTING), AQGV (SEQ ID NO: 2), LQGA (SEQ ID NO: 3), VLPALP (SEQ ID NO: 4), ALPALP (SEQ ID NO: 5), VAPALP (SEQ ID NO: 6), ALPALPQ (SEQ ID NO: 7), VLPAAPQ (SEQ ID NO: 8), VLPALAQ (SEQ ID NO: 9), LAGV (SEQ ID NO: 10), VLAALP (SEQ ID NO: 11), VLPALA (SEQ ID NO: 12), VLPALPQ (SEQ ID NO: 13), VLAALPQ (SEQ ID NO: 14), VLPALPA (SEQ ID NO: 15), GVLPALP (SEQ ID NO: 16), LQGVLPALPQVVC (SEQ ID NO: 17), LPGCPRGVNPVVS (SEQ ID NO
  • Ischemia induces increased expression of inflammatory cytokines due to activation of NF- ⁇ B and AP-1.
  • Inflammatory cytokines can be expressed by endothelium (for example, by trauma), perivascular cells and adherent or transmigrating leukocytes, inducing numerous pro-inflammatory and procoagulant effects. Together these effects predispose to inflammation, thrombosis and hemorrhage.
  • the present invention provides the opportunity to selectively control NF ⁇ B-dependent gene expression in tissues and organs in a living subject, preferably in a primate, allowing upregulating essentially anti-inflammatory responses such as IL-10, and downregulating essentially pro-inflammatory responses such as mediated by TNF- ⁇ , nitric oxide (NO), IL-5, IL-1 ⁇ .
  • essentially anti-inflammatory responses such as IL-10
  • essentially pro-inflammatory responses such as mediated by TNF- ⁇ , nitric oxide (NO), IL-5, IL-1 ⁇ .
  • the invention thus provides use of a NF ⁇ B regulating peptide or derivative thereof for the production of a pharmaceutical composition for the treatment of an ischemic event, preferably in a primate, and provides a method of treatment of an ischemic event, notably in a primate. It is preferred when the treatment comprises administering to the subject a pharmaceutical composition comprising an NF ⁇ B down-regulating peptide or functional analogue thereof.
  • VLPALPQVVC SEQ ID NO: 21
  • LQGVLPALPQ SEQ ID NO: 22
  • LQG LQGV
  • LQGV SEQ ID NO: 1
  • GVLPALPQ SEQ ID NO: 23
  • VLPALP SEQ ID NO: 4
  • VVC MTR and circular LQGVLPALPQVVC
  • VLPALPQVVC SEQ ID NO: 21
  • LQGVLPALPQ SEQ ID NO: 22
  • LQG LQGV
  • LQGV SEQ ID NO: 1
  • VLPALP SEQ ID NO: 4
  • composition that comprises at least two oligopeptides or functional analogues thereof, each capable of reducing production of NO and/or TNF- ⁇ by a cell, in particular wherein the at least two oligopeptides are selected from the group LQGV (SEQ ID NO: 1), AQGV (SEQ ID NO: 2) and VLPALP (SEQ ID NO: 4), for the treatment of an ischemic event, and, moreover to treat ischemia—perfusion injury.
  • LQGV SEQ ID NO: 1
  • AQGV SEQ ID NO: 2
  • VLPALP VLPALP
  • such a subject has suffered from ischemic events or has undergone anoxia or infarction.
  • a typical clinical instance is the myocardial infarction or chronic myocardial ischemia of heart tissue in various zones or areas of a living human subject, or, likewise a cerebrovascular infarct, such as a sudden massive infarct of the brain with immediate and possibly grave consequences, but also the so-called silent infarcts that go unnoticed for long times but are thought to be involved in the development of certain forms of dementias.
  • Typical examples also include other cardiovascular or circulatory disorders, such as heart failure, lacunar brain infarctions, Alzheimer's disease, thrombosis, arteriosclerosis, pregnancy related cardiovascular or circulatory disorders, retinopathies (such as associated with vascular diseases like diabetes) and the like.
  • cardiovascular or circulatory disorders such as heart failure, lacunar brain infarctions, Alzheimer's disease, thrombosis, arteriosclerosis, pregnancy related cardiovascular or circulatory disorders, retinopathies (such as associated with vascular diseases like diabetes) and the like.
  • NF ⁇ B/Rel family of transcription factors is activated and form different types of hetero- and homodimers among themselves to regulate the expression of target genes containing ⁇ B-specific binding sites.
  • NF- ⁇ B transcription factors are hetero- or homodimers of a family of related proteins characterized by the Rel homology domain. They form two subfamilies, those containing activation domains (p65-RELA, RELB, and c-REL) and those lacking activation domains (p50, p52).
  • the prototypical NF ⁇ B is a heterodimer of p65 (RELA) and p50 (NF- ⁇ B1).
  • p50-p65 heterodimers are known to be involved in enhancing the transcription of target genes and p50-p50 homodimers in transcriptional repression.
  • p65-p65 homodimers are known for both transcriptional activation and repressive activity against target genes.
  • ⁇ B DNA binding sites with varied affinities to different NFB dimers have been discovered in the promoters of several eukaryotic genes and the balance between activated NF ⁇ B homo- and heterodimers ultimately determines the nature and level of gene expression within the cell.
  • NF ⁇ B-regulating peptide refers to a peptide or a modification or derivative thereof capable of modulating the activation of members of the NF ⁇ B/Rel family of transcription factors. Activation of NF ⁇ B can lead to enhanced transcription of target genes. Also, it can lead to transcriptional repression of target genes. NF ⁇ B activation can be regulated at multiple levels.
  • an NF ⁇ B-regulating peptide is capable of modulating the transcription of genes that are under the control of NF ⁇ B/Rel family of transcription factors. Modulating comprises the upregulation or the downregulation of transcription.
  • a peptide according to the invention, or a functional derivative or analogue thereof is used for the production of a pharmaceutical composition for the treatment of ischemic events.
  • ischemic events are (but not limited to) cerebral vascular accident (CVA), circulatory diseases of the brain, retinopathies (such as associated with vascular diseases like diabetes), circulatory diseases of pregnancy, thrombosis, atherosclerosis, and so on.
  • CVA cerebral vascular accident
  • retinopathies such as associated with vascular diseases like diabetes
  • circulatory diseases of pregnancy thrombosis, atherosclerosis, and so on.
  • An ischemic event refers to an event in which the blood supply to a tissue is obstructed, such as stroke or myocardial infarction. Due to this obstruction, the endothelial tissue lining the affected blood vessels becomes “sticky” and begins to attract circulating white blood cells. The white cells bound to the endothelium eventually migrate into the brain or cardiac tissue, causing significant tissue destruction. Although neither acute myocardial infarction nor stroke is directly caused by inflammation, much of the underlying pathology and the damage that occurs after an acute ischemic event are caused by acute inflammatory responses during reperfusion, the restoration of blood flow to the affected organ.
  • a method for treating ischemic events, including cerebrovascular disease and ischemic heart failure, comprising administering to a subject in need of such a treatment a peptide according to the invention.
  • a method is provided to control the acute inflammatory response during reperfusion of the affected body part by administering a peptide, or a modification thereof, capable of modulating expression of a gene encoding a pro-inflammatory cytokine.
  • TNF- ⁇ is a pro-inflammatory and multifunctional cytokine that has been implicated in diverse pathological processes such as cancer, infection, and autoimmune inflammation.
  • TNF- ⁇ has been recently detected in various cardiac-related illnesses including congestive heart failure, myocarditis, dilated and septic cardiomyopathy, and ischemic heart diseases. TNF mRNA and TNF- ⁇ protein were detected in explanted hearts from humans with dilated cardiomyopathy and ischemic heart disease, but TNF- ⁇ was not detected in non-failing myocardium.
  • TNFR1 tumor necrosis factor receptor 1
  • TNFR2 tumor necrosis factor receptor 2
  • TNF2 tumor necrosis factor receptor associated factor 2
  • TRAF2-mediated signaling has been shown to activate NF- ⁇ B, with a resultant increase in the expression of the antioxidant protein manganese superoxide dismutase (MSOD).
  • MSOD antioxidant protein manganese superoxide dismutase
  • the invention now provides a method to increase the expression of gene products such as MSOD and other cytoprotective NF- ⁇ B-regulated genes.
  • the invention provides a method for treating an ischemic-reperfusion injury comprising administering to a subject in need of such treatment a signaling molecule comprising a peptide or functional analogue thereof the molecule capable of increasing production of IL-10 by a cell.
  • Increased IL-10 production is for example achieved by treating the subject systemically or treating the subjects infarcted area locally with peptides AQGV (SEQ ID NO: 2), LQGV (SEQ ID NO: 1) or VLPALP (SEQ ID NO: 4), or a functional analogue thereof similarly capable of modulating translocation and/or activity of a gene transcription factor present in a cell in the ischemic or infracted area.
  • AQGV SEQ ID NO: 2
  • LQGV SEQ ID NO: 1
  • VLPALP VLPALP
  • a functional analogue thereof similarly capable of modulating translocation and/or activity of a gene transcription factor present in a cell in the ischemic or infracted area.
  • peptides have the added advantage that TNF- ⁇ production by the cell is reduced.
  • an NF ⁇ B down-regulating peptide according to the invention can for example be introduced locally to the infracted area directly as a synthesized compound to living cells and tissues via a range of different delivery means.
  • Intracoronary delivery is accomplished using catheter-based deliveries of synthesized peptide (or derivative) suspended in a suitable buffer (such as saline) which can be injected locally (i.e., by injecting into the myocardium through the vessel wall) in the coronary artery using a suitable local delivery catheter such as a 10 mm InfusaSleeve catheter (Local Med, Palo Alto, Calif.) loaded over a 3.0 mm ⁇ 20 mm angioplasty balloon, delivered over a 0.014 inch angioplasty guide wire. Delivery is typically accomplished by first inflating the angioplasty balloon to 30 psi, and then delivering the protein through the local delivery catheter at 80 psi over 30 seconds (this can be modified to suit the delivery catheter).
  • a suitable buffer such as saline
  • a suitable local delivery catheter such as a 10 mm InfusaSleeve catheter (Local Med, Palo Alto, Calif.) loaded over a 3.0 mm ⁇ 20
  • Intracoronary bolus infusion of peptide (or derivative) synthesized previously can be accomplished by a manual injection of the substance through an Ultrafuse-X dual lumen catheter (SciMed, Minneapolis, Minn.) or another suitable device into proximal orifices of coronary arteries over 10 minutes.
  • Pericardial delivery of synthesized peptide is typically accomplished by installation of the peptide-containing solution into the pericardial sac.
  • the pericardium is accessed via a right atrial puncture, transthoracic puncture or via a direct surgical approach.
  • the peptide material is infused into the pericardial cavity and the catheter is withdrawn.
  • the delivery is accomplished via the aid of slow-release polymers such as heparinal-alginate or ethylene vinyl acetate (EVAc).
  • the desired amount of peptide/polymer is inserted under the epicardial fat or secured to the myocardial surface using, for example, sutures.
  • the peptide/polymer composition can be positioned along the adventitial surface of coronary vessels.
  • Intramyocardial delivery of synthesized peptide (or derivative) can be accomplished either under direct vision following thoracotomy or using thoracoscope or via a catheter. In either case, the peptide containing solution is injected using a syringe or other suitable device directly into the myocardium.
  • cc of volume can be injected into any given spot and multiple locations (up to 30 injections) can be done in each patient.
  • Catheter-based injections are carried out under fluoroscopic, ultrasound or Biosense NOGA guidance.
  • the desired area of the myocardium is injected using a catheter that allows for controlled local delivery of the material.
  • similar techniques are applied to administer the peptide locally to other infarcted areas, such as seen with cerebrovascular incidents.
  • the invention provides a method for modulating a cerebral ischemic event in a subject comprising providing the subject with a signaling molecule comprising a gene-regulatory peptide or functional analogue thereof in combination therapy with thrombolysis.
  • a signaling molecule comprising a gene-regulatory peptide or functional analogue thereof in combination therapy with thrombolysis.
  • Two major strategies can be used to reduce the neuronal damage following cerebral ischemia: restoration of cerebral blood perfusion through usage of thrombolytics and inhibition of the apoptotic and inflammatory cascades which result from ischemia through usage of a peptides or functional analogue according to the invention. Combining both treatment strategies provides additional benefits to those achieved by using the individual strategies alone. For instance, restoration of blood flow improves perfusion of the ischemic brain tissue with peptide compositions and enhances their protective effects.
  • Thrombolysis and/or prevention of thrombi are for example achieved by intravenous injection of beparin, in a bolus of 5,000 IU followed by infusion of 15,000 units/hour to induce an APTT-ratio of 2.0.
  • intramuscular injections of low-molecular weight heparin, such as fragmin of 200 IU/kg/day in 2 daily doses are given.
  • Intra-arterial thrombolysis is preferably applied within 3 hours of onset of ischemic stroke.
  • selective intra-arterial digital subtraction angiography is performed on a biplane, high-resolution angiography system (for example a Toshiba CAS 500) with a matrix of 1024 ⁇ 1024 pixels.
  • a 5.5.F-JB2 catheter (Valavanis) is inserted in the femoral artery and guided to the cerebral arteries for diagnostic 4-vessel angiography.
  • a microcatheter mostly a Fast Tracker 18 (Target Therapeutics) through the 5.5-F JB2 catheter is navigated into the cerebral arteria corresponding with the ischemic brain area.
  • a microcatheter is navigated into the occluded cerebral artery.
  • Urokinase (Urokinase HS Medac) in a mean dose usually ranging from 20,000 to 1,250,000 IU is infused directly into or near the proximal end of the occluding thrombus over 60 to 90 minutes.
  • treatment with peptide composition is preferably started at the same time.
  • the invention also provides a method for modulating an ischemic event in a subject comprising providing the subject with a signaling molecule comprising a gene-regulatory peptide or functional analogue thereof for the prevention of cerebral ischemia in patients with defined at risk periods.
  • a peptide or functional analogue thereof is valuable to prevent infarction, illustrated in two specific examples.
  • Cardiac or aortic surgery is frequently complicated with severe hypotensive periods and/or thrombo-embolic events which may result in cerebral or myclum ischemia and infarction.
  • the peptide composition according to the invention can be given in all or a specific subgroup of these patients, before, during and/or after surgery to prevent cerebral ischemia.
  • SAH aneurysmatic subarachnoid hemorrhagia
  • SAH is a life threatening intracerebral bleeding, usually due to a rupture of an aneurysm of the cerebral arteries in the circulus Willisi.
  • SAH affects 10.5 per 100,000 persons per year of which one-third will die. Up to one-third of patients will develop cerebral ischemia in the 3 weeks after SAH, which determines the final outcome and for which all patients with SAH will be admitted to intensive care units.
  • the pathophysiology of cerebral ischemia after SAH is not precisely known, but a specific role is claimed for the presence of subarachnoid blood and/or intracerebral inflammation and vasospasms.
  • NF ⁇ B down-regulating peptide should be given in this 3 weeks following SAH, alone or in combination with other forms of preventive treatments, during which these patients are at risk to develop cerebral ischemia and can be monitored at the intensive care unit.
  • an NF ⁇ B down-regulating peptide can be used to prevent (further) cerebral ischemia and improve final clinical outcome.
  • the invention furthermore provides a method to monitor and titrate therapeutic effect of a treatment with peptide according to the invention in patients with cerebral ischemia.
  • This is foremost achieved by clinical evaluation according to predefined neurological deficit-, disability- and handicap scales, such as the Oxford-handicap scale.
  • CT, CT-angiography, MRI, MR-angiography, and SPECT-scan can be done.
  • cytokines, soluble cytokine-receptors, chemokines are determined in follow-up plasma and cerebrospinal fluid (CSF) samples.
  • CSF cerebrospinal fluid
  • Intracerebral HPLC sensors provide for determining parenchyma oxygen, pH and small metabolites including lactate, pyruvate and glucose. This device is already in use in combination with intracranial pressure bolds to monitor the cerebral parenchyma of patients with contusio cerebri.
  • Preferred routes of administration of a peptide or functional analogue thereof according to the invention in patients with cerebral ischemia are: Intravenously in 0.9% saline solutions according to protocol; intrathecally.
  • the peptide composition may be given after a lumbar puncture with a 18 G needle or after subsequent insertion of a extralumbal catheter with the tip in the intrathecal space.
  • This way of drug administration can not be used in patients with large infarctions and danger of replacement of brain tissue or herniation, but is a useful way in treating patients with a SAH.
  • Intrathecal drug administration is an established route of drug administration in patients with leukemia and multiple sclerosis.
  • Intra-arterial A similar protocol is used as in intra-arterial thrombolysis.
  • selective intra-arterial digital substraction angiography is performed on a biplane, high-resolution angiography system (for example a Toshiba CAS 500) with a matrix of 1024 ⁇ 1024 pixels.
  • a 5.5.F-JB2 catheter (Valavanis) is inserted in the femoral artery and guided to the cerebral arteries for diagnostic 4-vessel angiography.
  • a microcatheter mostly a Fast Tracker 18 (Target Therapeutics) through the 5.5-F JB2 catheter is navigated into the cerebral arteria corresponding with the ischemic brain area. Perfusion of this area with peptide is achieved according to this protocol.
  • This route of administration is of special interest in case of combination therapy with intra-arterial thrombolysis. In that case the same devices and protocols are used in which the microcatheter is navigated into the occluded cerebral artery.
  • Urokinase Urokinase HS Medac
  • Urokinase HS Medac in a mean dose usually ranging from 20,000 to 1,250,000 is infused directly into or near the proximal end of the occluding thrombus over 60 to 90 minutes.
  • a very flexible hydrophilic guide wire catheter with a J shape tip to avoid perforation of the vessel wall for example a Silver Speed MTI 0.008 or 0.010 inch
  • a peptide or functional analogue may be applied locally after craniotomy.
  • suitable pharmaceutical carriers and vehicles are known conventionally to those skilled in the art.
  • the peptide compound will typically be dissolved or suspended in sterile water or saline.
  • systemic administration involves intravenous administration, for example per infusionem.
  • systemic administration per infusionem is advantageous, as the risk of bleeding is increased in such patients, necessitating the reduction of invasive measures such as the use of catheters or other puncturing techniques.
  • Improvement in neurological diseases is limited due to the restricted regeneration capacity of neurons, especially in the central nervous system (CNS). For this reason, and for the high susceptibility of neurons to ischemia and inflammation, treatment strategies in neurology more than in other medical disciplines, focus on an immediate prevention of (further) neural damage. Ischemia and inflammation of neural tissue are mediated by similar pathogenic pathways leading to and mediated by release and activation of transcription factors, such as NF- ⁇ B, and cytokines, such as TNF ⁇ . In addition, in many neurological diseases ischemic and inflammatory processes both contribute to (further) tissue damage.
  • the invention also provides a method for treating cerebral infarction with an NF ⁇ B down-regulating peptide according to the invention.
  • Cerebral infarction is a common and disabling neurological disease which results from an acute onset insufficient arterial blood supply and ischemia of the associated territorial brain.
  • the causes of the acute insufficient perfusion are (1) thrombo-embolic events related to atherosclerosis of large cerebral arteria and/or cardiac diseases leading to cortical infarctions, (2) hypotension leading to so called “watershed infarctions,” and (3) small vessel diseases related to hypertension and atherosclerosis leading to lacunair infarctions.
  • Each type of infarction may induce distinct patterns of neurological deficits related to the function of the damaged brain area. All these types of infarctions, especially multiple lacunar infaretions, may contribute to the development of vascular (or post-stroke) dementia.
  • Neurological deficits in stroke are potentially reversible, provided the duration of ischemia is short, such as in “transient ischemic attacks” (TIA's). Partial spontaneous improvement in ischemic strokes most likely results from reversible dysfunction of the penumbrae area, where ischemia does not evolve into infarction.
  • the invention also provides treatment of ischemic stroke patients with thrombolytic agents combined with treatment with an NF ⁇ B down-regulating peptide according to the invention, preferably within 3 hours after onset of neurological symptoms when cerebral ischemia in potential is a treatable state.
  • Permanent neurological deficit in stroke patients is due to apoptotic cell death of infarcted brain tissue caused by long lasting ischemic periods and subsequent activation of apoptotic pathways during the reperfusion phase.
  • Ischemia induces depolarization and release of excitatory amino acids such as glutamate leading to Ca 2+ and water influx, which successively leads to cerebral edema and Ca 2+ —mediated inflammatory and degenerative processes.
  • Ischemia induces increased expression of TNF and activation of NF- ⁇ B.
  • TNF can be expressed by endothelium (for example, by trauma), perivascular cells and adherent or transmigrating leukocytes, inducing numerous pro-inflammatory and procoagulant effects.
  • ⁇ -hCG oligopeptide derivates are known to inhibit TNF expression and NF- ⁇ B activation and successive inflammatory and apoptotic pathways. These characteristics should enable single ⁇ -hCG oligopeptide derivates or cocktails of derivates to prevent the further brain ischemia and infarction and the occurrence of complications, including cerebral edema and secondary hemorrhages, which may contribute to improvement of clinical outcome in stroke patients.
  • NF ⁇ B regulating peptide can be given in the same infusion, the peptide (or analogue) concentration preferably being from about 1 to about 1000 mg/l, but the peptide can also been given in a bolus injection.
  • the invention provides a method of treating a subject suffering from an ischemic event with a method and signaling molecule according to the invention concomitantly, or at least timely, with a thrombolytic agent, such as (recombinant) tissue plasminogen activator, or truncated forms thereof having tissue plasminogen activity, or streptokinase, or urokinase.
  • a thrombolytic agent such as (recombinant) tissue plasminogen activator, or truncated forms thereof having tissue plasminogen activity, or streptokinase, or urokinase.
  • such treatment can for example take the form of intravenous infusions of recombinant tissue plasminogen activator (rt-PA) at a dose of 0.9 mg/kg (maximum of 90 mg) in 0.9% saline solutions, whereby it is preferred that 10% of the rt-PA dose is given within 1 to 2 minutes and the remaining dose of rt-PA in 60 minutes.
  • rt-PA tissue plasminogen activator
  • such treatment can for example take the form of intravenous infusions of rt-PA at a dose of 15 mg as intravenous bolus, followed by 50 mg in the next 30 minutes followed by 35 mg in the next 60 minutes.
  • NF ⁇ B down-regulating peptide such as AQGV (SEQ ID NO: 2), LQGV (SEQ ID NO: 1) or VLPALP (SEQ ID NO: 4) at 2mg/kg and continue the infusion with a NF ⁇ B down regulating peptide such as AQGV (SEQ ID NO: 2), LQGV (SEQ ID NO: 1) or VLPALP (SEQ ID NO: 4) or a functional analogue thereof at a dose of 1 mg/kg bodyweight for every eight hours.
  • NF ⁇ B down-regulating peptide such as AQGV (SEQ ID NO: 2), LQGV (SEQ ID NO: 1) or VLPALP (SEQ ID NO: 4)
  • a signal molecule is administered in an effective concentration to an animal or human systemically, e.g., by intravenous, intra-muscular or intraperitoneal administration.
  • Another way of administration comprises perfusion of organs or tissue, be it in vivo or ex vivo, with a perfusion fluid comprising a signal molecule according to the invention.
  • Topical administration e.g., in ointments or sprays, may also apply, e.g., in or around infarcted areas in brain or heart, etc.
  • the administration may be done as a single dose, as a discontinuous sequence of various doses, or continuously for a period of time sufficient to permit substantial modulation of gene expression.
  • the duration of the administration may vary depending upon a number of factors which would readily be appreciated by those skilled in the art.
  • the administration dose of the active molecule may be varied over a fairly broad range.
  • concentrations of an active molecule which can be administered would be limited by efficacy at the lower end and the solubility of the compound at the upper end.
  • the optimal dose or doses for a particular patient should and can be determined by the physician or medical specialist involved, taking into consideration well-known relevant factors such as the condition, weight and age of the patient, etc.
  • mice Ten male C57BL/6 mice (23 to 26 g), 5 controls and 5 test animals were used as a model for ischemic stroke by middle cerebral artery occlusion/reperfusion. These mice are initially anesthetized with metofane and maintained with i.p. ketamine (60 mg/ml) and xylazine (5 mg/ml). Atropine methyl nitrate (0.18 mg/kg i.p.) is given to prevent airway obstruction. Animals are allowed to breathe spontaneously. A modified intravascular middle cerebral artery (MCA) occlusion technique is used to induce stroke.
  • MCA intravascular middle cerebral artery
  • a nonsiliconized, uncoated 6-0, 8-mm-long prolene suture with a rounded tip (diameter 0.20 mm) is advanced into the internal carotid artery to occlude the MCA for 1 hour, followed by 24 hours of reperfusion.
  • Cerebral blood perfusion is monitored by laser Doppler flowmetry (Transonic Systems). Laser Doppler flowmetry probes (0.8 mm in diameter) are positioned on the cortical surface 2 mm posterior to the bregma, both 3 and 6 mm to each side of midline. The procedure is considered to be successful if a >85% drop in CBF was observed immediately after placement of the suture.
  • Arterial blood gases (pH, PaO2, PaCO2) are measured before and during MCA occlusion with an ABL 30 Acid-Base Analyzer (Radiometer).
  • Each of the 5 test mice received a 1:1 mixture of LQGV (SEQ ID NO: 1) and VLPALP (SEQ ID NO: 4) at 5 mg/kg in a volume of 0.5 ml 0.9% saline which was given intravenously at 10 minutes, when blood flow was at a minimum, since these conditions would give a reasonable test of the bioactivity of these peptides during ischemia, because the time course of pathophysiological changes in the present murine model is different from that of human strokes, and the occlusion is experimentally removed after 1 hour.
  • Each of the control mice received 0.5 ml 0.9% saline i.v.
  • mice Early results control mice scored: 3, 5, 4, 2, 4; test mice scored: 3, 1, 3, 2, 1
  • TM-PC thrombomodulin-protein C
  • APC Activated protein C
  • EPCR endothelial protein C receptor
  • PAR-1 protease-activated receptor-1
  • the peptides as mentioned in this document such as LQG, AQG, LQGV (SEQ ID NO: 1), AQGV (SEQ ID NO: 2), LQGA (SEQ ID NO: 3), VLPALP (SEQ ID NO: 4), ALPALP (SEQ ID NO: 5), VAPALP (SEQ ID NO: 6), ALPALPQ (SEQ ID NO: 7), VLPAAPQ (SEQ ID NO: 8), VLPALAQ (SEQ ID NO: 9), LAGV (SEQ ID NO: 10), VLAALP (SEQ ID NO: 11), VLPALA (SEQ ID NO: 12), VLPALPQ (SEQ ID NO: 13), VLAALPQ (SEQ ID NO: 14), VLPALPA (SEQ ID NO: 15), GVLPALP (SEQ ID NO: 16), VVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCAL (SEQ ID NO: 24), RPRCRPINATLAVEKEGCPVCITVNTTIC
  • the side-chain of glutamine was protected with a trityl function.
  • the peptides were synthesized manually. Each coupling consisted of the following steps: (i) removal of the ⁇ -amino Fmoc-protection by piperidine in dimethylformamide (DMF), (ii) coupling of the Fmoc amino acid (3 eq) with diisopropylcarbodiimide (DIC)/1-hydroxybenzotriazole (HOBt) in DMF/N-methylformamide (NMP) and (iii) capping of the remaining amino functions with acetic anhydride/diisopropylethylamine (DIEA) in DMF/NMP.
  • DMF dimethylformamide
  • DIEA acetic anhydride/diisopropylethylamine
  • the peptide resin was treated with a mixture of trifluoroacetic acid (TFA)/H 2 O/triisopropylsilane (TIS) 95:2.5:2.5. After 30 minutes TIS was added until decolorization. The solution was evaporated in vacuo and the peptide precipitated with diethyl ether. The crude peptides were dissolved in water (50-100 mg/ml) and purified by reverse-phase high-performance liquid chromatography (RP-HPLC).
  • TFA trifluoroacetic acid
  • TIS triisopropylsilane
  • HPLC conditions were: column: Vydac TP21810C18 (10 ⁇ 250 mm); elution system: gradient system of 0.1% TFA in water v/v (A) and 0.1% TFA in acetonitrile (ACN) v/v (B); flow rate 6 ml/min; absorbance was detected from 190-370 nm.
  • gradient systems There were different gradient systems used. For example, for peptides LQG and LQGV (SEQ ID NO: 1): 10 minutes 100% A followed by linear gradient 0-10% B in 50 minutes.
  • VLPALP SEQ ID NO: 4
  • VLPALPQ VLPALPQ
  • the collected fractions were concentrated to about 5 ml by rotation film evaporation under reduced pressure at 40° C.
  • the remaining TFA was exchanged against acetate by eluting two times over a column with anion exchange resin (Merck II) in acetate form.
  • the elute was concentrated and lyophilized in 28 hours. Peptides later were prepared for use by dissolving them in PBS.
  • RAW 264.7 macrophages obtained from American Type Culture Collection (Manassas, Va.), were cultured at 37° C. in 5% CO2 using DMEM containing 10% FBS and antibiotics (100 U/ml of penicillin, and 100 ⁇ g/ml streptomycin). Cells (1 ⁇ 10 6 /ml) were incubated with peptide (10 ⁇ g/ml) in a volume of 2 ml. After 8 h of cultures cells were washed and prepared for nuclear extracts.
  • Nuclear extracts and EMSA were prepared according to Schreiber et al. Methods (Schrieber et al. 1989, Nucleic Acids Research 17). Briefly, nuclear extracts from peptide stimulated or nonstimulated macrophages were prepared by cell lysis followed by nuclear lysis. Cells were then suspended in 400 ⁇ l of buffer (10 mM HEPES (pH 7.9),10 mM KCl, 0.1 mM KCL, 0.1 mM EDTA, 0.1 mM EGTA, 1 mM DTT, 0.5 mM PMSF and protease inhibitors), vigorously vortexed for 15 s, left standing at 4° C.
  • buffer 10 mM HEPES (pH 7.9),10 mM KCl, 0.1 mM KCL, 0.1 mM EDTA, 0.1 mM EGTA, 1 mM DTT, 0.5 mM PMSF and protease inhibitors
  • Electrophoretic mobility shift assays were performed by incubating nuclear extracts prepared from control (RAW 264.7) and peptide treated RAW 264.7 cells with a 32P-labeled double-stranded probe (5′ AGCTCAGAGGGGGACTTTCCGAGAG 3′ (SEQ ID NO: 28)) synthesized to represent the NF ⁇ B binding sequence. Shortly, the probe was end-labeled with T4 polynucleotide kinase according to manufacturer's instructions (Promega, Madison, Wis.).
  • binding reaction mixtures (20 ⁇ l) contained 0.25 ⁇ g of poly(dI-dC) (Amersham Pharmacia Biotech) and 20,000 rpm of 32P-labeled DNA probe in binding buffer consisting of 5 mM EDTA, 20% Ficoll, 5 mM DTT, 300 mM KCl and 50 mM HEPES.
  • the binding reaction was started by the addition of cell extracts (10 ⁇ g) and was continued for 30 min at room temperature.
  • the DNA-protein complex was resolved from free oligonucleotide by electrophoresis in a 6% polyacrylamide gel. The gels were dried and exposed to x-ray films.
  • the transcription factor NF ⁇ B participates in the transcriptional regulation of a variety of genes.
  • Nuclear protein extracts were prepared from LPS and peptide treated RAW264.7 cells or from LPS treated RAW264.7 cells.
  • EMSA was performed.
  • the amount of NF ⁇ B present in the nuclear extracts of RAW264.7 cells treated with LPS or LPS was in combination with peptide for 4 hours.
  • peptides are able to modulate the translocation of NF ⁇ B since the amount of labeled oligonucleotide for NF ⁇ B is reduced.
  • peptides that show the modulation of translocation of NF- ⁇ B are: VLPALPQVVC (SEQ ID NO: 21), LQGVLPALPQ (SEQ ID NO: 22), LQG, LQGV (SEQ ID NO: 1), GVLPALPQ (SEQ ID NO: 23), VLPALP (SEQ ID NO: 4), VLPALPQ (SEQ ID NO: 13), GVLPALP (SEQ ID NO: 16), VVC, MTRV (SEQ ID NO: 20), MTR.
  • RAW 264.7 mouse macrophages were cultured in DMEM, containing 10% or 2% FBS, penicillin, streptomycin and glutamine, at 37° C., 5% CO 2 .
  • Cells were seeded in a 12-wells plate (3 ⁇ 10 6 cells/ml) in a total volume of 1 ml for 2hours and then stimulated with LPS ( E. coli 026:B6; Difco Laboratories, Detroit, Mich., USA) and/or NMPF (1 microgram/ml). After 30 minutes of incubation plates were centrifuged and cells were collected for nuclear extracts.
  • Nuclear extracts and EMSA were prepared according to Schreiber et al.
  • Nuclear extract (5-7.5 ⁇ g) was incubated for 30 minutes with 75000 cpm probe in binding reaction mixture (20 microliter) containing 0.5 ⁇ g poly dI-dC (Amersham Pharmacia Biotech) and binding buffer BSB (25 mM MgCl 2 , 5 mM CaCl 2 , 5mM DTT and 20% Ficoll) at room temperature.
  • the DNA-protein complex was resolved from free oligonucleotide by electrophoresis in a 4-6% polyacrylamide gel (150 V, 2-4 hours). The gel was then dried and exposed to x-ray film.
  • the transcription factor NF- ⁇ B participates in the transcriptional regulation of a variety of genes.
  • Nuclear protein extracts were prepared from either LPS (1 mg/ml), peptide (1 mg/ml) or LPS in combination with peptide treated and untreated RAW264.7 cells. In order to determine whether the peptides modulate the translocation of NF- ⁇ B into the nucleus, on these extracts EMSA was performed. Peptides are able to modulate the basal as well as LPS induced levels of NF- ⁇ B.
  • peptides that show the inhibition of LPS induced translocation of NF- ⁇ B are: VLPALPQVVC (SEQ ID NO: 21), LQGVLPALPQ (SEQ ID NO: 22), LQG, LQGV (SEQ ID NO: 1), GVLPALPQ (SEQ ID NO: 23), VLPALP (SEQ ID NO: 4), VVC, MTR and circular LQGVLPALPQVVC (SEQ ID NO: 17).
  • Peptides that in this experiment promote LPS induced translocation of NF- ⁇ B are: VLPALPQ (SEQ ID NO: 13), GVLPALP (SEQ ID NO: 16) and MTRV (SEQ ID NO: 20).
  • Basal levels of NF- ⁇ B in the nucleus was decreased by VLPALPQVVC (SEQ ID NO: 21), LQGVLPALPQ (SEQ ID NO: 22), LQG and LQGV (SEQ ID NO: 1) while basal levels of NF- ⁇ B in the nucleus was increased by GVLPALPQ (SEQ ID NO: 23), VLPALPQ, (SEQ ID NO: 13) GVLPALP (SEQ ID NO: 16), VVC, MTRV (SEQ ID NO: 20), MTR and LQGVLPALPQVVC (SEQ ID NO: 17).
  • QVVC (SEQ ID NO: 29) also showed the modulation of translocation of NF- ⁇ B into nucleus (data not shown).
  • Cells will be cultured in appropriate culture medium at 37° C., 5% CO 2 . Cells will be seeded in a 12-wells plate (usually 1 ⁇ 10 6 cells/ml) in a total volume of 1 ml for 2hours and then stimulated with regulatory peptide in the presence or absence of additional stimuli such as LPS. After 30 minutes of incubation plates will be centrifuged and cells are collected for cytosolic or nuclear extracts.
  • Nuclear Extracts Nuclear extracts and EMSA could be prepared according to Schreiber et al. Method (Schreiber et al. 1989, Nucleic Acids Research 17). Cells are collected in a tube and centrifuged for 5 minutes at 2000 rpm (rounds per minute) at 4° C. (Universal 30 RF, Hettich Zentrifuges).
  • the pellet is washed with ice-cold Tris buffered saline (TBS pH 7.4) and resuspended in 400 ⁇ l of a hypotonic buffer A (10 mM HEPES pH 7.9, 10 mM KCl, 0.1 mM EDTA, 0.1 mM EGTA, 1 mM DTT, 0.5 mM PMSF and protease inhibitor cocktail (CompleteTM Mini, Roche) and left on ice for 15 minutes. Twenty five micro liter 10% NP-40 is added and the sample is centrifuged (2 minutes, 4000 rpm, 4° C.). The supernatant (cytoplasmic fraction) was collected and stored at ⁇ 70° C. for analysis.
  • a hypotonic buffer A (10 mM HEPES pH 7.9, 10 mM KCl, 0.1 mM EDTA, 0.1 mM EGTA, 1 mM DTT, 0.5 mM PMSF and protease inhibitor cocktail (CompleteTM Mini, Roche
  • the pellet which contains the nuclei, is washed with 50 ⁇ l buffer A and resuspended in 50 ⁇ l buffer C (20 mM HEPES pH 7.9, 400 mM NaCl, 1 mM EDTA, 1 mM EGTA, 1 mM DTT, 0.5 mM PMSF and protease inhibitor cocktail and 10% glycerol).
  • 50 ⁇ l buffer C (20 mM HEPES pH 7.9, 400 mM NaCl, 1 mM EDTA, 1 mM EGTA, 1 mM DTT, 0.5 mM PMSF and protease inhibitor cocktail and 10% glycerol.
  • the samples are left to shake at 4° C. for at least 60 minutes.
  • the samples are centrifuged and the supernatant (nucleic fraction) is stored at ⁇ 70° C. for analysis.
  • EMSA For Electrophoretic mobility shift assays an oligonucleotide representing NF- ⁇ B binding sequence such as (5′-AGC TCA GAG GGG GAC TTT CCG AGA G-3′ (SEQ ID NO: 28)) are synthesized. Hundred pico mol sense and antisense oligo are annealed and labeled with ⁇ - 32 P-dATP using T4 polynucleotide kinase according to manufacture's instructions (Promega, Madison, Wis.).
  • Cytosolic extract or nuclear extract (5-7.5 ⁇ g) from cells treated with regulatory peptide or from untreated cells is incubated for 30 minutes with 75000 cpm probe in binding reaction mixture (20 ⁇ l) containing 0.5 ⁇ g poly dI-dC (Amersham Pharmacia Biotech) and binding buffer BSB (25 mM MgCl 2 , 5 mM CaCl 2 , 5 mM DTT and 20% Ficoll) at room temperature. Or cytosolic and nuclear extract from untreated cells or from cells treated with stimuli could also be incubated with probe in binding reaction mixture and binding buffer.
  • the DNA-protein complex is resolved from free oligonucleotide by electrophoresis in a 4-6% polyacrylamide gel (150 V, 2-4 hours). The gel is then dried and exposed to x-ray film. Peptides can be biotinylated and incubated with cells. Cells are then washed with phosphate-buffered saline, harvested in the absence or presence of certain stimulus (LPS, PHA, TPA, anti-CD3, VEGF, TSST-1, VIP or know drugs etc.).
  • certain stimulus LPS, PHA, TPA, anti-CD3, VEGF, TSST-1, VIP or know drugs etc.
  • cells lysates whole lysate, cytosolic fraction or nuclear fraction
  • lysis buffer by centrifugation at 6000 rpm for 1 minute.
  • Proteins are eluted by incubating the beads in 0.05 N NaOH for 1 mm at room temperature to hydrolyze the protein-peptide linkage and analyzed by SDS-polyacrylamide gel electrophoresis followed by immunoprecipitated with agarose-conjugated anti-NF- ⁇ B subunits antibody or immunoprecipitated with antibody against to be studied target. After hydrolyzing the protein-peptide linkage, the sample could be analyzed on HPLS and mass-spectrometry. Purified NF- ⁇ B subunits or cell lysate interaction with biotinylated regulatory peptide can be analyzed on biosensor technology. Peptides can be labeled with FITC and incubated with cells in the absence or presence of different stimulus.
  • cells After culturing, cells can be analyzed with fluorescent microscopy, confocal microscopy; flow cytometry (cell membrane staining and/or intracellular staining) or cells lysates are made and analyzed on HPLC and mass-spectrometry.
  • NF- ⁇ B transfected (reporter gene assay) cells and gene array technology can be used to determine the regulatory effects of peptides.
  • HPLC and mass-spectrometry analysis Purified NF- ⁇ B subunit or cytosolic/nuclear extract is incubated in the absence or presence of (regulatory) peptide is diluted (2:1) with 8 N guanidinium chloride and 0.1% trifluoroacetic acid, injected into a reverse-phase HPLC column (Vydac C18) equilibrated with solvent A (0.1% trifluoroacetic acid), and eluted with a gradient of 0 to 100% eluant B (90% acetonitrile in solvent A). Factions containing NF- ⁇ B subunit are pooled and concentrated. Fractions are then dissolved in appropriate volume and could be analyzed on mass-spectrometry.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Molecular Biology (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Endocrinology (AREA)
  • Reproductive Health (AREA)
  • Toxicology (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

The invention relates to the treatment of an ischemic event such as a stroke or myocardial infarction. The invention provides a method for modulating an ischemic event in a subject comprising providing the subject with a gene-regulatory peptide or functional analogue thereof. Furthermore, the invention provides use of an NF-κB down-regulating peptide or functional analogue thereof for the production of a pharmaceutical composition for the treatment of reperfusion injury occurring after an ischemic event in a subject.

Description

    CROSS-REFERENCE TO RELATED APPLICATION
  • This application is a continuation-in-part of U.S. patent application Ser. No. 10/028,075, filed Dec. 21, 2001, pending, the content of the entirety of which is incorporated by this reference.[0001]
  • TECHNICAL FIELD
  • The current invention relates to the body's innate way of modulation of important physiological processes and builds on insights reported in PCT International Publications WO99/59617 and WO01/72831 and PCT International Application PCT/NL02/00639, the contents of the entirety of all of which are incorporated by this reference. [0002]
  • BACKGROUND
  • In the aforementioned applications, small gene-regulatory peptides are described that are present naturally in pregnant women and are derived from proteolytic breakdown of placental gonadotropins such as human chorionic gonadotropin (hCG) produced during pregnancy. These peptides (in their active state often only at about 4 to 6 amino acids long) were shown to have unsurpassed immunological activity that they exert by regulating expression of genes encoding inflammatory mediators such as cytokines. Surprisingly, it was found that breakdown of hCG provides a cascade of peptides that help maintain a pregnant woman's immunological homeostasis. These peptides are nature's own substances that balance the immune system to assure that the mother stays immunologically sound while her fetus does not get prematurely rejected during pregnancy but instead is safely carried through its time of birth. [0003]
  • Where it was generally thought that the smallest breakdown products of proteins have no specific biological function on their own (except to serve as antigen for the immune system), it now emerges that the body in fact routinely utilizes the normal process of proteolytic breakdown of the proteins it produces to generate important gene-regulatory compounds, short peptides that control the expression of the body's own genes. Apparently the body uses a gene-control system ruled by small broken down products of the exact proteins that are encoded by its own genes. [0004]
  • It is known that during pregnancy the maternal system introduces a status of temporary immuno-modulation which results in suppression of maternal rejection responses directed against the fetus. Paradoxically, during pregnancy, often the mother's resistance to infection is increased and she is found to be better protected against the clinical symptoms of various auto-immune diseases such as rheumatism and multiple sclerosis. The protection of the fetus can thus not be interpreted only as a result of immune suppression. Each of the above three applications have provided insights by which the immunological balance between protection of the mother and protection of the fetus can be understood. [0005]
  • It was shown that certain short breakdown products of hCG (i.e., short peptides which can easily be synthesized, if needed modified, and used as pharmaceutical composition) exert a major regulatory activity on pro- or anti-inflammatory cytokine cascades that are governed by a family of crucial transcription factors, the NFκB family which stands central in regulating the expression of genes that shape the body's immune response. [0006]
  • Most of the hCG produced during pregnancy is produced by cells of the placenta, the exact organ where cells and tissues of mother and child most intensely meet and where immuno-modulation is most needed to fight off rejection. Being produced locally, the gene-regulatory peptides which are broken down from hCG in the placenta immediately balance the pro- or anti-inflammatory cytokine cascades found in the no-mans land between mother and child. Being produced by the typical placental cell, the trophoblast, the peptides traverse extracellular space; enter cells of the immune system and exert their immuno-modulatory activity by modulating NFκB-mediated expression of cytokine genes, thereby keeping the immunological responses in the placenta at bay. [0007]
  • BRIEF SUMMARY OF THE INVENTION
  • It is herein postulated that the beneficial effects seen on the occurrence and severity of auto-immune disease in the pregnant woman result from an overspill of the hCG-derived peptides into the body as a whole; however, these effects must not be overestimated, as it is easily understood that the further away from the placenta, the less immuno-modulatory activity aimed at preventing rejection of the fetus will be seen, if only because of a dilution of the placenta-produced peptides throughout the body as a whole. However, the immuno-modulatory and gene-regulatory activity of the peptides should by no means only be thought to occur during pregnancy and in the placenta; man and women alike produce hCG, for example in their pituitaries, and nature certainly utilizes the gene-regulatory activities of peptides in a larger whole. [0008]
  • Consequently, a novel therapeutic inroad is provided, using the pharmaceutical potential of gene-regulatory peptides and derivatives thereof. Indeed, evidence of specific up- or down-regulation of NFκB driven pro- or anti-inflammatory cytokine cascades that are each, and in concert, directing the body's immune response was found in silico in gene-arrays by expression profiling studies, in vitro after treatment of immune cells and in vivo in experimental animals treated with gene-regulatory peptides. Also, considering that NFκB is a primary effector of disease (A.S. Baldwin, J. Clin. Invest., 2001, 107:3-6), using the hCG derived gene-regulatory peptides offer significant potential for the treatment of a variety of human and animal diseases, thereby tapping the pharmaceutical potential of the exact substances that help balance the mother's immune system such that her pregnancy is safely maintained. [0009]
  • DETAILED DESCRIPTION OF THE INVENTION
  • The invention in particular relates to the treatment of an ischemic event such as a stroke or myocardial infarction. [0010]
  • An ischemic event refers to an event in which the blood supply to a tissue is obstructed. Due to this obstruction, the endothelial tissue lining the affected blood vessels becomes “sticky” and begins to attract circulating white blood cells. The white cells bound to the endothelium eventually migrate into the affected tissue, causing significant tissue destruction. Although neither acute myocardial infarction nor stroke is directly caused by inflammation, much of the underlying pathology and the damage that occurs after an acute ischemic event are caused by acute inflammatory responses during reperfusion, the restoration of blood flow to the affected organ. Early restitution of blood flow to ischemic tissues is essential to halt the progression of cellular injury associated with decrease of oxygen supply and nutrient delivery. This fact provides the basis for the traditional view that minimizing ischemic time is the only important intervention for diminishing the extent of ischemic injury. However, it is now well recognized that reperfusion of ischemic tissues initiates a complex series of reactions that can paradoxically injure tissues. Although several mechanisms have been proposed to explain the pathogenesis of ischemia—reperfusion injury, most attention has focused on a role for reactive oxygen and nitrogen metabolites and inflammatory leukocytes. In addition to the local tissue injury, distant organs can also be affected, particularly if the intensity of the inflammatory reaction in post ischemic tissue (e.g., intestine) is great. The remote effects of ischemia—reperfusion injury are most frequently observed in the lung and (cardio- or cerebro-)vascular system, and can result in the development of the systemic inflammatory response syndrome (SIRS) and multiple organ dysfunction syndrome (MODS), both of which account for 30-40% of the mortality in tertiary referral intensive care units (ICUs). This application, however, mostly deals with localized ischemic events. [0011]
  • In PCT International Publication WO01/72831 a method and a pharmaceutical composition are provided for modulating cardiovascular or circulatory disorders, such as heart failure, brain infarctions, Alzheimer's disease, thrombosis, arteriosclerosis, pregnancy-related cardiovascular or circulatory disorders and the like. It has been found that an immunoregulator as described in the application has a very beneficial effect on animals, including humans, suffering from a cardiovascular disorder. The immunoregulator according to PCT International Publication WO01/72831 also widens the scope of possibilities of dotter treatments. In cases where conventionally such a treatment could not be performed because of risks of an oxygen tension becoming too low, a dotter treatment in cases of myocardial infarction is feasible when combined with treatment with the immunoregulator. Accordingly, expensive and difficult bypass surgery may in many cases be avoided, and the application also suggested the same protective effect of the immunoregulator in other organs as well in circulatory related disease. [0012]
  • The current invention provides additional modes and means of treatment. The invention provides a method for modulating an ischemic event in a subject believed to be in need thereof comprising providing the subject with a signaling molecule comprising a short gene-regulatory peptide or functional analogue thereof, wherein the signaling molecule is administered in an amount sufficient to modulate the ischemic event. The signal molecule is preferably a short peptide, preferably of at most 30 amino acids long, or a functional analogue or derivative thereof. In a much preferred embodiment, the peptide is an oligopeptide of from about 3 to about 15 amino acids long, preferably 4 to 12, more preferably 4 to 9, most preferably 4 to 6 amino acids long, or a functional analogue or derivative thereof. Of course, such signaling molecule can be longer, for example by extending it (N- and/or C-terminally), with more amino acids or other side groups, which can for example be (enzymatically) cleaved off when the molecule enters the place of final destination. In particular a method is provided wherein the signaling molecule modulates translocation and/or activity of a gene transcription factor. It is particularly useful when the gene transcription factor comprises an NF-κB/Rel protein or an AP-1 protein. Ischemia induces increased expression of inflammatory cytokines due to activation of NF-κB and AP-1, and in a preferred embodiment the invention provides a method translocation and/or activity of the NF-κB/Rel protein is inhibited. In one embodiment, the peptide is selected from the group of peptides LQG, AQG, LQGV (SEQ ID NO: 1 of the hereby incorporated accompanying SEQUENCE LISTING), AQGV (SEQ ID NO: 2), LQGA (SEQ ID NO: 3), VLPALP (SEQ ID NO: 4), ALPALP (SEQ ID NO: 5), VAPALP (SEQ ID NO: 6), ALPALPQ (SEQ ID NO: 7), VLPAAPQ (SEQ ID NO: 8), VLPALAQ (SEQ ID NO: 9), LAGV (SEQ ID NO: 10), VLAALP (SEQ ID NO: 11), VLPALA (SEQ ID NO: 12), VLPALPQ (SEQ ID NO: 13), VLAALPQ (SEQ ID NO: 14), VLPALPA (SEQ ID NO: 15), GVLPALP (SEQ ID NO: 16), LQGVLPALPQVVC (SEQ ID NO: 17), LPGCPRGVNPVVS (SEQ ID NO: 18), LPGC (SEQ ID NO: 19), MTRV (SEQ ID NO: 20), MTR, VVC. [0013]
  • The invention is further explained by the use of the following illustrative examples.[0014]
  • EXAMPLES
  • Ischemia induces increased expression of inflammatory cytokines due to activation of NF-κB and AP-1. Inflammatory cytokines can be expressed by endothelium (for example, by trauma), perivascular cells and adherent or transmigrating leukocytes, inducing numerous pro-inflammatory and procoagulant effects. Together these effects predispose to inflammation, thrombosis and hemorrhage. Of clinical and medical interest and value, the present invention provides the opportunity to selectively control NFκB-dependent gene expression in tissues and organs in a living subject, preferably in a primate, allowing upregulating essentially anti-inflammatory responses such as IL-10, and downregulating essentially pro-inflammatory responses such as mediated by TNF-α, nitric oxide (NO), IL-5, IL-1β. [0015]
  • The invention thus provides use of a NFκB regulating peptide or derivative thereof for the production of a pharmaceutical composition for the treatment of an ischemic event, preferably in a primate, and provides a method of treatment of an ischemic event, notably in a primate. It is preferred when the treatment comprises administering to the subject a pharmaceutical composition comprising an NFκB down-regulating peptide or functional analogue thereof. Examples of useful NFκB down-regulating peptides are VLPALPQVVC (SEQ ID NO: 21), LQGVLPALPQ (SEQ ID NO: 22), LQG, LQGV (SEQ ID NO: 1), GVLPALPQ (SEQ ID NO: 23), VLPALP (SEQ ID NO: 4), VVC, MTR and circular LQGVLPALPQVVC (SEQ ID NO: 17). More down-regulating peptides and functional analogues can be found using the methods as provided herein. Most prominent among NFκB down-regulating peptides are VLPALPQVVC (SEQ ID NO: 21), LQGVLPALPQ (SEQ ID NO: 22), LQG, LQGV (SEQ ID NO: 1), and VLPALP (SEQ ID NO: 4). These are also capable of reducing production of NO by a cell. It is herein also provided to use a composition that comprises at least two oligopeptides or functional analogues thereof, each capable of reducing production of NO and/or TNF-α by a cell, in particular wherein the at least two oligopeptides are selected from the group LQGV (SEQ ID NO: 1), AQGV (SEQ ID NO: 2) and VLPALP (SEQ ID NO: 4), for the treatment of an ischemic event, and, moreover to treat ischemia—perfusion injury. [0016]
  • In one such instance as provided herein, such a subject has suffered from ischemic events or has undergone anoxia or infarction. A typical clinical instance is the myocardial infarction or chronic myocardial ischemia of heart tissue in various zones or areas of a living human subject, or, likewise a cerebrovascular infarct, such as a sudden massive infarct of the brain with immediate and possibly grave consequences, but also the so-called silent infarcts that go unnoticed for long times but are thought to be involved in the development of certain forms of dementias. [0017]
  • Typical examples also include other cardiovascular or circulatory disorders, such as heart failure, lacunar brain infarctions, Alzheimer's disease, thrombosis, arteriosclerosis, pregnancy related cardiovascular or circulatory disorders, retinopathies (such as associated with vascular diseases like diabetes) and the like. [0018]
  • In response to a variety of pathophysiological and developmental signals, the NFκB/Rel family of transcription factors is activated and form different types of hetero- and homodimers among themselves to regulate the expression of target genes containing κB-specific binding sites. NF-κB transcription factors are hetero- or homodimers of a family of related proteins characterized by the Rel homology domain. They form two subfamilies, those containing activation domains (p65-RELA, RELB, and c-REL) and those lacking activation domains (p50, p52). The prototypical NFκB is a heterodimer of p65 (RELA) and p50 (NF-κB1). Among the activated NFκB dimers, p50-p65 heterodimers are known to be involved in enhancing the transcription of target genes and p50-p50 homodimers in transcriptional repression. However, p65-p65 homodimers are known for both transcriptional activation and repressive activity against target genes. κB DNA binding sites with varied affinities to different NFB dimers have been discovered in the promoters of several eukaryotic genes and the balance between activated NFκB homo- and heterodimers ultimately determines the nature and level of gene expression within the cell. The term “NFκB-regulating peptide” as used herein refers to a peptide or a modification or derivative thereof capable of modulating the activation of members of the NFκB/Rel family of transcription factors. Activation of NFκB can lead to enhanced transcription of target genes. Also, it can lead to transcriptional repression of target genes. NFκB activation can be regulated at multiple levels. For example, the dynamic shuttling of the inactive NFκB dimers between the cytoplasm and nucleus by IκB proteins and its termination by phosphorylation and proteasomal degradation, direct phosphorylation, acetylation of NFκB factors, and dynamic reorganization of NFκB subunits among the activated NFκB dimers have all been identified as key regulatory steps in NFκB activation and, consequently, in NFκB-mediated transcription processes. Thus, an NFκB-regulating peptide is capable of modulating the transcription of genes that are under the control of NFκB/Rel family of transcription factors. Modulating comprises the upregulation or the downregulation of transcription. In a preferred embodiment, a peptide according to the invention, or a functional derivative or analogue thereof is used for the production of a pharmaceutical composition for the treatment of ischemic events. Examples of such events are (but not limited to) cerebral vascular accident (CVA), circulatory diseases of the brain, retinopathies (such as associated with vascular diseases like diabetes), circulatory diseases of pregnancy, thrombosis, atherosclerosis, and so on. [0019]
  • An ischemic event refers to an event in which the blood supply to a tissue is obstructed, such as stroke or myocardial infarction. Due to this obstruction, the endothelial tissue lining the affected blood vessels becomes “sticky” and begins to attract circulating white blood cells. The white cells bound to the endothelium eventually migrate into the brain or cardiac tissue, causing significant tissue destruction. Although neither acute myocardial infarction nor stroke is directly caused by inflammation, much of the underlying pathology and the damage that occurs after an acute ischemic event are caused by acute inflammatory responses during reperfusion, the restoration of blood flow to the affected organ. Thus, a method is provided herein for treating ischemic events, including cerebrovascular disease and ischemic heart failure, comprising administering to a subject in need of such a treatment a peptide according to the invention. In particular, a method is provided to control the acute inflammatory response during reperfusion of the affected body part by administering a peptide, or a modification thereof, capable of modulating expression of a gene encoding a pro-inflammatory cytokine. TNF-α is a pro-inflammatory and multifunctional cytokine that has been implicated in diverse pathological processes such as cancer, infection, and autoimmune inflammation. TNF-α has been recently detected in various cardiac-related illnesses including congestive heart failure, myocarditis, dilated and septic cardiomyopathy, and ischemic heart diseases. TNF mRNA and TNF-α protein were detected in explanted hearts from humans with dilated cardiomyopathy and ischemic heart disease, but TNF-α was not detected in non-failing myocardium. Although the complete portfolio of signaling pathways that are common to both tumor necrosis factor receptor 1 (TNFR1) and tumor necrosis factor receptor 2 (TNFR2) is not known, it is of interest to note that a recently described zinc finger protein, termed tumor necrosis factor receptor associated factor 2 (TRAF2), has been shown to be involved with both TNFR1- and TNFR2-mediated signaling. Consequently, TRAF2-mediated signaling has been shown to activate NF-κB, with a resultant increase in the expression of the antioxidant protein manganese superoxide dismutase (MSOD). Previous studies suggested that the cytoprotective effects of TNF in the setting of myocardial ischemia were mediated through TNF-induced upregulation of MSOD. It was suggested that pro-inflammatory cytokines such as TNF may play an important role in the timing of cardiac stress response, both by providing early antiapoptotic cytoprotective signals that are responsible for delimiting cardiac injury and also by providing delayed signals that facilitate tissue repair and remodeling once myocardial damage has supervened. Given the observation that some peptides according to the invention are capable of upregulating at least one gene in a cell, the invention now provides a method to increase the expression of gene products such as MSOD and other cytoprotective NF-κB-regulated genes. In particular, the invention provides a method for treating an ischemic-reperfusion injury comprising administering to a subject in need of such treatment a signaling molecule comprising a peptide or functional analogue thereof the molecule capable of increasing production of IL-10 by a cell. Increased IL-10 production is for example achieved by treating the subject systemically or treating the subjects infarcted area locally with peptides AQGV (SEQ ID NO: 2), LQGV (SEQ ID NO: 1) or VLPALP (SEQ ID NO: 4), or a functional analogue thereof similarly capable of modulating translocation and/or activity of a gene transcription factor present in a cell in the ischemic or infracted area. These peptides have the added advantage that TNF-α production by the cell is reduced. When taking ischemic heart failure as an example, an NFκB down-regulating peptide according to the invention can for example be introduced locally to the infracted area directly as a synthesized compound to living cells and tissues via a range of different delivery means. These include the following. [0020]
  • A. Intracoronary delivery is accomplished using catheter-based deliveries of synthesized peptide (or derivative) suspended in a suitable buffer (such as saline) which can be injected locally (i.e., by injecting into the myocardium through the vessel wall) in the coronary artery using a suitable local delivery catheter such as a 10 mm InfusaSleeve catheter (Local Med, Palo Alto, Calif.) loaded over a 3.0 mm×20 mm angioplasty balloon, delivered over a 0.014 inch angioplasty guide wire. Delivery is typically accomplished by first inflating the angioplasty balloon to 30 psi, and then delivering the protein through the local delivery catheter at 80 psi over 30 seconds (this can be modified to suit the delivery catheter). [0021]
  • B. Intracoronary bolus infusion of peptide (or derivative) synthesized previously can be accomplished by a manual injection of the substance through an Ultrafuse-X dual lumen catheter (SciMed, Minneapolis, Minn.) or another suitable device into proximal orifices of coronary arteries over 10 minutes. [0022]
  • C. Pericardial delivery of synthesized peptide (or derivative) is typically accomplished by installation of the peptide-containing solution into the pericardial sac. The pericardium is accessed via a right atrial puncture, transthoracic puncture or via a direct surgical approach. Once the access is established, the peptide material is infused into the pericardial cavity and the catheter is withdrawn. Alternatively, the delivery is accomplished via the aid of slow-release polymers such as heparinal-alginate or ethylene vinyl acetate (EVAc). In both cases, once the peptide (or derivative) is integrated into the polymer, the desired amount of peptide/polymer is inserted under the epicardial fat or secured to the myocardial surface using, for example, sutures. In addition, the peptide/polymer composition can be positioned along the adventitial surface of coronary vessels. [0023]
  • D. Intramyocardial delivery of synthesized peptide (or derivative) can be accomplished either under direct vision following thoracotomy or using thoracoscope or via a catheter. In either case, the peptide containing solution is injected using a syringe or other suitable device directly into the myocardium. [0024]
  • Up to 2 cc of volume can be injected into any given spot and multiple locations (up to 30 injections) can be done in each patient. Catheter-based injections are carried out under fluoroscopic, ultrasound or Biosense NOGA guidance. In all cases after catheter introduction into the left ventricle the desired area of the myocardium is injected using a catheter that allows for controlled local delivery of the material. Of course, similar techniques are applied to administer the peptide locally to other infarcted areas, such as seen with cerebrovascular incidents. [0025]
  • In a further embodiment, the invention provides a method for modulating a cerebral ischemic event in a subject comprising providing the subject with a signaling molecule comprising a gene-regulatory peptide or functional analogue thereof in combination therapy with thrombolysis. Two major strategies can be used to reduce the neuronal damage following cerebral ischemia: restoration of cerebral blood perfusion through usage of thrombolytics and inhibition of the apoptotic and inflammatory cascades which result from ischemia through usage of a peptides or functional analogue according to the invention. Combining both treatment strategies provides additional benefits to those achieved by using the individual strategies alone. For instance, restoration of blood flow improves perfusion of the ischemic brain tissue with peptide compositions and enhances their protective effects. Thrombolysis and/or prevention of thrombi are for example achieved by intravenous injection of beparin, in a bolus of 5,000 IU followed by infusion of 15,000 units/hour to induce an APTT-ratio of 2.0. Alternatively, intramuscular injections of low-molecular weight heparin, such as fragmin of 200 IU/kg/day in 2 daily doses, are given. Intra-arterial thrombolysis is preferably applied within 3 hours of onset of ischemic stroke. In short, selective intra-arterial digital subtraction angiography is performed on a biplane, high-resolution angiography system (for example a Toshiba CAS 500) with a matrix of 1024×1024 pixels. A 5.5.F-JB2 catheter (Valavanis) is inserted in the femoral artery and guided to the cerebral arteries for diagnostic 4-vessel angiography. A microcatheter, mostly a Fast Tracker 18 (Target Therapeutics) through the 5.5-F JB2 catheter is navigated into the cerebral arteria corresponding with the ischemic brain area. A microcatheter is navigated into the occluded cerebral artery. Urokinase (Urokinase HS Medac) in a mean dose usually ranging from 20,000 to 1,250,000 IU is infused directly into or near the proximal end of the occluding thrombus over 60 to 90 minutes. For mechanical disruption and removal of the thrombotic material additional usage of a very flexible hydrophilic guide wire catheter with a J shape tip to avoid perforation of the vessel wall (for example a Silver Speed MTI 0.008 or 0.010 inch) may be necessary. In addition to agents for thrombolysis and/or prevention of thrombosis, whether applied intravenously, intramuscularly or intra-arterial, treatment with peptide composition is preferably started at the same time. The invention also provides a method for modulating an ischemic event in a subject comprising providing the subject with a signaling molecule comprising a gene-regulatory peptide or functional analogue thereof for the prevention of cerebral ischemia in patients with defined at risk periods. Some conditions are frequently followed by cerebral ischemia, in which a peptide or functional analogue thereof is valuable to prevent infarction, illustrated in two specific examples. (1) Cardiac or aortic surgery is frequently complicated with severe hypotensive periods and/or thrombo-embolic events which may result in cerebral or myclum ischemia and infarction. The peptide composition according to the invention can be given in all or a specific subgroup of these patients, before, during and/or after surgery to prevent cerebral ischemia. (2) The final outcome in patients with aneurysmatic subarachnoid hemorrhagia (SAH) is largely determined by the development of cerebral ischemia in the subsequent 3 weeks. SAH is a life threatening intracerebral bleeding, usually due to a rupture of an aneurysm of the cerebral arteries in the circulus Willisi. SAH affects 10.5 per 100,000 persons per year of which one-third will die. Up to one-third of patients will develop cerebral ischemia in the 3 weeks after SAH, which determines the final outcome and for which all patients with SAH will be admitted to intensive care units. The pathophysiology of cerebral ischemia after SAH is not precisely known, but a specific role is claimed for the presence of subarachnoid blood and/or intracerebral inflammation and vasospasms. Treatment to prevent cerebral ischemia, including triple H-therapy (hypervolemia, hemodilution, hypertension), vasodilators, and endovascular approaches to symptomatic vasospasms, thus far are insufficient in many patients. A NFκB down-regulating peptide should be given in this 3 weeks following SAH, alone or in combination with other forms of preventive treatments, during which these patients are at risk to develop cerebral ischemia and can be monitored at the intensive care unit. In these two and other conditions in which there is a limited period with a significant increase to develop cerebral ischemia, an NFκB down-regulating peptide can be used to prevent (further) cerebral ischemia and improve final clinical outcome. [0026]
  • The invention furthermore provides a method to monitor and titrate therapeutic effect of a treatment with peptide according to the invention in patients with cerebral ischemia. This is foremost achieved by clinical evaluation according to predefined neurological deficit-, disability- and handicap scales, such as the Oxford-handicap scale. CT, CT-angiography, MRI, MR-angiography, and SPECT-scan can be done. Also, cytokines, soluble cytokine-receptors, chemokines are determined in follow-up plasma and cerebrospinal fluid (CSF) samples. Follow-up CSF samples can be obtained by permanent monitoring via ventricular catheters. Intracerebral HPLC sensors provide for determining parenchyma oxygen, pH and small metabolites including lactate, pyruvate and glucose. This device is already in use in combination with intracranial pressure bolds to monitor the cerebral parenchyma of patients with contusio cerebri. [0027]
  • Preferred routes of administration of a peptide or functional analogue thereof according to the invention in patients with cerebral ischemia are: Intravenously in 0.9% saline solutions according to protocol; intrathecally. In short, the peptide composition may be given after a lumbar puncture with a 18 G needle or after subsequent insertion of a extralumbal catheter with the tip in the intrathecal space. This way of drug administration can not be used in patients with large infarctions and danger of replacement of brain tissue or herniation, but is a useful way in treating patients with a SAH. Intrathecal drug administration is an established route of drug administration in patients with leukemia and multiple sclerosis. In patients with SAH extralumar drains are already frequently used to prevent or treat hydrocephalus, a common complication in SAH. Intra-arterial. A similar protocol is used as in intra-arterial thrombolysis. In short, selective intra-arterial digital substraction angiography is performed on a biplane, high-resolution angiography system (for example a Toshiba CAS 500) with a matrix of 1024×1024 pixels. A 5.5.F-JB2 catheter (Valavanis) is inserted in the femoral artery and guided to the cerebral arteries for diagnostic 4-vessel angiography. A microcatheter, mostly a Fast Tracker 18 (Target Therapeutics) through the 5.5-F JB2 catheter is navigated into the cerebral arteria corresponding with the ischemic brain area. Perfusion of this area with peptide is achieved according to this protocol. This route of administration is of special interest in case of combination therapy with intra-arterial thrombolysis. In that case the same devices and protocols are used in which the microcatheter is navigated into the occluded cerebral artery. Urokinase (Urokinase HS Medac) in a mean dose usually ranging from 20,000 to 1,250,000 is infused directly into or near the proximal end of the occluding thrombus over 60 to 90 minutes. For mechanical disruption and removal of the thrombotic material additional usage of a very flexible hydrophilic guide wire catheter with a J shape tip to avoid perforation of the vessel wall (for example a Silver Speed MTI 0.008 or 0.010 inch) may be necessary. Furthermore, a peptide or functional analogue may be applied locally after craniotomy. A range of suitable pharmaceutical carriers and vehicles are known conventionally to those skilled in the art. Thus, for parenteral or systemic administration, the peptide compound will typically be dissolved or suspended in sterile water or saline. Typically, systemic administration involves intravenous administration, for example per infusionem. Especially when the subject is at risk to experience iatrogenic reperfusion injury occurring after the ischemic event, for example due to treatment with an anticoagulant or a thrombolytic agent, systemic administration per infusionem is advantageous, as the risk of bleeding is increased in such patients, necessitating the reduction of invasive measures such as the use of catheters or other puncturing techniques. [0028]
  • Improvement in neurological diseases is limited due to the restricted regeneration capacity of neurons, especially in the central nervous system (CNS). For this reason, and for the high susceptibility of neurons to ischemia and inflammation, treatment strategies in neurology more than in other medical disciplines, focus on an immediate prevention of (further) neural damage. Ischemia and inflammation of neural tissue are mediated by similar pathogenic pathways leading to and mediated by release and activation of transcription factors, such as NF-κB, and cytokines, such as TNFα. In addition, in many neurological diseases ischemic and inflammatory processes both contribute to (further) tissue damage. More than other diseases neurological disorders will therefore profit from immune mediating agents, such as by treatment with an β-hCG oligopeptide derivate such as an NFκB down-regulating peptide according to the invention, that has an immediate and pleiotropic effect and inhibit these common pathways in both ischemic and inflammatory processes. The invention also provides a method for treating cerebral infarction with an NFκB down-regulating peptide according to the invention. [0029]
  • Cerebral infarction is a common and disabling neurological disease which results from an acute onset insufficient arterial blood supply and ischemia of the associated territorial brain. The causes of the acute insufficient perfusion are (1) thrombo-embolic events related to atherosclerosis of large cerebral arteria and/or cardiac diseases leading to cortical infarctions, (2) hypotension leading to so called “watershed infarctions,” and (3) small vessel diseases related to hypertension and atherosclerosis leading to lacunair infarctions. Each type of infarction may induce distinct patterns of neurological deficits related to the function of the damaged brain area. All these types of infarctions, especially multiple lacunar infaretions, may contribute to the development of vascular (or post-stroke) dementia. [0030]
  • Neurological deficits in stroke are potentially reversible, provided the duration of ischemia is short, such as in “transient ischemic attacks” (TIA's). Partial spontaneous improvement in ischemic strokes most likely results from reversible dysfunction of the penumbrae area, where ischemia does not evolve into infarction. The invention also provides treatment of ischemic stroke patients with thrombolytic agents combined with treatment with an NFκB down-regulating peptide according to the invention, preferably within 3 hours after onset of neurological symptoms when cerebral ischemia in potential is a treatable state. [0031]
  • Permanent neurological deficit in stroke patients is due to apoptotic cell death of infarcted brain tissue caused by long lasting ischemic periods and subsequent activation of apoptotic pathways during the reperfusion phase. Ischemia induces depolarization and release of excitatory amino acids such as glutamate leading to Ca[0032] 2+ and water influx, which successively leads to cerebral edema and Ca2+—mediated inflammatory and degenerative processes. Ischemia induces increased expression of TNF and activation of NF-κB. TNF can be expressed by endothelium (for example, by trauma), perivascular cells and adherent or transmigrating leukocytes, inducing numerous pro-inflammatory and procoagulant effects. Together these effects predispose to local inflammation, thrombosis and hemorrhage. As such they can contribute to stroke initiation, progression of brain damage and in development of tolerance to ischemia. In addition, TNF may contribute to repair and recovery after stroke as an important mediator and modulator of inflammation. β-hCG oligopeptide derivates are known to inhibit TNF expression and NF-κB activation and successive inflammatory and apoptotic pathways. These characteristics should enable single β-hCG oligopeptide derivates or cocktails of derivates to prevent the further brain ischemia and infarction and the occurrence of complications, including cerebral edema and secondary hemorrhages, which may contribute to improvement of clinical outcome in stroke patients. Ischemia and infarction secondary to cerebral contusion and to epi-, subarachnoid- and subdural hemorrhages play a significant role in final brain damage and clinical outcome in patients with these disorders. Local TNF expression and NF-κB activation due to ischemia in these diseases will predispose to local inflammation, thrombosis and hemorrhage, similar to ischemic stroke patients. Therefore administration of single NFκB down regulating peptides or mixtures thereof contributes to improvement of final outcome also in these diseases. In patients with contusio cerebri and intracranial pressure treatment it is advantageous to combine treatment with the peptides or functional analogues thereof with osmotic agents like mannitol to reduce intracranial pressure and stimulate cerebral perfusion, i.e. by administering intravenous infusions of mannitol 20% in 0.9% saline solutions of 200 ml, or another hypertonic solution, 1 to 6 times a day. NFκB regulating peptide can be given in the same infusion, the peptide (or analogue) concentration preferably being from about 1 to about 1000 mg/l, but the peptide can also been given in a bolus injection. Doses of 1 to 5 mg/kg bodyweight, for example every eight hours in a bolus injection or per infusionem until the patient stabilizes, are recommended. For example in cases where large infarcted areas are expected or diagnosed, it is preferred to monitor cytokine profiles, such as TNF-α or IL-10 levels, in the plasma (or cerebrospinal fluid) of the treated patient, and to stop treatment when these levels are normal. In patients with contusion cerebri, intracranial pressure and intraparechymal oxygen and metabolites can be monitored using intracranial sensors. In a preferred embodiment, the invention provides a method of treating a subject suffering from an ischemic event with a method and signaling molecule according to the invention concomitantly, or at least timely, with a thrombolytic agent, such as (recombinant) tissue plasminogen activator, or truncated forms thereof having tissue plasminogen activity, or streptokinase, or urokinase. In the case of an cerebrovascular incident, such treatment can for example take the form of intravenous infusions of recombinant tissue plasminogen activator (rt-PA) at a dose of 0.9 mg/kg (maximum of 90 mg) in 0.9% saline solutions, whereby it is preferred that 10% of the rt-PA dose is given within 1 to 2 minutes and the remaining dose of rt-PA in 60 minutes. In the case of an acute myocardial infarction, such treatment can for example take the form of intravenous infusions of rt-PA at a dose of 15 mg as intravenous bolus, followed by 50 mg in the next 30 minutes followed by 35 mg in the next 60 minutes. For the sake of treating the resulting perfusion injury that occurs due to the lysis of the thrombus and the subsequent perfusion of the ischemic area, it is herein provided to also provide the patient with a bolus injection of NFκB down-regulating peptide such as AQGV (SEQ ID NO: 2), LQGV (SEQ ID NO: 1) or VLPALP (SEQ ID NO: 4) at 2mg/kg and continue the infusion with a NFκB down regulating peptide such as AQGV (SEQ ID NO: 2), LQGV (SEQ ID NO: 1) or VLPALP (SEQ ID NO: 4) or a functional analogue thereof at a dose of 1 mg/kg bodyweight for every eight hours. Dosages may be increased or decreased, for example depending on the outcome of monitoring the cytokine profile in the plasma of the patient. In one embodiment of the present invention, a signal molecule is administered in an effective concentration to an animal or human systemically, e.g., by intravenous, intra-muscular or intraperitoneal administration. Another way of administration comprises perfusion of organs or tissue, be it in vivo or ex vivo, with a perfusion fluid comprising a signal molecule according to the invention. Topical administration, e.g., in ointments or sprays, may also apply, e.g., in or around infarcted areas in brain or heart, etc. The administration may be done as a single dose, as a discontinuous sequence of various doses, or continuously for a period of time sufficient to permit substantial modulation of gene expression. In the case of a continuous administration, the duration of the administration may vary depending upon a number of factors which would readily be appreciated by those skilled in the art.
  • The administration dose of the active molecule may be varied over a fairly broad range. The concentrations of an active molecule which can be administered would be limited by efficacy at the lower end and the solubility of the compound at the upper end. The optimal dose or doses for a particular patient should and can be determined by the physician or medical specialist involved, taking into consideration well-known relevant factors such as the condition, weight and age of the patient, etc. [0033]
  • Ten male C57BL/6 mice (23 to 26 g), 5 controls and 5 test animals were used as a model for ischemic stroke by middle cerebral artery occlusion/reperfusion. These mice are initially anesthetized with metofane and maintained with i.p. ketamine (60 mg/ml) and xylazine (5 mg/ml). Atropine methyl nitrate (0.18 mg/kg i.p.) is given to prevent airway obstruction. Animals are allowed to breathe spontaneously. A modified intravascular middle cerebral artery (MCA) occlusion technique is used to induce stroke. A nonsiliconized, uncoated 6-0, 8-mm-long prolene suture with a rounded tip (diameter 0.20 mm) is advanced into the internal carotid artery to occlude the MCA for 1 hour, followed by 24 hours of reperfusion. [0034]
  • Cerebral blood perfusion (CBF) is monitored by laser Doppler flowmetry (Transonic Systems). Laser Doppler flowmetry probes (0.8 mm in diameter) are positioned on the cortical surface 2 mm posterior to the bregma, both 3 and 6 mm to each side of midline. The procedure is considered to be successful if a >85% drop in CBF was observed immediately after placement of the suture. [0035]
  • Survival and neurological deficits is monitored and scored as follows: no neurological deficit (0), failure to extend forepaw fully (1), turning to left (2), circling to left (3), unable to walk spontaneously (4), stroke-related death (5). [0036]
  • Arterial blood gases (pH, PaO2, PaCO2) are measured before and during MCA occlusion with an ABL 30 Acid-Base Analyzer (Radiometer). [0037]
  • Reducing cerebral ischemia by gene-regulatory peptides in murine model. [0038]
  • Each of the 5 test mice received a 1:1 mixture of LQGV (SEQ ID NO: 1) and VLPALP (SEQ ID NO: 4) at 5 mg/kg in a volume of 0.5 ml 0.9% saline which was given intravenously at 10 minutes, when blood flow was at a minimum, since these conditions would give a reasonable test of the bioactivity of these peptides during ischemia, because the time course of pathophysiological changes in the present murine model is different from that of human strokes, and the occlusion is experimentally removed after 1 hour. Each of the control mice received 0.5 ml 0.9% saline i.v. [0039]
  • Administration of peptides after 2 to 3 hours in this murine model would actually be during the reperfusion phase, which may not be fully relevant to the human clinical situation where treatment would be desired within 1 hour after the stroke, because complete reopening of major occluded blood vessels in humans who experience ischemic stroke might not typically happen spontaneously 1 hour after the onset of ischemic stroke. [0040]
  • Early results control mice scored: 3, 5, 4, 2, 4; test mice scored: 3, 1, 3, 2, 1 [0041]
  • Possible mechanisms by which peptides reduce cerebral ischemia in murine model. Not wishing to be bound by theory, the thrombomodulin-protein C (TM-PC) pathway is known to function on endothelium and to counterbalance coagulation. In addition the TM-PC pathway provides protective signaling that counteracts apoptosis in response to oxygen deprivation. Activated protein C (APC) is a systemic anti-coagulant and anti-inflammatory factor which has been demonstrated to protect the brain from ischemic injury. Cytoprotection of brain endothelium by APC in vitro required endothelial protein C receptor (EPCR) and protease-activated receptor-1 (PAR-1), as did in vivo neuroprotective activity in the murine stroke model. It reduces organ damage in animal models of sepsis, ischemic injury and stroke. This invention shows that the above used gene-regulatory peptides reduce inflammatory mediators, activation of transcription factors, including NFκB, and directly interfere with the TM-PC pathway. The neuroprotection induced by these peptides is mediated by one or combinations of these effects. Peptides in this way act as a direct cell survival factor and reduce secondary ischemia by their anti-coagulant and anti-inflammatory effects. [0042]
  • The peptides as mentioned in this document such as LQG, AQG, LQGV (SEQ ID NO: 1), AQGV (SEQ ID NO: 2), LQGA (SEQ ID NO: 3), VLPALP (SEQ ID NO: 4), ALPALP (SEQ ID NO: 5), VAPALP (SEQ ID NO: 6), ALPALPQ (SEQ ID NO: 7), VLPAAPQ (SEQ ID NO: 8), VLPALAQ (SEQ ID NO: 9), LAGV (SEQ ID NO: 10), VLAALP (SEQ ID NO: 11), VLPALA (SEQ ID NO: 12), VLPALPQ (SEQ ID NO: 13), VLAALPQ (SEQ ID NO: 14), VLPALPA (SEQ ID NO: 15), GVLPALP (SEQ ID NO: 16), VVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCAL (SEQ ID NO: 24), RPRCRPINATLAVEKEGCPVCITVNTTICAGYCPT (SEQ ID NO: 25), SKAPPPSLPSPSRLPGPS (SEQ ID NO: 26), LQGVLPALPQVVC (SEQ ID NO: 17), SIRLPGCPRGVNPVVS (SEQ ID NO: 27), LPGCPRGVNPVVS (SEQ ID NO: 18), LPGC (SEQ ID NO: 19), MTRV (SEQ ID NO: 20), MTR, and VVC were prepared by solid-phase synthesis using the fluorenylmethoxycarbonyl (Fmoc)/tert-butyl-based methodology with 2-chlorotrityl chloride resin as the solid support. The side-chain of glutamine was protected with a trityl function. The peptides were synthesized manually. Each coupling consisted of the following steps: (i) removal of the α-amino Fmoc-protection by piperidine in dimethylformamide (DMF), (ii) coupling of the Fmoc amino acid (3 eq) with diisopropylcarbodiimide (DIC)/1-hydroxybenzotriazole (HOBt) in DMF/N-methylformamide (NMP) and (iii) capping of the remaining amino functions with acetic anhydride/diisopropylethylamine (DIEA) in DMF/NMP. Upon completion of the synthesis, the peptide resin was treated with a mixture of trifluoroacetic acid (TFA)/H[0043] 2O/triisopropylsilane (TIS) 95:2.5:2.5. After 30 minutes TIS was added until decolorization. The solution was evaporated in vacuo and the peptide precipitated with diethyl ether. The crude peptides were dissolved in water (50-100 mg/ml) and purified by reverse-phase high-performance liquid chromatography (RP-HPLC). HPLC conditions were: column: Vydac TP21810C18 (10×250 mm); elution system: gradient system of 0.1% TFA in water v/v (A) and 0.1% TFA in acetonitrile (ACN) v/v (B); flow rate 6 ml/min; absorbance was detected from 190-370 nm. There were different gradient systems used. For example, for peptides LQG and LQGV (SEQ ID NO: 1): 10 minutes 100% A followed by linear gradient 0-10% B in 50 minutes. For example for peptides VLPALP (SEQ ID NO: 4) and VLPALPQ (SEQ ID NO: 13): 5 minutes 5% B followed by linear gradient 1% B/minute. The collected fractions were concentrated to about 5 ml by rotation film evaporation under reduced pressure at 40° C. The remaining TFA was exchanged against acetate by eluting two times over a column with anion exchange resin (Merck II) in acetate form. The elute was concentrated and lyophilized in 28 hours. Peptides later were prepared for use by dissolving them in PBS.
  • RAW 264.7 macrophages, obtained from American Type Culture Collection (Manassas, Va.), were cultured at 37° C. in 5% CO2 using DMEM containing 10% FBS and antibiotics (100 U/ml of penicillin, and 100 μg/ml streptomycin). Cells (1×10[0044] 6/ml) were incubated with peptide (10 μg/ml) in a volume of 2 ml. After 8 h of cultures cells were washed and prepared for nuclear extracts.
  • Nuclear extracts and EMSA were prepared according to Schreiber et al. Methods (Schrieber et al. 1989, Nucleic Acids Research 17). Briefly, nuclear extracts from peptide stimulated or nonstimulated macrophages were prepared by cell lysis followed by nuclear lysis. Cells were then suspended in 400 μl of buffer (10 mM HEPES (pH 7.9),10 mM KCl, 0.1 mM KCL, 0.1 mM EDTA, 0.1 mM EGTA, 1 mM DTT, 0.5 mM PMSF and protease inhibitors), vigorously vortexed for 15 s, left standing at 4° C. for 15 min, and centrifuged at 15,000 rpm for 2 minutes. The pelleted nuclei were resuspended in buffer (20 mM HEPES (pH 7.9), 10% glycerol, 400 mM NaCl, 1 mM EDTA, 1mM EGTA, 1 mM DTT, 0.5 mM PMSF and protease inhibitors) for 30 min on ice, then the lysates were centrifuged at 15,000 rpm for 2 minutes. The supernatants containing the solubilized nuclear proteins were stored at −70° C. until used for the Electrophoretic Mobility Shift Assays (EMSA). [0045]
  • Electrophoretic mobility shift assays were performed by incubating nuclear extracts prepared from control (RAW 264.7) and peptide treated RAW 264.7 cells with a 32P-labeled double-stranded probe (5′ AGCTCAGAGGGGGACTTTCCGAGAG 3′ (SEQ ID NO: 28)) synthesized to represent the NFκB binding sequence. Shortly, the probe was end-labeled with T4 polynucleotide kinase according to manufacturer's instructions (Promega, Madison, Wis.). The annealed probe was incubated with nuclear extract as follows: in EMSA, binding reaction mixtures (20 μl) contained 0.25 μg of poly(dI-dC) (Amersham Pharmacia Biotech) and 20,000 rpm of 32P-labeled DNA probe in binding buffer consisting of 5 mM EDTA, 20% Ficoll, 5 mM DTT, 300 mM KCl and 50 mM HEPES. The binding reaction was started by the addition of cell extracts (10 μg) and was continued for 30 min at room temperature. The DNA-protein complex was resolved from free oligonucleotide by electrophoresis in a 6% polyacrylamide gel. The gels were dried and exposed to x-ray films. [0046]
  • The transcription factor NFκB participates in the transcriptional regulation of a variety of genes. Nuclear protein extracts were prepared from LPS and peptide treated RAW264.7 cells or from LPS treated RAW264.7 cells. In order to determine whether the peptide modulates the translocation of NFκB into the nucleus, on these extracts EMSA was performed. The amount of NFκB present in the nuclear extracts of RAW264.7 cells treated with LPS or LPS was in combination with peptide for 4 hours. Here we determined that indeed some peptides are able to modulate the translocation of NFκB since the amount of labeled oligonucleotide for NFκB is reduced. In this experiment, peptides that show the modulation of translocation of NF-κB are: VLPALPQVVC (SEQ ID NO: 21), LQGVLPALPQ (SEQ ID NO: 22), LQG, LQGV (SEQ ID NO: 1), GVLPALPQ (SEQ ID NO: 23), VLPALP (SEQ ID NO: 4), VLPALPQ (SEQ ID NO: 13), GVLPALP (SEQ ID NO: 16), VVC, MTRV (SEQ ID NO: 20), MTR. [0047]
  • RAW 264.7 mouse macrophages were cultured in DMEM, containing 10% or 2% FBS, penicillin, streptomycin and glutamine, at 37° C., 5% CO[0048] 2. Cells were seeded in a 12-wells plate (3×106 cells/ml) in a total volume of 1 ml for 2hours and then stimulated with LPS (E. coli 026:B6; Difco Laboratories, Detroit, Mich., USA) and/or NMPF (1 microgram/ml). After 30 minutes of incubation plates were centrifuged and cells were collected for nuclear extracts. Nuclear extracts and EMSA were prepared according to Schreiber et al. Cells were collected in a tube and centrifuged for 5 minutes at 2000 rpm (rounds per minute) at 4° C. (Universal 30 RF, Hettich Zentrifuges). The pellet was washed with ice-cold Tris buffered saline (TBS pH 7.4) and resuspended in 400 μl of a hypotonic buffer A (10 mM HEPES pH 7.9, 10 mM KCI, 0.1 mM EDTA, 0.1 mM EGTA, 1 mM DTT, 0.5 mM PMSF and protease inhibitor cocktail (Complete™ Mini, Roche) and left on ice for 15 minutes. Twenty five micro liter 10% NP-40 was added and the sample was centrifuged (2 minutes, 4000 rpm, 4° C.). The supernatant (cytoplasmic fraction) was collected and stored at −70° C. The pellet, which contains the nuclei, was washed with 50 μl buffer A and resuspended in 50 μl buffer C (20 mM HEPES pH 7.9, 400 mM NaCl, 1 mM EDTA, 1 mM EGTA, 1 mM DTT, 0.5 mM PMSF and protease inhibitor cocktail and 10% glycerol). The samples were left to shake at 4° C. for at least 60 minutes. Finally the samples were centrifuged and the supernatant (nucleic fraction) was stored at −70° C.
  • Bradford reagent (Sigma) was used to determine the final protein concentration in the extracts. For Electrophoretic mobility shift assays an oligonucleotide representing NF-κB binding sequence (5′-AGC TCA GAG GGG GAC TTT CCG AGA G-3′ (SEQ ID NO: 28)) was synthesized. Hundred pico mol sense and antisense oligo were annealed and labeled with γ-[0049] 32P-dATP using T4 polynucleotide kinase according to manufacture's instructions (Promega, Madison, Wis.). Nuclear extract (5-7.5 μg) was incubated for 30 minutes with 75000 cpm probe in binding reaction mixture (20 microliter) containing 0.5 μg poly dI-dC (Amersham Pharmacia Biotech) and binding buffer BSB (25 mM MgCl2, 5 mM CaCl2, 5mM DTT and 20% Ficoll) at room temperature. The DNA-protein complex was resolved from free oligonucleotide by electrophoresis in a 4-6% polyacrylamide gel (150 V, 2-4 hours). The gel was then dried and exposed to x-ray film. The transcription factor NF-κB participates in the transcriptional regulation of a variety of genes. Nuclear protein extracts were prepared from either LPS (1 mg/ml), peptide (1 mg/ml) or LPS in combination with peptide treated and untreated RAW264.7 cells. In order to determine whether the peptides modulate the translocation of NF-κB into the nucleus, on these extracts EMSA was performed. Peptides are able to modulate the basal as well as LPS induced levels of NF-κB. In this experiment peptides that show the inhibition of LPS induced translocation of NF-κB are: VLPALPQVVC (SEQ ID NO: 21), LQGVLPALPQ (SEQ ID NO: 22), LQG, LQGV (SEQ ID NO: 1), GVLPALPQ (SEQ ID NO: 23), VLPALP (SEQ ID NO: 4), VVC, MTR and circular LQGVLPALPQVVC (SEQ ID NO: 17). Peptides that in this experiment promote LPS induced translocation of NF-κB are: VLPALPQ (SEQ ID NO: 13), GVLPALP (SEQ ID NO: 16) and MTRV (SEQ ID NO: 20). Basal levels of NF-κB in the nucleus was decreased by VLPALPQVVC (SEQ ID NO: 21), LQGVLPALPQ (SEQ ID NO: 22), LQG and LQGV (SEQ ID NO: 1) while basal levels of NF-κB in the nucleus was increased by GVLPALPQ (SEQ ID NO: 23), VLPALPQ, (SEQ ID NO: 13) GVLPALP (SEQ ID NO: 16), VVC, MTRV (SEQ ID NO: 20), MTR and LQGVLPALPQVVC (SEQ ID NO: 17). In other experiments, QVVC (SEQ ID NO: 29) also showed the modulation of translocation of NF-κB into nucleus (data not shown).
  • Further modes of identification of gene-regulatory peptides by NFκB analysis [0050]
  • Cells: Cells will be cultured in appropriate culture medium at 37° C., 5% CO[0051] 2. Cells will be seeded in a 12-wells plate (usually 1×106 cells/ml) in a total volume of 1 ml for 2hours and then stimulated with regulatory peptide in the presence or absence of additional stimuli such as LPS. After 30 minutes of incubation plates will be centrifuged and cells are collected for cytosolic or nuclear extracts.
  • Nuclear Extracts: Nuclear extracts and EMSA could be prepared according to Schreiber et al. Method (Schreiber et al. 1989, Nucleic Acids Research 17). Cells are collected in a tube and centrifuged for 5 minutes at 2000 rpm (rounds per minute) at 4° C. (Universal 30 RF, Hettich Zentrifuges). The pellet is washed with ice-cold Tris buffered saline (TBS pH 7.4) and resuspended in 400 μl of a hypotonic buffer A (10 mM HEPES pH 7.9, 10 mM KCl, 0.1 mM EDTA, 0.1 mM EGTA, 1 mM DTT, 0.5 mM PMSF and protease inhibitor cocktail (Complete™ Mini, Roche) and left on ice for 15 minutes. Twenty five micro liter 10% NP-40 is added and the sample is centrifuged (2 minutes, 4000 rpm, 4° C.). The supernatant (cytoplasmic fraction) was collected and stored at −70° C. for analysis. The pellet, which contains the nuclei, is washed with 50 μl buffer A and resuspended in 50 μl buffer C (20 mM HEPES pH 7.9, 400 mM NaCl, 1 mM EDTA, 1 mM EGTA, 1 mM DTT, 0.5 mM PMSF and protease inhibitor cocktail and 10% glycerol). The samples are left to shake at 4° C. for at least 60 minutes. Finally the samples are centrifuged and the supernatant (nucleic fraction) is stored at −70° C. for analysis. [0052]
  • Bradford reagent (Sigma) could be used to determine the final protein concentration in the extracts. [0053]
  • EMSA: For Electrophoretic mobility shift assays an oligonucleotide representing NF-κB binding sequence such as (5′-AGC TCA GAG GGG GAC TTT CCG AGA G-3′ (SEQ ID NO: 28)) are synthesized. Hundred pico mol sense and antisense oligo are annealed and labeled with γ-[0054] 32P-dATP using T4 polynucleotide kinase according to manufacture's instructions (Promega, Madison, Wis.). Cytosolic extract or nuclear extract (5-7.5 μg) from cells treated with regulatory peptide or from untreated cells is incubated for 30 minutes with 75000 cpm probe in binding reaction mixture (20 μl) containing 0.5 μg poly dI-dC (Amersham Pharmacia Biotech) and binding buffer BSB (25 mM MgCl2, 5 mM CaCl2, 5 mM DTT and 20% Ficoll) at room temperature. Or cytosolic and nuclear extract from untreated cells or from cells treated with stimuli could also be incubated with probe in binding reaction mixture and binding buffer. The DNA-protein complex is resolved from free oligonucleotide by electrophoresis in a 4-6% polyacrylamide gel (150 V, 2-4 hours). The gel is then dried and exposed to x-ray film. Peptides can be biotinylated and incubated with cells. Cells are then washed with phosphate-buffered saline, harvested in the absence or presence of certain stimulus (LPS, PHA, TPA, anti-CD3, VEGF, TSST-1, VIP or know drugs etc.). After culturing cells are lysed and cells lysates (whole lysate, cytosolic fraction or nuclear fraction) containing 200 micro gram of protein are incubated with 50 miroliter Neutr-Avidin-plus beads for 1 h at 4° C. with constant shaking. Beads are washed five times with lysis buffer by centrifugation at 6000 rpm for 1 minute. Proteins are eluted by incubating the beads in 0.05 N NaOH for 1 mm at room temperature to hydrolyze the protein-peptide linkage and analyzed by SDS-polyacrylamide gel electrophoresis followed by immunoprecipitated with agarose-conjugated anti-NF-κB subunits antibody or immunoprecipitated with antibody against to be studied target. After hydrolyzing the protein-peptide linkage, the sample could be analyzed on HPLS and mass-spectrometry. Purified NF-κB subunits or cell lysate interaction with biotinylated regulatory peptide can be analyzed on biosensor technology. Peptides can be labeled with FITC and incubated with cells in the absence or presence of different stimulus. After culturing, cells can be analyzed with fluorescent microscopy, confocal microscopy; flow cytometry (cell membrane staining and/or intracellular staining) or cells lysates are made and analyzed on HPLC and mass-spectrometry. NF-κB transfected (reporter gene assay) cells and gene array technology can be used to determine the regulatory effects of peptides.
  • HPLC and mass-spectrometry analysis: Purified NF-κB subunit or cytosolic/nuclear extract is incubated in the absence or presence of (regulatory) peptide is diluted (2:1) with 8 N guanidinium chloride and 0.1% trifluoroacetic acid, injected into a reverse-phase HPLC column (Vydac C18) equilibrated with solvent A (0.1% trifluoroacetic acid), and eluted with a gradient of 0 to 100% eluant B (90% acetonitrile in solvent A). Factions containing NF-κB subunit are pooled and concentrated. Fractions are then dissolved in appropriate volume and could be analyzed on mass-spectrometry. [0055]
  • Further references: [0056]
  • PCT International Publications WO99/59617, WO01/72831, WO97/49721, WO01/10907, and WO01/11048, the contents of the entirety of all of which are incorporated by this reference. [0057]
  • 1 29 1 4 PRT Artificial Sequence Description of Artificial Sequence Synthetic peptide 1 Leu Gln Gly Val 1 2 4 PRT Artificial Sequence Description of Artificial Sequence Synthetic peptide 2 Ala Gln Gly Val 1 3 4 PRT Artificial Sequence Description of Artificial Sequence Synthetic peptide 3 Leu Gln Gly Ala 1 4 6 PRT Artificial Sequence Description of Artificial Sequence Synthetic peptide 4 Val Leu Pro Ala Leu Pro 1 5 5 6 PRT Artificial Sequence Description of Artificial Sequence Synthetic peptide 5 Ala Leu Pro Ala Leu Pro 1 5 6 6 PRT Artificial Sequence Description of Artificial Sequence Synthetic peptide 6 Val Ala Pro Ala Leu Pro 1 5 7 7 PRT Artificial Sequence Description of Artificial Sequence Synthetic peptide 7 Ala Leu Pro Ala Leu Pro Gln 1 5 8 7 PRT Artificial Sequence Description of Artificial Sequence Synthetic peptide 8 Val Leu Pro Ala Ala Pro Gln 1 5 9 7 PRT Artificial Sequence Description of Artificial Sequence Synthetic peptide 9 Val Leu Pro Ala Leu Ala Gln 1 5 10 4 PRT Artificial Sequence Description of Artificial Sequence Synthetic peptide 10 Leu Ala Gly Val 1 11 6 PRT Artificial Sequence Description of Artificial Sequence Synthetic peptide 11 Val Leu Ala Ala Leu Pro 1 5 12 6 PRT Artificial Sequence Description of Artificial Sequence Synthetic peptide 12 Val Leu Pro Ala Leu Ala 1 5 13 7 PRT Artificial Sequence Description of Artificial Sequence Synthetic peptide 13 Val Leu Pro Ala Leu Pro Gln 1 5 14 7 PRT Artificial Sequence Description of Artificial Sequence Synthetic peptide 14 Val Leu Ala Ala Leu Pro Gln 1 5 15 7 PRT Artificial Sequence Description of Artificial Sequence Synthetic peptide 15 Val Leu Pro Ala Leu Pro Ala 1 5 16 7 PRT Artificial Sequence Description of Artificial Sequence Synthetic peptide 16 Gly Val Leu Pro Ala Leu Pro 1 5 17 13 PRT Artificial Sequence Description of Artificial Sequence Synthetic peptide 17 Leu Gln Gly Val Leu Pro Ala Leu Pro Gln Val Val Cys 1 5 10 18 13 PRT Artificial Sequence Description of Artificial Sequence Synthetic peptide 18 Leu Pro Gly Cys Pro Arg Gly Val Asn Pro Val Val Ser 1 5 10 19 4 PRT Artificial Sequence Description of Artificial Sequence Synthetic peptide 19 Leu Pro Gly Cys 1 20 4 PRT Artificial Sequence Description of Artificial Sequence Synthetic peptide 20 Met Thr Arg Val 1 21 10 PRT Artificial Sequence Description of Artificial Sequence Synthetic peptide 21 Val Leu Pro Ala Leu Pro Gln Val Val Cys 1 5 10 22 10 PRT Artificial Sequence Description of Artificial Sequence Synthetic peptide 22 Leu Gln Gly Val Leu Pro Ala Leu Pro Gln 1 5 10 23 8 PRT Artificial Sequence Description of Artificial Sequence Synthetic peptide 23 Gly Val Leu Pro Ala Leu Pro Gln 1 5 24 38 PRT Artificial Sequence Description of Artificial Sequence Synthetic peptide 24 Val Val Cys Asn Tyr Arg Asp Val Arg Phe Glu Ser Ile Arg Leu Pro 1 5 10 15 Gly Cys Pro Arg Gly Val Asn Pro Val Val Ser Tyr Ala Val Ala Leu 20 25 30 Ser Cys Gln Cys Ala Leu 35 25 35 PRT Artificial Sequence Description of Artificial Sequence Synthetic peptide 25 Arg Pro Arg Cys Arg Pro Ile Asn Ala Thr Leu Ala Val Glu Lys Glu 1 5 10 15 Gly Cys Pro Val Cys Ile Thr Val Asn Thr Thr Ile Cys Ala Gly Tyr 20 25 30 Cys Pro Thr 35 26 18 PRT Artificial Sequence Description of Artificial Sequence Synthetic peptide 26 Ser Lys Ala Pro Pro Pro Ser Leu Pro Ser Pro Ser Arg Leu Pro Gly 1 5 10 15 Pro Ser 27 16 PRT Artificial Sequence Description of Artificial Sequence Synthetic peptide 27 Ser Ile Arg Leu Pro Gly Cys Pro Arg Gly Val Asn Pro Val Val Ser 1 5 10 15 28 25 DNA Artificial Sequence Description of Artificial Sequence Synthetic probe 28 agctcagagg gggactttcc gagag 25 29 4 PRT Artificial Sequence Description of Artificial Sequence Synthetic peptide 29 Gln Val Val Cys 1

Claims (20)

What is claimed is:
1. A method for modulating an ischemic event in a subject, said method comprising:
providing the subject with a gene-regulatory peptide or functional analogue thereof.
2. The method according to claim 1 wherein said gene-regulatory peptide or functional analogue thereof down-regulates translocation, activity, or translocation and activity of a gene transcription factor.
3. The method according to claim 2 wherein said gene transcription factor comprises an NF-kappaB/Rel protein.
4. The method according to claim 3 wherein translocation, activity, or translocation and activity of said NF-kappaB/Rel protein is inhibited.
5. The method according to claim 1 wherein said gene-regulatory peptide or functional analogue thereof has NFkappaB down-regulating activity in LPS stimulated RAW264.7 cells.
6. The method according to claim 2 wherein said gene-regulatory peptide or functional analogue thereof has NFkappaB down-regulating activity in LPS stimulated RAW264.7 cells.
7. The method according to claim 3 wherein said gene-regulatory peptide or functional analogue thereof has NFkappaB down-regulating activity in LPS stimulated RAW264.7 cells.
8. The method according to claim 4 wherein said gene-regulatory peptide or functional analogue thereof has NFkappaB down-regulating activity in LPS stimulated RAW264.7 cells.
9. The method according to claim 1 wherein the subject is at risk of experiencing reperfusion injury after said ischemic event.
10. The method according to claim 2 wherein the subject is at risk of experiencing reperfusion injury after said ischemic event.
11. The method according to claim 3 wherein the subject is at risk of experiencing reperfusion injury after said ischemic event.
12. The method according to claim 4 wherein the subject is at risk of experiencing reperfusion injury after said ischemic event.
13. The method according to claim 5 wherein the subject is at risk of experiencing reperfusion injury after said ischemic event.
14. The method according to claim 6 wherein the subject is at risk of experiencing reperfusion injury after said ischemic event.
15. The method according to claim 7 wherein the subject is at risk of experiencing reperfusion injury after said ischemic event.
16. The method according to claim 8 wherein the subject is at risk of experiencing reperfusion injury after said ischemic event.
17. The method according to any one of claims 1 through 16 wherein said gene-regulatory peptide or functional analogue thereof has NFkappaB down-regulating activity in LPS unstimulated RAW264.7 cells.
18. The method according to claim 1 further comprising:
also providing the subject with a therapeutic amount of a thrombolytic agent.
19. The method according to claim 8 wherein the thrombolytic agent has tissue plasminogen activity.
20. A method for treating an ischemic event in a subject, said method comprising:
inhibiting, in the subject, a gene transcription factor comprising NF-kappaB/Rel protein by providing the subject with a gene-regulatory peptide so as to down-regulate translocation, activity, or translocation and activity of the gene transcription factor, thus treating the subject's ischemic event.
US10/409,642 1998-05-20 2003-04-08 Treatment of ischemic events Abandoned US20030220258A1 (en)

Priority Applications (3)

Application Number Priority Date Filing Date Title
US10/409,642 US20030220258A1 (en) 2001-12-21 2003-04-08 Treatment of ischemic events
US11/593,329 US8216998B2 (en) 2001-12-21 2006-11-06 Treatment of ischemic events
US12/074,020 US20090042807A1 (en) 1998-05-20 2008-02-29 Oligopeptide treatment of ischemia reperfusion injury

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US10/028,075 US20030113733A1 (en) 2001-10-04 2001-12-21 Gene regulator
US10/409,642 US20030220258A1 (en) 2001-12-21 2003-04-08 Treatment of ischemic events

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
US10/028,075 Continuation-In-Part US20030113733A1 (en) 1998-05-20 2001-12-21 Gene regulator

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US10/821,256 Continuation-In-Part US20050227925A1 (en) 1998-05-20 2004-04-08 Compositions capable of reducing elevated blood urea concentration
US11/593,329 Continuation US8216998B2 (en) 2001-12-21 2006-11-06 Treatment of ischemic events

Publications (1)

Publication Number Publication Date
US20030220258A1 true US20030220258A1 (en) 2003-11-27

Family

ID=37830740

Family Applications (2)

Application Number Title Priority Date Filing Date
US10/409,642 Abandoned US20030220258A1 (en) 1998-05-20 2003-04-08 Treatment of ischemic events
US11/593,329 Expired - Fee Related US8216998B2 (en) 2001-12-21 2006-11-06 Treatment of ischemic events

Family Applications After (1)

Application Number Title Priority Date Filing Date
US11/593,329 Expired - Fee Related US8216998B2 (en) 2001-12-21 2006-11-06 Treatment of ischemic events

Country Status (1)

Country Link
US (2) US20030220258A1 (en)

Cited By (27)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20030119720A1 (en) * 2001-03-29 2003-06-26 Khan Nisar Ahmed Oligopeptide treatment of anthrax
US20030166556A1 (en) * 2000-03-29 2003-09-04 Khan Nisar Ahmed Immunoregulator
US20030215434A1 (en) * 2001-12-21 2003-11-20 Khan Nisar Ahmed Treatment of multiple sclerosis (MS)
US20030220261A1 (en) * 2001-12-21 2003-11-27 Khan Nisar Ahmed Treatment of iatrogenic disease
US20030220257A1 (en) * 2001-12-21 2003-11-27 Robbert Benner Treatment of trauma
US20030220259A1 (en) * 2001-12-21 2003-11-27 Robbert Benner Treatment of neurological disorders
US20030220260A1 (en) * 2001-12-21 2003-11-27 Khan Nisar Ahmed Peptide compositions
US20030224995A1 (en) * 2001-12-21 2003-12-04 Khan Nisar Ahmed Treatment of burns
US20040138096A1 (en) * 1998-05-20 2004-07-15 Erasmus Universiteit Rotterdam Immunoregulator
US20050037430A1 (en) * 2000-03-29 2005-02-17 Biotempt B.V. Methods and uses for protein breakdown products
US20050119184A1 (en) * 1998-05-20 2005-06-02 Khan Nisar A. Immunoregulator
US20050214943A1 (en) * 2001-10-04 2005-09-29 Khan Nisar A Gene regulatory peptides
US20050227925A1 (en) * 2004-04-08 2005-10-13 Robbert Benner Compositions capable of reducing elevated blood urea concentration
US20060111292A1 (en) * 2003-04-08 2006-05-25 Biotempt, B.V. Compositions for mucosal and oral administration comprising HCG fragments
US20070021347A1 (en) * 2005-07-05 2007-01-25 Biotempt B.V. Treatment for tumors
US20070142272A1 (en) * 2003-01-24 2007-06-21 Zlokovic Berislav V Neuroprotective activity of activated protein c independent of its anticoagulant activity
US20070197447A1 (en) * 1998-05-20 2007-08-23 Khan Nisar A Oligopeptide acetate and formulations thereof
US20070219138A1 (en) * 2000-03-29 2007-09-20 Biotempt B.V. Compositions capable of reducing elevated blood urea concentration
US20080027007A1 (en) * 2006-03-07 2008-01-31 Robbert Benner Control of radiation injury
US20080076719A1 (en) * 2001-03-29 2008-03-27 Khan Nisar A Immunoregulatory compositions
US20080076714A1 (en) * 2003-04-08 2008-03-27 Biotempt B.V. Administration of gene-regulatory peptides
US20080305100A1 (en) * 2004-07-23 2008-12-11 Zlokovic Berislav V Activated Protein C Inhibits Undesirable Effects of Plasminogen Activator in the Brain
US7501391B2 (en) 2001-12-21 2009-03-10 Biotempt B.V. Treatment of transplant survival
US7786084B2 (en) 2001-12-21 2010-08-31 Biotempt B.V. Treatment of burns
USRE43279E1 (en) 2000-03-29 2012-03-27 Biotemp B.V. Compositions capable of reducing elevated blood urea concentration
US8216998B2 (en) 2001-12-21 2012-07-10 Biotempt B.V. Treatment of ischemic events
US20150307572A1 (en) * 2007-07-12 2015-10-29 Compugen Ltd. Bioactive peptides and methods of using same

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
SG178780A1 (en) * 2007-02-12 2012-03-29 Biotempt Bv Treatment of trauma-hemorrhage with short oligopeptides

Citations (49)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4427660A (en) * 1982-03-03 1984-01-24 Research Corporation Formyl-methionyl chemotatic peptide antibiotic conjugates useful in treating infections
US4571336A (en) * 1983-08-25 1986-02-18 Endorphin, Inc. Immune stimulation
US4753965A (en) * 1987-04-09 1988-06-28 Merrell Dow Pharmaceuticals, Inc. Method of treating multiple sclerosis with chalcone derivatives
US4855285A (en) * 1985-12-04 1989-08-08 The Ohio State University Research Foundation Antigenic modification of polypeptides
US4977244A (en) * 1985-06-27 1990-12-11 The United States Of America As Represented By The Department Of Health And Human Services Uromodulin and a process of purifying it
US5002961A (en) * 1987-10-19 1991-03-26 Merrell Dow Pharmaceuticals Method for reducing injury with imidazol-2-thionecarboxamides
US5223397A (en) * 1991-06-05 1993-06-29 Sangstat Medical Corporation Soluble hla cross-match
US5380668A (en) * 1993-07-06 1995-01-10 University Of Utah Research Foundation Compounds having the antigenicity of hCG
US5677275A (en) * 1994-08-05 1997-10-14 The United States Of America As Represented By The Department Of Health And Human Services Treatment of cancer with human chorionic gonadotropin
US5801193A (en) * 1997-04-15 1998-09-01 Immune Modulation, Inc. Compositions and methods for immunosuppressing
US5851997A (en) * 1994-10-04 1998-12-22 Harris; Pamela Jo Use of human chorionic gonadotropin as an immune-potentiating antiviral agent
US5854004A (en) * 1991-11-25 1998-12-29 Boehringer Ingleheim Gmbh Process for screening substances capable of modulating a receptor-dependent cellular signal transmission path
US5942494A (en) * 1995-10-06 1999-08-24 The Trustees Of Columbia University In The City Of New York Stimulation of gene expression and synthesis of heat shock protein 72/73 (HSP 70)
US5958413A (en) * 1990-11-01 1999-09-28 Celltech Limited Use of antibodies to TNF or fragments derived thereof and xanthine derivatives for combination therapy and compositions therefor
US5966513A (en) * 1995-10-18 1999-10-12 Nec Corporation ATM network topology management method
US5981486A (en) * 1995-04-13 1999-11-09 Chugai Seiyaku Kabushiki Kaisha Peptide suppressing IκBα phosphorylation
US5994126A (en) * 1992-04-01 1999-11-30 The Rockefeller University Method for in vitro proliferation of dendritic cell precursors and their use to produce immunogens
US5997871A (en) * 1996-06-24 1999-12-07 University Of Maryland Biotechnology Insitute Treatment and prevention of cancer by administration of derivatives of human chorionic gonadotropin
US6051596A (en) * 1990-08-10 2000-04-18 Anormed, Inc. Immunosuppressive compositions
US6075150A (en) * 1998-01-26 2000-06-13 Cv Therapeutics, Inc. α-ketoamide inhibitors of 20S proteasome
US6150500A (en) * 1996-07-12 2000-11-21 Salerno; John C. Activators of endothelial nitric oxide synthase
US6235281B1 (en) * 1994-02-07 2001-05-22 Knoll Aktiengesellschaft Use of anti-TNF antibodies as drugs for the treatment of disorders with an elevated serum level of interleukin-6
US6310041B1 (en) * 1999-03-09 2001-10-30 Fornix Biosciences N.V. Synthetic complementary peptides and ophthalmologic uses thereof
US6319504B1 (en) * 1996-06-24 2001-11-20 University Of Maryland Biotechnology Institute Treatment and prevention of HIV infection by administration of derivatives of human chorionic gonadotropin
US6361992B1 (en) * 1996-05-08 2002-03-26 The United States Of America As Represented By The Department Of Health And Human Services Thyroid stimulating hormone superagonists
US20020041871A1 (en) * 2000-06-01 2002-04-11 Brudnak Mark A. Genomeceutical and/or enzymatic composition and method for treating autism
US20020064501A1 (en) * 1998-05-20 2002-05-30 Khan Nisar Ahmed Immunoregulator
US6489296B1 (en) * 1997-10-20 2002-12-03 Eli Lilly And Company Method of reducing mortality in severe sepsis
US20030113733A1 (en) * 2001-10-04 2003-06-19 Khan Nisar Asmed Gene regulator
US6583109B1 (en) * 1997-06-24 2003-06-24 Robert C. Gallo Therapeutic polypeptides from β-hCG and derivatives
US20030119720A1 (en) * 2001-03-29 2003-06-26 Khan Nisar Ahmed Oligopeptide treatment of anthrax
US20030148955A1 (en) * 1999-04-19 2003-08-07 Pluenneke John D. Soluble tumor necrosis factor receptor treatment of medical disorders
US20030166556A1 (en) * 2000-03-29 2003-09-04 Khan Nisar Ahmed Immunoregulator
US20030186244A1 (en) * 2002-03-26 2003-10-02 Perlegen Sciences, Inc. Pharmaceutical and diagnostic business systems and methods
US6630138B2 (en) * 2000-02-11 2003-10-07 Eli Lilly And Company Protein C derivatives
US20030215434A1 (en) * 2001-12-21 2003-11-20 Khan Nisar Ahmed Treatment of multiple sclerosis (MS)
US20030220261A1 (en) * 2001-12-21 2003-11-27 Khan Nisar Ahmed Treatment of iatrogenic disease
US20030220260A1 (en) * 2001-12-21 2003-11-27 Khan Nisar Ahmed Peptide compositions
US20030219425A1 (en) * 2001-12-21 2003-11-27 Khan Nisar Ahmed Treatment of transplant survival
US20030220257A1 (en) * 2001-12-21 2003-11-27 Robbert Benner Treatment of trauma
US20030220259A1 (en) * 2001-12-21 2003-11-27 Robbert Benner Treatment of neurological disorders
US20030224995A1 (en) * 2001-12-21 2003-12-04 Khan Nisar Ahmed Treatment of burns
US20040013661A1 (en) * 2001-12-21 2004-01-22 Gert Wensvoort Stratification
US6727227B1 (en) * 1999-05-11 2004-04-27 Obschestvo S Ogranichennoi Otvetstven-Nostiju “Klinika Instituta {overscore (B)}ioregulyatsii Gerontologii” Tetrapetide revealing geroprotective effect, pharmacological substance on its basis, and the method of its application
US20040208885A1 (en) * 2001-03-29 2004-10-21 Khan Nisar Ahmed Immunoregulatoratory compositions
US6831057B2 (en) * 1997-10-28 2004-12-14 The University Of North Carolina At Chapel Hill Use of NF-κB inhibition in combination therapy for cancer
US20050037430A1 (en) * 2000-03-29 2005-02-17 Biotempt B.V. Methods and uses for protein breakdown products
US20050227925A1 (en) * 2004-04-08 2005-10-13 Robbert Benner Compositions capable of reducing elevated blood urea concentration
US20060111292A1 (en) * 2003-04-08 2006-05-25 Biotempt, B.V. Compositions for mucosal and oral administration comprising HCG fragments

Family Cites Families (95)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3855397A (en) 1973-04-12 1974-12-17 Allied Chem Method of producing sodium carbonate and bicarbonate spherules from brine
US3898328A (en) 1973-12-03 1975-08-05 Syntex Inc Dry stable composition for the treatment of scours and dehydration
DE2360794C2 (en) 1973-12-06 1984-12-06 Hoechst Ag, 6230 Frankfurt Process for the production of peptides
IL44774A (en) 1974-05-06 1977-07-31 Baron E Pharmaceutical composition containing acetyl salicyclic acid
GB1518364A (en) 1976-05-05 1978-07-19 Beecham Group Ltd Pharmaceutical composition
GB1524740A (en) 1976-11-09 1978-09-13 Reckitt & Colmann Prod Ltd Pharmaceutical compositions for use in the suppression of gastric reflux
US4108846A (en) 1977-02-01 1978-08-22 Hoffmann-La Roche Inc. Solid phase synthesis with base N alpha-protecting group cleavage
US4289750A (en) 1978-10-16 1981-09-15 Kopp Klaus F Therapy of conditions which may be associated with altered renal function and dosage forms therefor
US4265874A (en) 1980-04-25 1981-05-05 Alza Corporation Method of delivering drug with aid of effervescent activity generated in environment of use
JPS5822474B2 (en) 1980-06-10 1983-05-09 天野製薬株式会社 Method for producing cholecystokinin pancreozymin C-terminal peptide amide sulfate ester
US4351762A (en) 1981-03-10 1982-09-28 Bioresearch, Inc. Rapid, quantitative peptide synthesis using mixed anhydrides
JPH0680015B2 (en) 1986-05-12 1994-10-12 ザ ウエルカム ファウンデーション リミテッド Pharmaceutical composition
US4966848A (en) 1988-02-08 1990-10-30 The General Hospital Corporation Isolation, purification, characterization, cloning and sequencing of N α-acetyltransferase
US5010175A (en) 1988-05-02 1991-04-23 The Regents Of The University Of California General method for producing and selecting peptides with specific properties
ATE136551T1 (en) 1988-05-10 1996-04-15 Alpha 1 Biomedicals Inc SOLID PHASE PROCESS FOR OBTAINING THYMOSINE-ALPHA-1
US5055447A (en) 1988-07-28 1991-10-08 Genentech, Inc. Method and compositions for the treatment and prevention of septic shock
US5175254A (en) 1988-09-24 1992-12-29 Societe D'expansion Scientifque Expansia Solid phase peptide synthesis using a polyacrylic support in aqueous solution
US5308834A (en) 1989-02-14 1994-05-03 Incyte Pharmaceuticals, Inc. Treatment of endotoxin-associated shock and prevention thereof using a BPI protein
US6309822B1 (en) 1989-06-07 2001-10-30 Affymetrix, Inc. Method for comparing copy number of nucleic acid sequences
US5102393A (en) 1989-07-17 1992-04-07 Survival Technology, Inc. Autoinjector converted from intramuscular to subcutaneous mode of injection
US5223421A (en) 1989-10-25 1993-06-29 The General Hospital Corporation Identification of methionine Nα-acetyltransferase
US5070187A (en) 1989-11-03 1991-12-03 Trustees Of Boston University Pharmacologically effective antagonists of arginine-vasopressin
CA2050425A1 (en) 1990-09-03 1992-03-04 Yoshiaki Uda Pharmaceutical composition and its mucous use
US5200507A (en) 1991-04-12 1993-04-06 Mallinckrodt Specialty Chemicals Company Method of separating a peptide from a resin
JPH06508029A (en) 1991-05-17 1994-09-14 カイロン コーポレイション Inhibitor of NF-↓kB transcriptional activator and its use
ES2103854T3 (en) 1992-05-30 1997-10-01 Sikiric Predrag PEPTIDES WITH ORGAN PROTECTIVE ACTIVITY, PROCEDURE FOR THE PREPARATION OF THE SAME AND ITS USE IN THERAPY.
US5436270A (en) 1993-04-07 1995-07-25 National Science Council Method for protecting against endotoxin-induced shock
JP4850985B2 (en) 1993-07-29 2012-01-11 アメリカ合衆国 Method for treating atherosclerosis or restenosis using microtubule stabilizer
US5837478A (en) 1993-12-23 1998-11-17 Icos Corporation Method of identifying modulators of binding between and VCAM-1
US5807746A (en) * 1994-06-13 1998-09-15 Vanderbilt University Method for importing biologically active molecules into cells
GB2293100A (en) 1994-09-15 1996-03-20 Medeva Europ Ltd Pharmaceutical compositions with deuterium oxide
US5700781A (en) 1994-10-04 1997-12-23 Harris; Pamela Jo Method for treating Kaposi's sarcoma and HIV infections
SE520730C2 (en) 1995-01-20 2003-08-19 Eskil Elmer Treatment of brain ischemia and brain damage with a neuroprotective drug
US5688489A (en) 1995-09-15 1997-11-18 Resolution Pharmaceuticals, Inc. Non-receptor mediated imaging agents
US5912014A (en) 1996-03-15 1999-06-15 Unigene Laboratories, Inc. Oral salmon calcitonin pharmaceutical products
US6207145B1 (en) 1997-05-09 2001-03-27 Pharma Pacific Pty Ltd. Therapeutic applications of high dose interferon
US5968513A (en) 1996-06-24 1999-10-19 University Of Maryland Biotechnology Institute Method of promoting hematopoiesis using derivatives of human chorionic gonadotropin
CA2180786C (en) 1996-07-02 2008-05-27 David Lightfoot Plants containing the gdha gene and methods of use thereof
GB9617021D0 (en) 1996-08-13 1996-09-25 Salpep Biotechnology Inc Novel peptides for treatment of inflammation and shock
GB9624927D0 (en) 1996-11-29 1997-01-15 Oxford Glycosciences Uk Ltd Gels and their use
US5966712A (en) 1996-12-12 1999-10-12 Incyte Pharmaceuticals, Inc. Database and system for storing, comparing and displaying genomic information
EP1005354A4 (en) 1997-02-07 2002-05-15 Univ Jefferson Peptide mimetics of the cytokine receptor gamma chain
EP0979096B1 (en) * 1997-02-15 2003-05-14 Millennium Pharmaceuticals, Inc. Treatment of infarcts through inhibition of nf-kappab
US6416959B1 (en) 1997-02-27 2002-07-09 Kenneth Giuliano System for cell-based screening
DE69837118T2 (en) 1997-04-07 2007-12-27 Fisher Biolmage Aps A method for screening substances for their effect on cAMP levels based on intracellular translocation of PKA
DE19735587B4 (en) 1997-08-16 2012-03-22 Eberhard-Karls-Universität Tübingen Universitätsklinikum A peptide having a radioprotective effect, a cosmetic or pharmaceutical composition containing the same, a nucleic acid encoding the same, a preparation process for this peptide and the use as a radioprotective agent
US6652860B1 (en) 1997-12-12 2003-11-25 University Of Western Ontario Peptide, apoEp 1.B, compositions and uses thereof
US6022696A (en) 1998-04-02 2000-02-08 Washington State University Research Foundation Methods of identifying agonists or antagonists of angiotensin IV
US20030220258A1 (en) 2001-12-21 2003-11-27 Robbert Benner Treatment of ischemic events
US8680059B2 (en) 1998-05-20 2014-03-25 Biotempt B.V. Oligopeptide acetate and formulations thereof
US20090042807A1 (en) 1998-05-20 2009-02-12 Nisar Ahmed Khan Oligopeptide treatment of ischemia reperfusion injury
US20040202645A1 (en) 2003-04-08 2004-10-14 Khan Nisar Ahmed Administration of gene-regulatory peptides
US6921751B1 (en) 1998-05-20 2005-07-26 Erasmus Universiteit Rotterdam Immunoregulator
US20030003545A1 (en) 1998-05-29 2003-01-02 Reinhard Ebner Interleukins-21 and 22
RU2139085C1 (en) 1998-06-23 1999-10-10 Санкт-Петербургская общественная организация "Институт биорегуляции и геронтологии" Agent stimulating reparative processes and method of its use
IL143219A0 (en) 1998-11-20 2002-04-21 Mount Sinai Hospital Corp Peptides that modulate the interaction of b class ephrins and pdz domains
US6507788B1 (en) 1999-02-25 2003-01-14 Société de Conseils de Recherches et D'Applications Scientifiques (S.C.R.A.S.) Rational selection of putative peptides from identified nucleotide, or peptide sequences, of unknown function
US6379970B1 (en) 1999-04-30 2002-04-30 The Arizona Board Of Regents On Behalf Of The University Of Arizona Analysis of differential protein expression
US7994278B1 (en) 1999-08-06 2011-08-09 Nobel Biosciences Llc Biologically active polypeptides derived from a novel early stage pregnancy factor designated maternin (MA)
CA2378480A1 (en) 1999-08-09 2001-02-15 Tripep Ab Pharmaceutical compositions containing tripeptides
GB0005702D0 (en) 2000-03-09 2000-05-03 Alpharma As Method
US6864355B1 (en) 2000-05-02 2005-03-08 Yale University Inhibition of NF-κB activation by blockade of IKKβ-NEMO interactions at the NEMO binding domain
BR0014742A (en) 1999-10-15 2002-08-27 Histatek Llc Method for inhibiting a pro-inflammatory response from a mononuclear cell and polymorphonuclear cell from human peripheral blood, or a fixed tissue cell, when contacted with a pro-inflammatory agent, receptor complex, and, method for the identification of a g kinase protein signal pathway modifying agent
RU2155063C1 (en) 1999-10-20 2000-08-27 Санкт-Петербургская общественная организация "Институт биорегуляции и геронтологии" Tetrapeptide stimulating functional activity of neurons, pharmacological agent based on thereof and method of its use
DE19953339A1 (en) 1999-11-05 2001-05-17 Goldham Pharma Gmbh Secret fragments
WO2001036454A1 (en) 1999-11-18 2001-05-25 Ceremedix, Inc. Compositions and methods for counteracting effects of reactive oxygen species and free radicals
DE60110396T2 (en) 2000-01-14 2006-01-19 Larson, Richard S., Albuquerque PEPTIDIC INHIBITORS OF LFA-1 / ICAM-1 INTERACTION
AU2001245537A1 (en) 2000-03-10 2001-09-24 Monsanto Company Anti-hypertensive peptides
US7576174B2 (en) 2000-03-29 2009-08-18 Biotempt B.V. Compositions capable of reducing elevated blood urea concentration
US6586403B1 (en) 2000-07-20 2003-07-01 Salpep Biotechnology, Inc. Treating allergic reactions and inflammatory responses with tri-and dipeptides
US6539102B1 (en) 2000-09-01 2003-03-25 Large Scale Proteomics Reference database
EP1217540A1 (en) 2000-11-29 2002-06-26 Lafayette Software Inc. Methods of organizing data and processing queries in a database system, and database system and software product for implementing such method
US20020155106A1 (en) 2000-12-01 2002-10-24 Hammond David J. Method of identifying a ligand for a target molecule
US7316819B2 (en) 2001-03-08 2008-01-08 Unigene Laboratories, Inc. Oral peptide pharmaceutical dosage form and method of production
US6894028B2 (en) 2001-04-06 2005-05-17 Zengen, Inc. Use of KPV tripeptide for dermatological disorders
CA2447292A1 (en) 2001-05-17 2002-11-21 Ceremedix, Inc. Peptide compounds for counteracting reactive oxygen species and free radicals
WO2002095030A2 (en) 2001-05-24 2002-11-28 Trillium Therapeutics Inc. Modulation of cd200 receptors
US20040072246A1 (en) 2001-09-11 2004-04-15 Roland Martin System and method for identifying t cell and other epitopes and the like
US20080242618A1 (en) 2001-12-21 2008-10-02 Khan Nisar A Stratification
US20080242837A1 (en) 2001-12-21 2008-10-02 Khan Nisar A Peptide compositions
US7786084B2 (en) 2001-12-21 2010-08-31 Biotempt B.V. Treatment of burns
US20080194489A1 (en) 2001-12-21 2008-08-14 Khan Nisar A Treatment of iatrogenic disease
WO2004016653A2 (en) 2002-08-15 2004-02-26 Leukotech A/S Bactericidal, anti-apoptotic, pro-inflammatory and anti-inflammatory peptides of heparin-binding protein (hbp) or human neutrophil elastase
EP1466612A1 (en) 2003-04-08 2004-10-13 Biotempt B.V. Treatment of inflammation and sepsis with hCG derived peptides
CA2534461A1 (en) 2003-08-05 2005-02-10 Green Peptide Co., Ltd An agent for preventing and/or treating hematologic malignancies
IL157772A (en) 2003-09-04 2016-06-30 Bmr Solutions Ltd Compositions comprising an oligopeptide derived from tortoise spleen for use in stimulating mammalian hemopoiesis
WO2005045044A2 (en) 2003-11-07 2005-05-19 Novartis Ag Use of fibroblast growth factor fragments
US7638485B2 (en) 2003-12-02 2009-12-29 Cleveland Biolabs, Inc. Modulating apoptosis
US20090227505A1 (en) 2004-01-07 2009-09-10 Biotempt B.V. Methods and uses for protein breakdown products
GB0415832D0 (en) * 2004-07-15 2004-08-18 Unilever Plc Fabric softening composition
EP1838340B1 (en) 2004-12-22 2018-04-04 Cleveland Clinic Foundation Flagellin related polypeptides and uses thereof
WO2007004869A2 (en) 2005-07-05 2007-01-11 Biotempt B.V. Treatment of tumors
EP1864692A1 (en) 2006-06-07 2007-12-12 Biotempt B.V. Use of peptides for the control of radiation injury
SG178780A1 (en) 2007-02-12 2012-03-29 Biotempt Bv Treatment of trauma-hemorrhage with short oligopeptides
EP2109054A1 (en) 2008-04-09 2009-10-14 Biotempt B.V. Methods for identifying biologically active peptides and predicting their function

Patent Citations (56)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4427660A (en) * 1982-03-03 1984-01-24 Research Corporation Formyl-methionyl chemotatic peptide antibiotic conjugates useful in treating infections
US4571336A (en) * 1983-08-25 1986-02-18 Endorphin, Inc. Immune stimulation
US4977244A (en) * 1985-06-27 1990-12-11 The United States Of America As Represented By The Department Of Health And Human Services Uromodulin and a process of purifying it
US4855285A (en) * 1985-12-04 1989-08-08 The Ohio State University Research Foundation Antigenic modification of polypeptides
US4753965A (en) * 1987-04-09 1988-06-28 Merrell Dow Pharmaceuticals, Inc. Method of treating multiple sclerosis with chalcone derivatives
US5002961A (en) * 1987-10-19 1991-03-26 Merrell Dow Pharmaceuticals Method for reducing injury with imidazol-2-thionecarboxamides
US6051596A (en) * 1990-08-10 2000-04-18 Anormed, Inc. Immunosuppressive compositions
US5958413A (en) * 1990-11-01 1999-09-28 Celltech Limited Use of antibodies to TNF or fragments derived thereof and xanthine derivatives for combination therapy and compositions therefor
US5223397A (en) * 1991-06-05 1993-06-29 Sangstat Medical Corporation Soluble hla cross-match
US5854004A (en) * 1991-11-25 1998-12-29 Boehringer Ingleheim Gmbh Process for screening substances capable of modulating a receptor-dependent cellular signal transmission path
US5994126A (en) * 1992-04-01 1999-11-30 The Rockefeller University Method for in vitro proliferation of dendritic cell precursors and their use to produce immunogens
US5380668A (en) * 1993-07-06 1995-01-10 University Of Utah Research Foundation Compounds having the antigenicity of hCG
US6235281B1 (en) * 1994-02-07 2001-05-22 Knoll Aktiengesellschaft Use of anti-TNF antibodies as drugs for the treatment of disorders with an elevated serum level of interleukin-6
US5877148A (en) * 1994-08-05 1999-03-02 The United States Of America As Represented By The Department Of Health And Human Services Treatment of cancer with human chorionic gonadotropin
US5677275A (en) * 1994-08-05 1997-10-14 The United States Of America As Represented By The Department Of Health And Human Services Treatment of cancer with human chorionic gonadotropin
US5851997A (en) * 1994-10-04 1998-12-22 Harris; Pamela Jo Use of human chorionic gonadotropin as an immune-potentiating antiviral agent
US5981486A (en) * 1995-04-13 1999-11-09 Chugai Seiyaku Kabushiki Kaisha Peptide suppressing IκBα phosphorylation
US5942494A (en) * 1995-10-06 1999-08-24 The Trustees Of Columbia University In The City Of New York Stimulation of gene expression and synthesis of heat shock protein 72/73 (HSP 70)
US5966513A (en) * 1995-10-18 1999-10-12 Nec Corporation ATM network topology management method
US6361992B1 (en) * 1996-05-08 2002-03-26 The United States Of America As Represented By The Department Of Health And Human Services Thyroid stimulating hormone superagonists
US6319504B1 (en) * 1996-06-24 2001-11-20 University Of Maryland Biotechnology Institute Treatment and prevention of HIV infection by administration of derivatives of human chorionic gonadotropin
US5997871A (en) * 1996-06-24 1999-12-07 University Of Maryland Biotechnology Insitute Treatment and prevention of cancer by administration of derivatives of human chorionic gonadotropin
US20030049273A1 (en) * 1996-06-24 2003-03-13 Gallo Robert C. Treatment and prevention of HIV infection by administration of derivatives of human chorionic gonadotropin
US6150500A (en) * 1996-07-12 2000-11-21 Salerno; John C. Activators of endothelial nitric oxide synthase
US5801193A (en) * 1997-04-15 1998-09-01 Immune Modulation, Inc. Compositions and methods for immunosuppressing
US6620416B1 (en) * 1997-06-24 2003-09-16 University Of Maryland Biotechnology Institute Method for treating HIV
US6596688B1 (en) * 1997-06-24 2003-07-22 University Of Maryland Biotechnology Institute Method for promoting hematopoiesis
US6583109B1 (en) * 1997-06-24 2003-06-24 Robert C. Gallo Therapeutic polypeptides from β-hCG and derivatives
US6489296B1 (en) * 1997-10-20 2002-12-03 Eli Lilly And Company Method of reducing mortality in severe sepsis
US6831057B2 (en) * 1997-10-28 2004-12-14 The University Of North Carolina At Chapel Hill Use of NF-κB inhibition in combination therapy for cancer
US6075150A (en) * 1998-01-26 2000-06-13 Cv Therapeutics, Inc. α-ketoamide inhibitors of 20S proteasome
US6844315B2 (en) * 1998-05-20 2005-01-18 Erasmus Universiteit Rotterdam Immunoregulator
US20020064501A1 (en) * 1998-05-20 2002-05-30 Khan Nisar Ahmed Immunoregulator
US6310041B1 (en) * 1999-03-09 2001-10-30 Fornix Biosciences N.V. Synthetic complementary peptides and ophthalmologic uses thereof
US20030148955A1 (en) * 1999-04-19 2003-08-07 Pluenneke John D. Soluble tumor necrosis factor receptor treatment of medical disorders
US6727227B1 (en) * 1999-05-11 2004-04-27 Obschestvo S Ogranichennoi Otvetstven-Nostiju “Klinika Instituta {overscore (B)}ioregulyatsii Gerontologii” Tetrapetide revealing geroprotective effect, pharmacological substance on its basis, and the method of its application
US6630138B2 (en) * 2000-02-11 2003-10-07 Eli Lilly And Company Protein C derivatives
US20030166556A1 (en) * 2000-03-29 2003-09-04 Khan Nisar Ahmed Immunoregulator
US20050037430A1 (en) * 2000-03-29 2005-02-17 Biotempt B.V. Methods and uses for protein breakdown products
US20020041871A1 (en) * 2000-06-01 2002-04-11 Brudnak Mark A. Genomeceutical and/or enzymatic composition and method for treating autism
US20030119720A1 (en) * 2001-03-29 2003-06-26 Khan Nisar Ahmed Oligopeptide treatment of anthrax
US20040208885A1 (en) * 2001-03-29 2004-10-21 Khan Nisar Ahmed Immunoregulatoratory compositions
US20050214943A1 (en) * 2001-10-04 2005-09-29 Khan Nisar A Gene regulatory peptides
US20030113733A1 (en) * 2001-10-04 2003-06-19 Khan Nisar Asmed Gene regulator
US20030219425A1 (en) * 2001-12-21 2003-11-27 Khan Nisar Ahmed Treatment of transplant survival
US20030224995A1 (en) * 2001-12-21 2003-12-04 Khan Nisar Ahmed Treatment of burns
US20040013661A1 (en) * 2001-12-21 2004-01-22 Gert Wensvoort Stratification
US20030220259A1 (en) * 2001-12-21 2003-11-27 Robbert Benner Treatment of neurological disorders
US20030220257A1 (en) * 2001-12-21 2003-11-27 Robbert Benner Treatment of trauma
US20030220260A1 (en) * 2001-12-21 2003-11-27 Khan Nisar Ahmed Peptide compositions
US20030220261A1 (en) * 2001-12-21 2003-11-27 Khan Nisar Ahmed Treatment of iatrogenic disease
US20030215434A1 (en) * 2001-12-21 2003-11-20 Khan Nisar Ahmed Treatment of multiple sclerosis (MS)
US20030186244A1 (en) * 2002-03-26 2003-10-02 Perlegen Sciences, Inc. Pharmaceutical and diagnostic business systems and methods
US20060111292A1 (en) * 2003-04-08 2006-05-25 Biotempt, B.V. Compositions for mucosal and oral administration comprising HCG fragments
US20050227925A1 (en) * 2004-04-08 2005-10-13 Robbert Benner Compositions capable of reducing elevated blood urea concentration
US20060142205A1 (en) * 2004-04-08 2006-06-29 Robbert Benner Compositions capable of reducing elevated blood urea concentration

Cited By (48)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20040138096A1 (en) * 1998-05-20 2004-07-15 Erasmus Universiteit Rotterdam Immunoregulator
US7402322B2 (en) 1998-05-20 2008-07-22 Biotempt B.V. Methods of treatment for septic shock with urine extract
US7820617B2 (en) 1998-05-20 2010-10-26 Biotempt B.V. Methods of selecting immunoregulator peptides obtained from gonadotropins
US20070197447A1 (en) * 1998-05-20 2007-08-23 Khan Nisar A Oligopeptide acetate and formulations thereof
US8680059B2 (en) 1998-05-20 2014-03-25 Biotempt B.V. Oligopeptide acetate and formulations thereof
US6921751B1 (en) 1998-05-20 2005-07-26 Erasmus Universiteit Rotterdam Immunoregulator
US20050119184A1 (en) * 1998-05-20 2005-06-02 Khan Nisar A. Immunoregulator
USRE43279E1 (en) 2000-03-29 2012-03-27 Biotemp B.V. Compositions capable of reducing elevated blood urea concentration
US7365155B2 (en) 2000-03-29 2008-04-29 Biotempt B.V. Immunoregulator
US20050037430A1 (en) * 2000-03-29 2005-02-17 Biotempt B.V. Methods and uses for protein breakdown products
USRE43140E1 (en) 2000-03-29 2012-01-24 Biotempt B.V. Immunoregulator
US7576174B2 (en) 2000-03-29 2009-08-18 Biotempt B.V. Compositions capable of reducing elevated blood urea concentration
USRE43309E1 (en) 2000-03-29 2012-04-10 Biotempt B.V. Immunoregulatory compositions
US20030166556A1 (en) * 2000-03-29 2003-09-04 Khan Nisar Ahmed Immunoregulator
US20070219138A1 (en) * 2000-03-29 2007-09-20 Biotempt B.V. Compositions capable of reducing elevated blood urea concentration
US7358330B2 (en) 2001-03-29 2008-04-15 Biotempt B.V. Immunoregulatory compositions
US7175679B2 (en) 2001-03-29 2007-02-13 Biotempt B.V. Oligopeptide treatment of NF-κB mediated inflammation
US20030119720A1 (en) * 2001-03-29 2003-06-26 Khan Nisar Ahmed Oligopeptide treatment of anthrax
US20080076719A1 (en) * 2001-03-29 2008-03-27 Khan Nisar A Immunoregulatory compositions
US20050214943A1 (en) * 2001-10-04 2005-09-29 Khan Nisar A Gene regulatory peptides
US7524820B1 (en) 2001-10-04 2009-04-28 Biotempt B.V. Compounds of therapeutic value in the treatment of multiple sclerosis and other diseases wherein foamy cells are involved in the disease etiology
US8216998B2 (en) 2001-12-21 2012-07-10 Biotempt B.V. Treatment of ischemic events
US20030215434A1 (en) * 2001-12-21 2003-11-20 Khan Nisar Ahmed Treatment of multiple sclerosis (MS)
US20030220261A1 (en) * 2001-12-21 2003-11-27 Khan Nisar Ahmed Treatment of iatrogenic disease
US7560433B2 (en) 2001-12-21 2009-07-14 Biotempt B.V. Treatment of multiple sclerosis (MS)
US20030224995A1 (en) * 2001-12-21 2003-12-04 Khan Nisar Ahmed Treatment of burns
US20030220257A1 (en) * 2001-12-21 2003-11-27 Robbert Benner Treatment of trauma
US7786084B2 (en) 2001-12-21 2010-08-31 Biotempt B.V. Treatment of burns
US7501391B2 (en) 2001-12-21 2009-03-10 Biotempt B.V. Treatment of transplant survival
US20030220259A1 (en) * 2001-12-21 2003-11-27 Robbert Benner Treatment of neurological disorders
US20030220260A1 (en) * 2001-12-21 2003-11-27 Khan Nisar Ahmed Peptide compositions
US20070142272A1 (en) * 2003-01-24 2007-06-21 Zlokovic Berislav V Neuroprotective activity of activated protein c independent of its anticoagulant activity
US20080076714A1 (en) * 2003-04-08 2008-03-27 Biotempt B.V. Administration of gene-regulatory peptides
US7517529B2 (en) 2003-04-08 2009-04-14 Biotempt B.V. Treatment of type I diabetes
US20060111292A1 (en) * 2003-04-08 2006-05-25 Biotempt, B.V. Compositions for mucosal and oral administration comprising HCG fragments
US20060142205A1 (en) * 2004-04-08 2006-06-29 Robbert Benner Compositions capable of reducing elevated blood urea concentration
US20050227925A1 (en) * 2004-04-08 2005-10-13 Robbert Benner Compositions capable of reducing elevated blood urea concentration
AU2005230403B2 (en) * 2004-04-08 2009-05-21 Biotempt, B.V. Oligopeptides for reducing elevated blood urea concentration
KR101217025B1 (en) 2004-04-08 2013-01-02 바이오템프트, 비.브이. Oligopeptides for reducing elevated blood urea concentration
WO2005097163A1 (en) * 2004-04-08 2005-10-20 Biotempt, B.V. Oligopeptides for reducing elevated blood urea concentration
US20080305100A1 (en) * 2004-07-23 2008-12-11 Zlokovic Berislav V Activated Protein C Inhibits Undesirable Effects of Plasminogen Activator in the Brain
US7662776B2 (en) 2005-07-05 2010-02-16 Biotempt B.V. Treatment of tumors using short peptides from human chorionic gonadotropin (HCG)
US20070021347A1 (en) * 2005-07-05 2007-01-25 Biotempt B.V. Treatment for tumors
US20080027007A1 (en) * 2006-03-07 2008-01-31 Robbert Benner Control of radiation injury
US8288341B2 (en) 2006-03-07 2012-10-16 Biotempt B.V. Control of radiation injury
US7795226B2 (en) 2006-03-07 2010-09-14 Biotempt B.V. Control of radiation injury
US20090281033A1 (en) * 2006-03-07 2009-11-12 Biotempt B.V. Control of radiation injury
US20150307572A1 (en) * 2007-07-12 2015-10-29 Compugen Ltd. Bioactive peptides and methods of using same

Also Published As

Publication number Publication date
US8216998B2 (en) 2012-07-10
US20070054860A1 (en) 2007-03-08

Similar Documents

Publication Publication Date Title
US8216998B2 (en) Treatment of ischemic events
US20030220260A1 (en) Peptide compositions
US7560433B2 (en) Treatment of multiple sclerosis (MS)
US20080242837A1 (en) Peptide compositions
Sosne et al. Biological activities of thymosin ß4 defined by active sites in short peptide sequences
US7786084B2 (en) Treatment of burns
CN103648518B (en) Ischemic combined therapy
CN110831668B (en) Plasmin treatment of conditions associated with PAI-1 overexpression
US20030224995A1 (en) Treatment of burns
Zheng et al. Delayed recanalization at 3 days after permanent MCAO attenuates neuronal apoptosis through FGF21/FGFR1/PI3K/Caspase-3 pathway in rats
US20030220257A1 (en) Treatment of trauma
CN101888851B (en) Methods for treatment of stroke or cerebrovascular accidents using an etb receptor agonist
KR20080098001A (en) Use of c1 inhibitor for the prevention of ischemia-reperfusion injury
JP5208135B2 (en) Recombinant leukocyte inhibitory factor and hirugen chimeric protein and drug composition thereof
JPWO2011019023A1 (en) Blood brain barrier disorder improving agent
WO2002099081A2 (en) Methods of using colony stimulating factors in the treatment of tissue damage and ischemia
CN110799547B (en) Compounds for treating, ameliorating or preventing neurological-related disorders and uses thereof
Arakawa et al. Milrinone reduces cerebral vasospasm after subarachnoid hemorrhage of WFNS grade IV or V
AU2016265523B2 (en) Oligopeptide having proinflammatory cytokine secretion-inhibiting activity
JP2014519514A (en) Method for repairing tissue damage using protease resistant mutants of stromal cell-derived factor-1
US20040105843A1 (en) Method of treatment of hypoxia/ischaemia
Solomon et al. Inhibitory Effects of Central Hypertensive Activity of motensin I and II by 1-Sar-8-ala-angiotensin II (Saralasin Acetate)
US20030054988A1 (en) Modified plasminogen related peptide fragments and their use as angiogenesis inhibitors
KR20210093958A (en) Analogs targeting mitochondrial diseases
WO2012138043A2 (en) Therapeutic composition containing endothelin as an active component

Legal Events

Date Code Title Description
AS Assignment

Owner name: BIOTEMPT B.V., NETHERLANDS

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:KHAN, NISAR AHMED;BENNER, ROBBERT;JACOBS, BARTHOLOMEUS CASPAR J.;REEL/FRAME:014262/0201;SIGNING DATES FROM 20030619 TO 20030621

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION