US20050089538A1 - CDR grafted type III anti-CEA humanized mouse monoclonal antibodies - Google Patents
CDR grafted type III anti-CEA humanized mouse monoclonal antibodies Download PDFInfo
- Publication number
- US20050089538A1 US20050089538A1 US10/755,382 US75538204A US2005089538A1 US 20050089538 A1 US20050089538 A1 US 20050089538A1 US 75538204 A US75538204 A US 75538204A US 2005089538 A1 US2005089538 A1 US 2005089538A1
- Authority
- US
- United States
- Prior art keywords
- seq
- mab
- region
- chain variable
- cea
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3007—Carcino-embryonic Antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
- A61K47/6853—Carcino-embryonic antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
Definitions
- the invention relates to immunological reagents for diagnostic and therapeutic use in colon and other cancers.
- the invention relates to humanized anti-carcinoembryonic antigen (“CEA”) monoclonal antibodies (“mAbs”) that have the binding affinity characteristics of corresponding mouse anti-CEA mAb (MN14) and the antigenic and effector properties of a human antibody.
- CEA humanized anti-carcinoembryonic antigen
- mAbs monoclonal antibodies
- MN14 mouse anti-CEA mAb
- the invention relates to humanized mAbs in which the complementarity determining regions (“CDRs”) of an anti-CEA murine mAb is grafted into the framework regions of a human antibody, to DNAs that encode such CDR-grafted antibodies, to vectors and transformed hosts for propagating and expressing the DNAs, and to conjugates of the antibodies useful in diagnostic and therapeutic applications.
- CDRs complementarity determining regions
- HAMAs human anti-mouse antibodies
- circulating HAMAs decrease the effective concentration of the targeting agent in the patient and therefore limiting the diagnostic or therapeutic agent from reaching the target site.
- One strategy has been to chemically modify the targeting antibody to suppress its antigenicity. For example, conjugation of polyethylene glycol to the targeting antibody (PEGylation) is reported to reduce antigenicity of antibodies.
- Another approach has been to characterize the situs of antigenicity in an antibody and then remove it. In this vein, Fab′, F(ab) 2 and other antibody fragments have been used in place of whole IgG.
- Fab′, F(ab) 2 and other antibody fragments have been used in place of whole IgG.
- attempts have been made to reduce the adverse effects of HAMA by plasmaphoretically removing HAMA from blood. Immunosuppressive techniques also have been used to ameliorate the adverse effect of the foreign antibody sufficiently to permit multiple treatments with the targeting agent.
- MN14 murine Class III anti-CEA mAb
- Particular objects in this regard are substrate DNAs that facilitate genetic manipulation to produce improved antibodies and DNAs encoding the antibodies with advantageous properties in cell culture and antibody production.
- Yet another object of the invention is to provide vectors for propagating the DNA and for expressing the antibody.
- a related object of the invention is to provide cells containing a vector for the purposes of storage, propagation, antibody production and therapeutic applications.
- Still another object of the invention is to provide compositions comprising the antibodies for use in diagnosis and therapy.
- a humanized mouse mAb comprising the CDRs of a murine Class III, anti-CEA mAb (MN-14) engrafted to the framework regions of a heterologous (human) antibody, wherein the thus humanized mAb antibody retains the Class III, anti-CEA binding specificity of the murine mAb but in the patient is less immunogenic than is the parent MN-14 murine monoclonal antibody.
- the light chain variable regions of the humanized antibody are characterized by the formula: FR L1 -CDR L1 -FR L2 -CDR L2 -FR L3 -CDR L3 -FR L4 wherein each FR is separately a framework region of a human antibody, and each CDR is separately in a complementarity-determining region of the light chains of MN-14, and the subscripts refer to light (“L”) chain regions.
- the heavy chain variable regions are characterized by the formula: FR H1 -CDR H1 -FR H2 -CDR H2 -FR H3 -CDR H3 -FR H4 wherein FR and CDR have the same meanings as above, and wherein the subscripts “H” refer to heavy chain regions.
- CDR L1 has the amino acid sequence KASQDVGTSVA (SEQ. ID NO. 20); CDR L2 has the amino acid sequence WTSTRHT (SEQ. ID NO. 21); CDR L3 has the amino acid sequence QQYSLYRS (SEQ. ID NO. 22); CDR H1 has the amino acid sequence TYWMS (SEQ. ID. NO. 23); CDR H2 has the amino acid sequence EIHPD SSTINYAPSLKD (SEQ. ID NO. 24); and, CDR H3 has the amino acid sequence LYFGFPWFAY (SEQ. ID NO. 25).
- FR L1 has the amino acid sequence DIQLTQSPSS LSASVGDRVTITC (SEQ. ID NO. 26); FR L2 has the amino acid sequence WYQQKPGKAP KLLIY (SEQ. ID NO. 27); FR L3 has the amino acid sequence GVP(S or D)RFSGS(G or V) SGTDFTFTISSLQPEDIATYYC (SEQ. ID NO. 28); FR L4 has the amino acid sequence FGQGTKVEIK (SEQ. ID NO. 29); FR H1 has the amino acid sequence EVQLVESGGG VVQPGRSLRLSCSSSGFDFT (SEQ. ID NO.
- FR H2 has the amino acid sequence WVRQAPGKGLEWVA (SEQ. ID NO. 33), WVRQAPGKGLEWIA (SEQ. ID NO. 34), or WVRQPPGRGLEWIA (SEQ. ID NO. 35);
- FR H3 has the amino acid sequence RFTISRDNSKNTLFLQMDSLRPEDTGVYFCAS (SEQ. ID NO. 36), RFTISRDNAKNTLFLQMDSLRPEDTGVYFC AS (SEQ. ID NO.
- FR H4 has the amino acid sequence WGQGTPVTVSS (SEQ. ID NO. 39), or WGQGTTVTVSS (SEQ. ID NO. 40); and wherein C may be in the sulfhydryl or disulfide form.
- Another preferred embodiment comprises a diagnostic or therapeutic agent complexed to Class III, anti-CEA humanized mAb in which the CDRs of the antibody are derived from those of the MN-14 murine mAb and the FRs are derived from those of the heterologous (human) antibody, wherein the conjugate retains the Class III, anti-CEA binding specificity of MN-14, but is in humans less immunogenic than is murine MN-14.
- the light chain and heavy chain variable regions are characterized as shown above and have amino acid sequences also as described above.
- a method for diagnosing or treating a patient comprises the step of administering in an appropriate regimen the conjugate of the previous preferred embodiment.
- Another preferred embodiment comprises an isolated, purified DNA that encodes the light chain, the heavy chain or both chains of the humanized antibody described above.
- Another preferred embodiment comprises the DNA sequence of the CDRs and FRs described above.
- CDR is used as an abbreviation for Complementarity Determining Region. These are the regions within the variable regions of an antibody that are primarily, but not exclusively, responsible for antigen-antibody binding.
- FR is an abbreviation for Framework Region. Broadly speaking, these are the portions of the variable regions of an antibody which lie adjacent to or flank the CDRs. In general, these regions have more of a structural function that affects the conformation of the variable region and are less directly responsible for the specific binding of antigen to antibody, although, nonetheless, the framework regions can affect the interaction.
- Chimeric refers to an antibody in which the variable region is derived from a mouse antibody and the constant region is derived from an antibody from a heterologous (other) species.
- Humanized refers to a chimeric antibody as defined above, but one in which the FR variable regions are derived from a human antibody.
- HAMA refers to human antibodies directed to a mouse antibody, that are produced when a mouse antibody is administered to a human subject.
- HAHA refers to human antibodies directed to a humanized mouse antibody.
- CEA refers to carcinoembryonic antigen, a 180 kDa glycoprotein that is expressed in most adenocarcinomas of endodermally-derived digestive system epithelia and in some other cancers such as breast cancer and non-small cell lung cancer.
- FIGS. 1A and 1B shows the consensus DNA sequence of murine NEWM MN-14 variable region heavy chain (“VH”) and its protein translation product. The CDRs are enclosed in boxes.
- FIGS. 2A and 2B shows the consensus DNA sequence of murine MN-14 variable region light chain (“VK”) and its protein translation product. The CDRs are enclosed in boxes.
- FIG. 3 shows a vector for the expression of chimeric or humanized MN-14 heavy chain gene.
- the schematic diagram shows both the chimeric and a reshaped heavy chain immunoglobulin (Ig) gene and the pSVgpt expression vector.
- the diagram at top labeled “CHIMERIC,” is a map showing DNA encoding the MN-14 mouse VH region joined to DNA encoding a human IgG1 constant region.
- the three CDRs are indicated by the three dark areas.
- the FRs are indicated by the four stippled areas.
- the middle diagram labeled “RESHAPED” shows the humanization of the MN-14 VH region in which the mouse FRs have been replaced by human FRs, indicated by the four clear areas in the “Human” VH region.
- the circular map of the expression vector pSVgpt at bottom shows the HindIII/BamHI insertion site for the reshaped MN-14 antibody gene just downstream from an Igh enhancer element.
- the map also indicates some important functional domains in the vector, including the replication origins for propagation in E. coli (colEl ori) and in mammalian cells (SV40 promoter region), and genes encoding selective markers for culturing bacterial (Ap r ) and mammalian (gpt) cells transformed with the vector. Expression of the antibody gene in this case is mediated by the Ig promoter indicated by the solid circles near the HindIII site in the maps of the antibody genes.
- FIG. 4 shows a vector for the expression of chimeric or humanized MN-14 kappa chain gene.
- the diagram shows a chimeric and a reshaped MN-14 kappa light chain gene and the pSVhyg expression vector.
- the diagram at top, labelled “CHIMERIC,” is a map showing DNA encoding the MN-14 mouse kappa light chain variable region (“VK”) joined to DNA encoding a human kappa constant (“CK”) region.
- VK mouse kappa light chain variable region
- CK human kappa constant
- the middle diagram shows the humanization of the MN-14 VK region in which the mouse FRs have been replaced by human FRs, which are indicated by the four clear areas in the “Human” VK region.
- the circular map of the expression vector pSVhyg at bottom shows the HindIII/BamH1 insertion site for the reshaped MN-14 antibody gene just downstream from an Igh enhancer element.
- the map indicates some important functional domains in the vector, including the replication origins for E. coli (col E1 ori) and mammalian propagation (SV40 promoter region), and genes encoding selective markers for culturing bacterial (Ap r ) and mammalian (gpt) cells transformed with the vector. Expression of the antibody gene in this case is mediated by the Ig promoter schematized by the solid circles near the HindIII site in the maps of the antibody genes.
- FIGS. 5A and 5B shows the alignments of the murine MN-14 variable regions (SEQ. ID. NOS. 2 and 4) with the human variable regions NEWM VH (SEQ. ID NO. 5) and REI VK (SEQ. ID NO. 6) ( FIG. 5A ). and with the human KOL VH region (SEQ. ID NO. 7) ( FIG. 5B ).
- CDRs are boxed, and the murine VH FRs, which are incorporated into the humanized VH, are marked with their positions according to the numbering system of Kabat et al. SEQUENCES OF PROTEINS OF IMMUNOLOGICAL INTEREST, U.S. Government Printing Office, Washington, D.C., 1987.
- Murine residues outside the CDRs that were included in the KLHuVH are indicated by a filled circle.
- FIGS. 6A, 6B and 6 C shows a comparison of the amino acid sequence between murine (SEQ. ID NO. 2) and humanized (SEQ. ID NOS. 57, 8-11, 58 and 12-15). MN-14 VH framework residues (FR). Only human FR residues different from the mouse are shown. CDAs for NEWM and KOL are also not shown. The position of the substitution is indicated according to the Kabat et al. numbering system. The 3 CDRs are boxed.
- FIG. 7 shows the DNA sequence and corresponding amino acid sequence (SEQ. ID NOS. 16 and 17) of the MN-14HuVH (KLHuVh) region. CDRs are boxed.
- FIG. 8 shows the DNA sequence and corresponding amino acid sequence (SEQ. ID NOS. 18 and 19) of the MN-14HuVK region. CDRs are boxed.
- FIG. 9 is a graph of MN-14 blocking (i.e., competition) assays comparing relative binding affinities of KLHuVH variants, including: (- ⁇ -) KLHuVH/HuVK; (- ⁇ -) KLHuVHAIG/HuVK; (- ⁇ -) KLHuVHAIGAY/HuVK; (- ⁇ -) KLHuVHAIGA/HuVK; (- ⁇ -) chimeric control; and, (- ⁇ -) murine control.
- MN-14 blocking i.e., competition
- FIG. 10 shows MN-14 blocking assays comparing hMN-14 with HMN-14-NVT (glycosylated in FR 1 region).
- FIG. 11 is a radioautogram of the abdomen of a colon cancer patient following administration of 131 I-labelled hMN14IgG (left panel) or mMN14IgG (right panel) in the same patient.
- MN-14 The murine anti-CEA IgG1 monoclonal antibody MN-14, and its production, have been described previously. Hansen et al., Cancer, 71: 3478 (1993); Primus et al., U.S. Pat. No. 4,818,709. MN-14 meets all of the criteria of a Class III, anti-CEA monoclonal antibody, being unreactive with meconium antigen by EIA and not reacting with normal tissues.
- Blocking studies are carried out according to Hansen et al. 1993, above, Losman et al., Int. Cancer, 56: 580 (1994); Hansen et al., Clin. Chem., 35: 146 (1989).
- binding of humanized MN-14 may be assessed relative to a labeled MN-14 probe.
- a typical probe is MN-14 conjugated to horse radish peroxidase (HRP).
- HRP horse radish peroxidase
- Both labeled and unlabeled MN-14 are added to a CEA sample fixed to a solid support such as microtitre plate wells.
- the degree of “blocking” of labeled MN-14 binding to CEA is a direct reflection of unlabeled MN-14 activity.
- the relative activity of an unknown sample of humanized MN-14 or derivatives thereof can be determined.
- the reactions are performed in the wells of a microtitre plate where wells are charged directly with CEA at a level of, for example, 25 ⁇ g/well or indirectly where the wells are precharged with an antibody reactive with CEA but to an epitope different than that to which MN-14 interacts; such an antibody may be the MN-15 mAb.
- CEA can thus be indirectly fixed to the well.
- a competitive binding EIA assay can then be performed with such a charged plate.
- antibodies can be radioiodinated conventionally with, for example, 131 I by the chloramine-T method to a specific activity of about 10 mCi/ ⁇ g, and free radioisotopes removed by chromatography on acrylamide gel columns (see Hansen et al., 1993, above).
- MN-14 light and heavy chain CDRs disclosed herein, and modified MN-14 CDRs can be integrated into other antibodies using well-known recombinant techniques, such as those described in the above references.
- oligonucleotides encoding MN-14 CDRs can be synthesized. Oligonucleotides that encode modified CDRs may be made, as well as those that encode exactly the amino acid sequences herein set forth. Also, the oligonucleotides may contain nucleotides in addition to those of an MN-14 CDRs, to facilitate cloning, for instance. Oligonucleotide synthesis techniques are well known, and can be carried out on automated equipment available from a number of manufacturers. Moreover, oligonucleotides of any specified sequence can be obtained commercially.
- Oligonucleotides encoding the MN-14 CDRs and/or specific FR residues. or representing the complementary strand thereof, may be used to introduce codons for these residues into VH or VK DNA by site-directed mutagenesis provided that the ends of the oligonucleotides, generally 12 nucleotides, are designed to anneal perfectly to the template DNA.
- the template DNAs are typically single-stranded DNAs representing M13 vectors that carry a variable region DNA encoding the required FRs.
- the mutagenic oligonucleotides are phosphorylated at their 5′ ends and, together with an oligonucleotide priming 5′ to variable region DNA, are annealedd to the ssDNA template.
- the oligonucleotides are extended using T7 polymerase and the fragments linked together by T4 DNA ligase to give a complete mutant strand covering the whole variable region.
- T7 polymerase a polymerase
- T4 DNA ligase to give a complete mutant strand covering the whole variable region.
- multiple copies of its complementary strand can be synthesized from a suitable primer using Taq DNA polymerase in a thermal cycling reaction. Once the mutant strand has been preferentially amplified in this manner, the DNA can be amplified by conventional PCR for cloning, sequencing and expression.
- Suitable antibody-encoding DNAs are illustrated by the disclosure herein, but include practically any such DNA.
- a variety of human antibody genes are available in the form of publically accessible deposits. Many sequences of antibodies and antibody-encoding genes have been published and suitable antibody genes can be synthesized from these sequences much as described above.
- CDR grafting in accordance with the present disclosure may be carried out using established techniques.
- Antibody-producing cell lines may be selected and cultured using techniques well known to the skilled artisan. Such techniques are described in a variety of laboratory manuals and primary publications. For instance, techniques suitable for use in the invention as described below are described in CURRENT PROTOCOLS IN IMMUNOLOGY, Coligan et al., Eds., Green Publishing Associates and Wiley-Interscience, John Wiley and Sons, New York (1991) which is herein incorporated by reference in its entirety, including supplements.
- RNA may be isolated from the original hybridoma cells by standard techniques, such as guanidinium isothiocyanate extraction and precipitation followed by centrifugation or chromatography. Where desirable, mRNA may be isolated from total RNA by standard techniques such as chromatography on oligodT cellulose. Techniques suitable to these purposes are well known in the art as described in the foregoing references.
- cDNAs that encode the light and the heavy chains of the antibody may be made, either simultaneously or separately, using reverse transcriptase and DNA polymerase in accordance with well known methods. It may be initiated by consensus constant region primers or by more specific primers based on the published heavy and light chain DNA and amino acid sequences.
- PCR also may be used to isolate DNA clones encoding the antibody light and heavy chains.
- the libraries may be screened by consensus primers or larger homologous probes, such as mouse constant region probes.
- consensus primers or larger homologous probes such as mouse constant region probes.
- cDNAs that encode the light and the heavy chain of an antibody can be propagated in any suitable vector in any suitable host prior to isolation of the CDR. Often the clones will most conveniently be propagated for this purpose in E. coli as illustrated in the examples below. However, a variety of other vectors and host cells well knowN to those of skill profitably may be employed in this aspect of the invention. A variety of such vectors are described in the foregoing references.
- DNA typically plasmid DNA
- DNA may be isolated from the cells, restriction mapped and sequenced in accordance with standard, well known techniques set forth in detail in the foregoing references relating to recombinant DNA techniques.
- DNAs encoding antibody heavy and light chains and fragments thereof in accordance with the vector are used to construct chimeric and CDR-grafted humanized MN-14 antibodies.
- the CDRs of the MN-14 anti-CEA mAb are herein identified and described, and illustrated in FIGS. 1A and 1B and and 2 A and 2 B (SEQ. ID NOS. 2 and 4, respectively) Using these sequences, CDRs of the MN-14 heavy and light chain can be synthesized for use in the present invention. It is not necessary to redone MN-14 CDRs from a natural source.
- the DNA and amino acid sequences are set forth herein. Oligonucleotide synthesis techniques suitable to this aspect of the invention are well known to the skilled artisan and may be carried out using any of several commercially available automated synthesizers. In addition, DNAs encoding the CDRs set forth herein can be obtained through the services of commercial DNA synthesis vendors.
- Polynucleotides synthesized in accordance with this aspect of the invention may include those not derived from an MN-14 CDR as well as those that make up the CDR.
- the additional bases may be included to facilitate joining the CDR to the FRs from a heterologous source. They may comprise restriction sites or overlapping complementary regions for this purpose.
- the synthesis of longer, double-stranded DNAs from shorter, overlapping, single-stranded DNAs is well known to those of skill in the art.
- well known is the end-to-end joining of DNAs, including blunt-ended DNAs and those with at least partially overlapping complementary termini.
- the CDRs of the MN-14 heavy and light chains may also be modified particularly after incorporation into a chimeric or humanized antibody using well-known recombinant DNA techniques for deleting, inserting and altering bases in a cloned or synthetic DNA or RNA.
- Site-specific mutagenesis techniques suitable to this end are well known to those of skill in the art, and are illustrated in the foregoing references on recombinant DNA techniques.
- deletional and insertional techniques are also illustrated. These methods can be used to introduce practically any desired alteration into polynucleotides that encode the MN-14 CDRs or into other regions of a closed heavy or light chain gene.
- MN-14 CDRs and modified MN-14 CDRs can be introduced into practically any set of FRs in accordance with the present invention. It will be appreciated by those of skill in the art that a variety of well known techniques for cloning and manipulating polynucleotides may be effectively employed in this regard. Such techniques are illustrated by the methods set forth in the foregoing recombinant DNA-related references.
- human antibody in this context refers to any antibody that occurs in a human or an engineered antibody that has been designed, in some respect, to be compatible with the human immune system. Particularly preferred for this purpose are antibodies that, broadly, do not engender an adverse immune response in a patient. More particularly, the expression “human antibody” is intended to mean an antibody encoded by a gene actually occurring in a human, or an allele, variant or mutant thereof.
- DNA encoding an MN-14-derived CDR-grafted antibody may be assembled from MN-14 VH and VK region DNAs and the variable regions thus formed combined with their respective light and heavy chains of human constant domains, it may be inserted into a vector for propagation and expression by conventional techniques. In this manner desired amounts of the antibody may be obtained.
- the MN-14 CDR-grafted human antibody can be used in imaging applications by administrating to a subject the humanized antibody or Fab′ thereof conjugated with an imaging compound or isotope.
- the antibody is conjugated to a label for imaging using conventional methods.
- conventional methods include, but are not restricted to: 1) direct radioiodination of the antibody protein or fragments thereof or 2) direct attachment to the antibody or fragments thereof of metallic nuclides (see, e.g., Hansen et al., Cancer, 73: 761 (1994)).
- bifunctional chelates that can be used to bind various diagnostic or therepeutic metals to the antibody or fragment thereof is also within the scope of the present invention (see, Antibodies in Radiodiagnosis and Therapy , ed. M. R. Zalutsky, 1989, CRC Press, Boca Raton, Fla., and Cancer Therapy with Radiolabeled Antibodies , ed. D. M.
- the reaction of serum antibody with the MN-14 CDR-grafted antibody and imaging agent portions of the conjugate can be determined over the course of the diagnostic procedures, including the reaction of control sera obtained prior to administration of conjugate. Similar determinations are made in other patients treated with similar conjugates of MN-14 itself.
- the sera antibody reactive with CDR-grafted MN-14 human antibodies detected by these tests is much less than the antibody reactive with antibody portion of the conjugate in patients treated with the murine MN-14-containing conjugates.
- MN-14 and CDR-grafted MN-14 antibodies conjugated to aminodextran and to boron may be used for diagnostic purposes.
- MN-14 and CDR-grafted MN-14 antibodies can be prepared as set forth above for conjugation to an aminodextran-boron adduct.
- Amino-dextran-boron adducts can be prepared by reaction of a suitable boron cage compound (e.g., a 12-boron carborane suitably derivatized with an amino-dectran functional group).
- the amino-dextran is reacted with an excess of a haloacetyl acid ester or anhydride (such as iodoacetic anhydride), thereby producing an amino-dextran with a desired number of haloacetyl groups, usually ranging from 10-1000 groups, depending on the reaction conditions and the size of the amino-dextran.
- a suitable boron derivative such as mercaptocarborane-B12 is reacted, in a desired molar excess, with the haloacetyl-amino-dextran via an alkylation reaction.
- a number of haloacetyl groups on the boronated haloacetyl amino-dextran remain unreacted, and can be used as a “handle” to attach the adduct to protein thiol groups.
- MN-14 CDR-grafted humanized antibodies and their derivatives because of their reduced immunogenicity, are useful in therapy, for passive immunization without negative immune reactions such as serum sickness or anaphylactic shock, for localization and in vivo imaging of tumors as described above, for specific treatment of disease cells, e.g., site directed delivery of cytotoxins, immunomodulators or other pharmaceutically active molecules where local concentration of the active agent is an important factor, or the like, thereby establishing the practical utility of these humanized antibodies.
- the humanized, CDR-grafted MN-14 monoclonal antibody is radiolabeled or conjugated with a metal chelator complexed with a radionuclide, e.g., iodine, ytrium, technetium, or the like, and radio-scanning techniques may be used to detect primary and metastatic CEA tumors.
- a radionuclide e.g., iodine, ytrium, technetium, or the like
- radio-scanning techniques may be used to detect primary and metastatic CEA tumors.
- the radioactive antibody is injected, e.g., intravenously, and the patient scanned with a gamma imager at regular intervals. Tumors expressing CEA will take up more radioantibodies than other tissues and will be easily recognized by the imaging camera.
- monoclonal antibodies labelled with 131 I are used in amounts of 3 to 10 ⁇ g representing 15 to 30 ⁇ Ci per kg body weight.
- the antibodies are conjugated to any of a variety of known therapeutic agents such as doxorubicin, methotrexate, taxol, ricin A, radioactive atoms, cytoxic agents, and the like, formulating such conjugate in a pharmaceutically acceptable sterile vehicle, and administering the formulation by conventional means.
- the therapeutic dosages can be readily determined conventionally by the user of average skills in these arts.
- the therapeutic dose for mammals is between about 1 mg and 5 mg per kg body weight for the monoclonal antibodies themselves, and between 0.1 mg and 5 mg per kg body weight for conjugates with cytotoxic drugs, depending on the status of the patient and the mode of administration.
- the humanized antibodies can be used in combination with components of the host's immune system, e.g., complement or cell mediated responses, in order to remove from the subject CEA-presenting cancer cells.
- the immune responses of patients may be monitored in accordance with the foregoing procedures. For additional procedures for radioimaging and therapy, see EP 0 323,806, Hansen et al., Cancer 71: 3478-85 (1993), and U.S. Pat. No. 4,818,709 and references contained therein, all of which are incorporated by reference.
- compositions for parenteral administration such as are described in Remington's Pharmaceutical Sciences, Mack Publishing Co., Easton, Pa., 1989.
- the final preparations contain from 0.01% to 50% of active ingredients.
- Methods for the production of such conjugates and their use in diagnostics and therapeutics are provided in, for example, Shih et al., U.S. Pat. No. 5,057,313; Shih et al., Int. J. Cancer 41:832 (1988); copending, commonly owned U.S. Ser. No. 08/162,912, now U.S. Pat. No. 5,443,953; and, McKearn et al., U.S. Pat. No. 5,156,840, the contents of which are incorporated by reference.
- a humanized antibody conjugate and a pharmaceutically acceptable carrier are administered to a patient in a therapeutically effective amount.
- a combination of a conjugate and a pharmaceutically acceptable carrier is said to be administered in a “therapeutically effective amount” if the amount administered is physiologically significant.
- An agent is “physiologically significant” if its presence results in a detectable change in the physiology of a recipient patient.
- a targeted therapeutic agent is “therapeutically effective” if it delivers a higher proportion of the administered dose to the intended target than accretes at the target upon systemic administration of the equivalent untargeted agent.
- the conjugate and carrier may need to be administered in combination with other therapeutic agents or as part of a broader treatment regimen.
- Physicians are currently of the opinion that the effectiveness of targeted therapeutics can often be greatly increased when used in a combination therapy approach.
- high-dose radioimmunotherapy for B-cell lymphomas which causes severe hematologic toxicity when used alone, has been shown to be highly effective when used in combination with autologous bone marrow reinfusion. Press et al., “Treatment of Relapsed B Cell Lymphomas with High Dose Radioimmunotherapy and Bone Marrow Transplantation” in CANCER THERAPY WITH RADIOLABELED ANTIBODIES, Goldenberg, ed.
- the antibody was covalently complexed to aminodextran-conjugated methotrexate using the method described by Shih et al., above using carbohydrate hydroxyl groups for derivatization purposes.
- a mutation can be introduced at position 18-20 in the VK FR1 region of hMN-14 (the prefix “h” is intended to mean “humanized”) so as to introduce a glycosylation site, NVT, prior to expression of the blocking gene in mammalian cells.
- hMN-14 antibody with mutated hMN-14-NVT in a blocking cell binding assay FIG. 8 ) has demonstrated that the carbohydrate moiety at position 18 is without influence on immunoreactivity of this humanized antibody.
- Aminodextran average molecular mass 40 kDa, is oxidized by NaIO 4 to form aldehydes (by the oxidation of hydroxyl groups). About 50 to 150 moles of aldehydic groups are introduced per mole of aminodextran by careful control of the reaction conditions and timing. The aldehydes then are reacted with an excess of 1,3-diamino-2-hydroxypropane to form Schiff bases with virtually all of the aldehydes. The Schiff bases are then reduced by treatment with excess NaBH 4 . The amine-derivatized dextran then is purified by gel-exclusion chromatography.
- the cytotoxic drug methotrexate is activated by treatment with dicyclocarbodiamide, followed by reaction with N-hydroxysuccinimide, both in dimethylformamide. Activated MTX is mixed in a 50:1 ratio with the amino derivatized dextran in aqueous solution.
- the product provides, after purification, MTX-derivatized dextran having about 35 MTX moles per mole.
- the MTX adduct thus obtained is conjugated to a MN-14 CDR-grafted antibody using methods described in Shih, et al., supra.
- the antibody carbohydrates are oxidized and the resultant aldehydes are reacted with the remaining amines on the dextran in the adduct.
- the Schiff-base product obtained thereby is reduced by treatment with sodium cyanoborohydride in 10-fold molar excess over antibody.
- the reduced antibody-dextran-MTX product is thoroughly purified prior to assay, and formulated for administration to patients.
- Parental MN-14 antibody is conjugated to dextran-MTX in the same way, as a control.
- the purified CDR-grafted antibody conjugate can be administered to patients with a CEA-producing cancer (see above).
- the response to therapy is monitored, including adverse side effects, particularly those which are mediated by the patient's immune systems.
- Patients treated with the CDR-grafted antibody conjugate show improved therapeutic results, decreased immune response to the agent and notably decreased immune-mediated adverse effects of therapy.
- Therapy with the CDR-grafted antibody conjugate can be carried out at higher dosages and for longer periods of time then with the parental murine MN-14 antibody, allowing more aggressive therapies and improved responses.
- a mouse/mouse hybridoma cell line producing Class III, anti-CEA monoclonal antibodies was established according to Hansen et al. (1993) above and Primus et al. (1983) above.
- Cells were selected for secretion of kappa IgG1 by testing conditioned medium using standard isotyping techniques. A variety of kits for this purpose are commercially available. Such cells were screened for production of antibody by testing conditioned medium using a standard blocking assay described above. Stocks of producer cells that proved out in the assay were expanded and frozen in liquid nitrogen.
- mRNA from MN-14 producing cells was used to synthesize cDNA using standard techniques of cDNA synthesis and DNA amplification by PCR, as described below.
- the primers used for PCR included a restriction endonuclease cleavage site at their 5′ ends to facilitate cloning of the amplification product.
- An oligonucleotide complementary to the end of the sense strand of the DNA encoding the first constant region domain of the murine IgG 1 heavy chain (“CH1”) was used to prime first strand cDNA synthesis by reverse transcriptase.
- the sequence of this primer, CG1FOR is shown in Table 1. Table 1 below provides other oligonucleotide sequences used herein.
- OLIGONUCLEOTIDE SEQUENCES SEQ. ID NO. CG1FOR 41 5′ GG AAGCTT AGACAGATGGGGGTGTCGTTTTG 3′ VH1FOR 42 5′ TGAGGAGAC GGTGACC GTGGTCCCTTGGCCCCAG 3′ VH1BACK 43 5′ AGGTSMAR CTGCAG SAGTCWGG 3′ SH1BACK 44 5′ TG GAATTC ATGGRATGGAGCTGGRTCWTBHTCTT 3′ SH2BACK 45 5′ TG GAATTC ATGRACTTCDGGYTCAACTKRRTTT CK2FOR 46 5′ GG AAGCTT GAAGATGGATACAGTTGGTGCAGC 3′ VK1FOR 47 5′ GTT AGATCT CCAGCTTGGTCCC 3′ VK3FOR 48 5′ GTT AGATCT CCAGCTTGGTCCC 3′ VK3FOR 48 5′ GTT AGATCT CCAGTTTGGTGCCT 3′ VK1BACK 49 5′ GACATT CAGC
- variable region of the heavy chain (“VH”) cDNA then was amplified by the PCR using the same primer, CG1FOR, and a primer based on the consensus sequence of the 5′ end of VH genes (VH1BACK), as described in Orlandi et al. (1989) cited above.
- the PCR product of this reaction was analyzed by agarose gel electrophoresis, which, upon ethidium bromide staining and fluorescence illumination, revealed one major band of about 400 bp, as expected.
- signal sequence primers were used in the PCR to allow determination of the authentic amino acids of the N-terminus.
- SH1BACK and SH2BACK degenerate oligonucleotides based on heavy chain signal sequence coding regions, were used in separate reactions in concert with CG1FOR. A diffuse product band was obtained from CG1FOR, SH1BACK amplification.
- VH1FOR oligonucleotide complementary to a fourth framework region consensus sequence
- the amplification product obtained using the CG1FOR, VH1BACK primer pair was digested with HindIII and PstI separately. The cleavage sites of these enzymes are included in the PCR primers. It was preferable to determine whether there were also sites internal to the VH. Agarose gel analysis of the restriction fragments indicated the presence of an internal PstI site close to one end of the DNA.
- the PCR product was digested with HindIII and PstI, cloned into M13mp18 and 19 and the DNA sequence of the inserts of representative clones determined. The majority of the clones contained inserts of the same VH DNA.
- VH1FOR and SH1BACK primers In order to confirm the VH sequence from a second cDNA preparation and, at the same time, to obtain the authentic, rather than primer-dictated, DNA sequence corresponding to the N-terminus of the VH, the PCR product from VH1FOR and SH1BACK primers was cloned. These primers contain BstEII and EcoR1 restriction sites, rather than the PstI and HindIII sites of CG1FOR and VH1BACK described above. The PCR product of this reaction was cloned by digesting with BstEII, filling in the BstEII ends, digesting with EcoRI, and ligating the EcoRI and blunt ends to the vector, which had been digested with EcoRI and HindIII.
- the sequences of the cloned fragments were determined. The yield of VH fragments was relatively low, perhaps reflecting a lack of specificity in the PCR caused by degeneracy of SH1BACK. However, four of the 18 clones that were sequenced contained DNA encoding the MN-14 VH region as previously sequenced. The other inserts did not derive from VH-encoding DNA.
- FIGS. 1A and 1B The amino acid sequence of murine MN-14 heavy chain variable region, translated from the VH DNA sequence, is shown in FIGS. 1A and 1B (SEQ. ID. NOS. 1 and 2). Comparison of this sequence with sequences representing the murine VH subgroups indicated that the variable heavy region of MN-14 belongs to subgroup IIIB (see, Kabat et al. SEQUENCES OF PROTEINS OF IMMUNOLOGICAL INTEREST, U.S. Government Printing Office, 1987).
- the MN-14 CDR sequences are different from any of those reported by Kabat et al. (1987), supra. Furthermore, the amino acids at four positions in the MN-14 heavy chain VH framework regions are different from those in the framework regions of other subgroup IIIB VH sequences. These four substitutions (Ser 14, Thr 30, Ser 98 and Pro 108) have been observed in other murine VH regions outside the IIIB VH subgroup, however, with the proline in Kabat position 108 being the most unusual.
- Any unusual residues in the VH or VK may represent somatic mutations which proved advantageous to the binding of murine MN-14.
- cDNA encoding the kappa light chain of MN-14 was cloned in much the same fashion as the cDNA encoding the variable region of the heavy chain, as described above.
- Several primers were used to prime reverse transcriptase for synthesis of the first strand of the kappa chain cDNA.
- the sequence of one primer, CK2FOR was derived from the sequence of the 5′ end of the constant region of kappa light chain genes (“CK”).
- the sequences of two other primers, VK1FOR and VK3FOR were based on the sequence of the 3′ end of the variable region of kappa light chain genes (“VK”).
- the first strand DNA product was amplified by PCR using a number of primer pairs. Synthesis in one direction was primed by the primers used to make the first strand. Polymerization in the other, “backward,” direction initiated from a series of kappa light chain-specific primers which had sequences based on either the sequence at the 5′ end of the VK region, VK1BACK, VK2BACK, VK3BACK, VK4BACK and VK8BACK, or the sequence encoding the last four amino acids of the signal peptide and the first four amino acids of the variable region, VK5BACK, VK6BACK and VK7BACK. In addition, cDNA primed by CK2FOR also was amplified using VK1FOR and VK8BACK.
- the amplification products were analyzed by gel electrophoresis in the manner described in the Examples above.
- the products from the reactions primed by VK1BACK, VK3BACK, VK5BACK, VK7BACK and VK8BACK gave rise to the expected 350 bp band.
- VK1FOR/VK8BACK From the VK1FOR/VK8BACK combination, a VK cDNA insert was obtained, but this did not yield a functional VK due to a frameshift within the cDNA encoding CDR L3 and absence of the invariant Cys at position 23.
- This VK cDNA has been isolated from other hybridoma cells and it is derived from the Sp2/0 fusion partner.
- CK2FOR/VK1BACK product yielded a further four different aberrant VK cDNA inserts, in this case lacking the conserved residues of framework 4.
- VK insert obtained using this primer pair was that of a functional VK with the exception of a frameshift at the 3′end of VK1BACK, a phenomenon apparently due to mismatch-induced slippage of the primer. This problem may be avoided by the use of VK8BACK which does not extend as far into the VK gene. However, analysis of further clones from VK1FOR/VK8BACK product did not yield the desired insert.
- VK3FOR was designed from its genuine fourth framework sequence, and synthesized as an alternative to VK1FOR. This strategy proved successful when amplification of VK3FOR-primed cDNA with VK3FOR and VK8BACK yielded 4 clones containing the desired VK.
- the DNA and amino acid sequence of the murine MN-14 kappa light chain variable region is set out in FIGS. 2A and 2B (SEQUENCE ID. NOS. 3 and 4).
- This MN-14 VK can be placed in Kabat's VK subgroup V. Only 3 residues in the MN-14 VK framework regions (Met 10, Val 66 and Thr 76) do not appear in other members of this subgroup. Met 10 and Val 66 are the most unusual of the three. They are not found in any murine VK listed in Kabat. None of the MN-14 VK CDRs are previosuly-reported sequences in Kabat.
- variable region cDNAs In the production of a chimeric antibody consisting of murine variable regions and human constant regions, testing alongside the parent mouse antibody served to check that the correct variable region cDNAs have been isolated. A successful chimeric antibody also acts as a useful control when assessing the binding of humanized versions.
- the scheme used in cloning the variable regions for expression is described by Orlandi et al. (1989) supra, and is illustrated in FIGS. 3 and 4 .
- VH DNA was amplified from the M13 clone MNVH41 using the PCR with oligonucleotides VH1BACK and VH1FOR.
- the PstI and BstEII restriction sites in the primers allowed the VH to be inserted into M13VHPCR1 in the correct context for expression.
- the internal BamHI restriction site of the VH was removed by site directed mutagenesis.
- the reaction product, which encompassed the entire HindIII-BamHI fragment of M13VHPCR1 was cloned into pSVgpt and the VH sequence confirmed.
- the human IgG1 constant region gene published by Takahashi et al., Cell, 29: 671-679 (1962) above then was added to the construct as a BamHI fragment, which yielded the vector referred to as pSVgptMN14MuVHHuIgG1.
- VK DNA was similarly obtained from the M13 clone MNVK154 by PCR amplification with the primers VK8BACK and VK3FOR and the PvuII, BglII-digested product cloned into M13VKPCR1, whereupon the sequence of the variable region was checked.
- the HindIII-BamHI fragment was excised from RF DNA and transferred to the plasmid pSVhyg.
- the construct already contains a human kappa constant region gene as described in Hieter et al., Cell, 22: 197-207 (1980).
- the final vector thus obtained was designated pSVhygMN14MuVKHuCK.
- the HindIII-BamHI fragment of M13KLHuVHAIGA was inserted into a plasmid pSVgpt to yield the expression vector pSVgptKLHuAIGAHuIgG1.
- the HindIII-BamHI fragment of M13HuVK was inserted into the plasmid pSVhyg to yield the expression vector pSVhygMN14REIHuVKHuCK.
- Antibody was purified conventionally from the medium by protein-A agarose affinity chromatography, initially. The purified antibody was characterized further with reference to native MN-14 antibody, human antibodies and other controls.
- the antibody was also characterized by its reaction profile in a MN-14 blocking assay, which provided an informative comparison of CEA binding affinities of the hybrid antibodies with CEA binding by the MN-14 murine antibody which served as a positive control.
- the human NEWM VH, KOL VH and REI VK frameworks were chosen as the basis for reshaping the antibody, as they are likely to be tolerated in humans. Alignments of the MN-14 VH (SEQ. ID NO. 2) and VK (SEQ. ID NO. 4) with these human variable regions are shown in FIGS. 5A and 5B (SEQ. ID. NOS. 5-7).
- the starting points for the introduction of MN-14 CDRs are DNAs encoding the required FRs and irrelevant CDRs. These template variable regions are in a form compatable with the expression vectors used, that is, within HindIII-BamHI fragments, that also include promotor regions, signal peptide and intron DNA ( FIGS. 3 and 4 ).
- the template is M13VHPCR1 (Orlandi et al, above, and section 8.3 below). A derivative of this template, containing KOL FRs and irrelevant CDRs, was used to generate the KOL coding region.
- a derivative of M13VKPCR1 (Orlandi et al. above) was used in the creation of the HuVK vector.
- the resulting vectors were termed M13NMHuVH, M13KLHuVH and M13HuVK.
- the HindIII-BamHI fragments containing the humanized MN-14 variable region DNAs were transferred from these M13 vectors to the expression vectors essentially as described for the construction of the chimeric MN-14 expression vectors in Example 8.1.
- the NEWM FR is described in Poljak et al. Biochemistry 16: 3412-20 (1977). Construction of a hMN-14 with an affinity for CEA comparable to that of its murine counterpart was achieved in a stepwise approach. Production of the chimeric antibody provided a useful control when assessing the binding of the humanized versions.
- the human NEWM VH and REI VK frameworks were initially chosen as the basis for reshaping the antibody as they are known to be tolerated in man. MN-14 residues Phe27, Asp28 and Thr30 were retained because, although not part of the Kabat's hypervariable region, CDR1 residues 31-35, those amino acids are part of the CDR1 structural loop (Chothia et al., J. Mol.
- FIGS. 6A, 6B , and 6 C The alignment of the different versions of the NEWM VH frameworks (SEQ. ID NOS. 5 and 8-11) with the MN-14 VH (SEQ. ID NO. 2) is shown in FIGS. 6A, 6B , and 6 C. Each of these versions has been paired with the same HuVK. The inclusion of either the TLY or KFIVS motifs gave about a two-fold improvement.
- KOL VH is described in Schmidt et al., Z. physiol. Chem, 364: 713-747 (1987).
- the FR used for humanizing the antibody is as given in Kabat.
- the original version of the KOL-based VH contained the MN-14 CDRs, as defined in terms of residue variability (Kabat et al., above) and three additional murine residues.
- the NEWM VH two of these substitutions were made because the actual peptide CDR1 structural loop, which extends from the ⁇ -sheet framework, consists of residues 25 to 32 (Chothia et al. 1987, above).
- MN-14 residue 94 was included because the Arg residue of the KOL VH is involved in a salt bridge with Asp 110 and, like with the NEWM VH, it was felt that retention of Arg 94 might perturb the MN-14 CDR3 structure.
- the side-chain of residue 94 may also interact with residues of CDR1.
- Other changes made to this basis MN-14 KOLHuVH (SEQ. ID NO. 12) were as follows: (i) Ser24 to Ala24 and Val48Ala49 to IleGly (KLHuVhAIG, SEQ. ID NO. 13).
- Ala24 The loop of CDR1 is anchored by the penetration of the side chain of residue 29 into the framework. Residue 24 is one of those with which it interacts (Chothia et al., J. Mol. Biol. 227: 799-817 (1992)).
- Ala74 This residue is part of the fourth loop found at the VH antigen-binding surface and its side chain is almost completely exposed to solvent (Padlan, 1991 above). Direct interaction of this residue with antigen could be envisaged.
- FIGS. 6A, 6B , and 6 C The alignment of the different versions of KOL VH frameworks (SEQ. ID NOS. 7 and 12-15) with NEWM based versions (SEQ. ID NOS. 5 and 8-11) and the murine MN14 (SEQ. ID NO. 2) is shown in FIGS. 6A, 6B , and 6 C.
- FIGS. 7 and 8 The DNA sequences and translation products of MN14HuVH and MN14HuVL are shown in FIGS. 7 and 8 , 0respectively (SEQ. ID NOS. 16-19, respectively).
- the humanized KLHuVH varients such as antibody KLHuVHAIGA/HuVK, were purified and tested in a blocking assay carried out as follows. Antibodies were added at the indicated concentrations together with HRP-labeled MN-14 to a final volume of 0.1 ml. Following 30 mins. of incubation at 37 1 C, and washing to remove unbound antibodies, the relative affinities of the antibodies were determined from the remaining bound peroxidase activity. A shown by the assay data of FIG. 9 , the activity of the “reshaped” (i.e., CDR-engrafted on FR) humanized antibody was similar to that of chimeric and murine positive controls.
- REI VL is described in Epp et al., Eur. J. Biochem., 45: 513-24 (1974). No change4s were made in REI framework to improve binding.
- the changes from the sequences given in Kabat et al. (1987) are: M4 to L; T39 to K: Y71 to F; L104 to V; Q105 to E: and T107 to K. These changes preexisted in the template used when grafting the MN-14 CDRs and were not made specifically to improve binding.
- the M4 to L change incorporates a restriction site but the remaining differences eliminate unusual residues in the REI framework.
- a similar framework has been referred to as a consensus of huma kappa subgroup I by Foote et al., J. Mol. Biol. 224: 487-9 (1992).
- Cells that were stably transformed for expression of the MN-14 CDR-grafted human antibodies were selected in the manner described above and cloned out to establish individual producer lines. Each of the lines was assayed to determine production of the correct antibody and to assess the efficiency of production. The antibody class was determined and the anti-CEA binding affinity assessed.
- the best producers were further characterized for the overall amount of the antibody produced and, for the best of these, sequences were obtained from the mRNA to insure that the mutation has not occurred in the antibody genes during transfection, integration, propagation or selection.
- the best producer lines of the MN-14 CDR-grafted human antibody were cultured, the growth medium collected and filtered through a 0.2 micron membrane.
- the antibody was then purified by protein A chromatography followed by other conventional purification steps such as ion exchange and size exclusion chromatography.
- the cells were pelleted and from the supernatant by conventional centrifugation.
- the antibody was purified from the supernatant fluid as described above.
Abstract
A Class III, anti-CEA monoclonal antibody, preferably a monoclonal antibody comprising the complementarity-determining regions (CDRs) of a parental murine Class III, anti-CEA monoclonal antibody is disclosed. This monoclonal antibody is preferably a humanized monoclonal antibody in which the CDRs are engrafted to the framework regions of a heterologous antibody, wherein the humanized monoclonal antibody retains the binding specificity of the parental murine monoclonal antibody. A preferred Class III, anti-CEA monoclonal antibody is one in which the preferred heterologous antibody is from a human. Also provided are DNA constructs, vectors, cells and methods for producing the Class III, anti-CEA monoclonal antibodies, and diagnostic and therapeutic conjugates using same. Methods of treatment with a Class III, anti-CEA monoclonal antibody and with the conjugate containing this monoclonal antibody are provided as well as methods of diagnosis with the conjugate containing this monoclonal antibody.
Description
- This application is a continuation of application Ser. No. 09/253,794, filed Feb. 22, 1999, now pending, which is a divisional of application Ser. No. 08/318,157, filed Oct. 5, 1994, now U.S. Pat. No. 5,874,540, which are both incorporated by reference in their entirety. This application claims only subject matter disclosed in the parent applications and therefore presents no new matter.
- The invention relates to immunological reagents for diagnostic and therapeutic use in colon and other cancers. In particular, the invention relates to humanized anti-carcinoembryonic antigen (“CEA”) monoclonal antibodies (“mAbs”) that have the binding affinity characteristics of corresponding mouse anti-CEA mAb (MN14) and the antigenic and effector properties of a human antibody. Further, the invention relates to humanized mAbs in which the complementarity determining regions (“CDRs”) of an anti-CEA murine mAb is grafted into the framework regions of a human antibody, to DNAs that encode such CDR-grafted antibodies, to vectors and transformed hosts for propagating and expressing the DNAs, and to conjugates of the antibodies useful in diagnostic and therapeutic applications.
- A promising approach to cancer diagnosis and therapy involves the use of targeting antibodies to deliver diagnostic and therapeutic agents directly to the site of a malignancy. Over the past decade, a wide variety of tumor-specific antibodies and antibody fragments have been developed, as have methods to conjugate the antibodies to drugs, toxins, radionuclides or other agents, and to administer the conjugates to patients. These efforts have produced great progress, but a variety of largely unanticipated problems have limited the diagnostic and therapeutic utility of some of the reagents thus far developed.
- Among the most intractable problems is that which is caused by the human immune system itself, which may respond to the targeting conjugate as a foreign antigen. For instance, patients treated with drugs or radionuclides complexed with murine monoclonal antibodies (which have been the most commonly used targeting antibodies for human) develop circulating human anti-mouse antibodies (HAMAs) and a generalized immediate type-III hypersensitivity reaction to the antibody moiety of the conjugate. Furthermore, even when adverse side effects are minimal (for example, as in a single administration), circulating HAMAs decrease the effective concentration of the targeting agent in the patient and therefore limiting the diagnostic or therapeutic agent from reaching the target site.
- Several approaches have been developed to overcome or avoid this problem, with only limited success. One strategy has been to chemically modify the targeting antibody to suppress its antigenicity. For example, conjugation of polyethylene glycol to the targeting antibody (PEGylation) is reported to reduce antigenicity of antibodies. Another approach has been to characterize the situs of antigenicity in an antibody and then remove it. In this vein, Fab′, F(ab)2 and other antibody fragments have been used in place of whole IgG. In addition, attempts have been made to reduce the adverse effects of HAMA by plasmaphoretically removing HAMA from blood. Immunosuppressive techniques also have been used to ameliorate the adverse effect of the foreign antibody sufficiently to permit multiple treatments with the targeting agent.
- None of these approaches has proven altogether satisfactory. An important need persists for a means to reduce or eliminate the adverse immune response to targeting antibody and antibody conjugates in order to gain the full benefit of these diagnostic and therapeutic agents.
- This goal has been achieved with the CDR-grafted humanized murine anti-human CEA mAbs that are described below.
- It is an object of the present invention to provide a humanized Class III anti-CEA mAb in which the CDRs of a murine Class III anti-CEA mAb (MN14) are functionally engrafted to the amino acid sequence of a human antibody or antibody fragment to provide an immunological reagent with the anti-CEA binding properties of the murine Class III, anti-CEA mAb and the immunogenic properties of a human mAb in a human patient.
- It is another object of the present invention to provide DNA constructs encoding such antibodies. Particular objects in this regard are substrate DNAs that facilitate genetic manipulation to produce improved antibodies and DNAs encoding the antibodies with advantageous properties in cell culture and antibody production.
- Yet another object of the invention is to provide vectors for propagating the DNA and for expressing the antibody. A related object of the invention is to provide cells containing a vector for the purposes of storage, propagation, antibody production and therapeutic applications.
- Still another object of the invention is to provide compositions comprising the antibodies for use in diagnosis and therapy. In this regard it is an object of the invention to provide conjugates comprising the antibodies complexed with imaging agents and therapeutic agents for ex vivo and in vivo imaging, diagnosis, prognosis and therapy, among others.
- In accomplishing the foregoing objects, there has been provided, in accordance with one aspect of the present invention, a humanized mouse mAb, comprising the CDRs of a murine Class III, anti-CEA mAb (MN-14) engrafted to the framework regions of a heterologous (human) antibody, wherein the thus humanized mAb antibody retains the Class III, anti-CEA binding specificity of the murine mAb but in the patient is less immunogenic than is the parent MN-14 murine monoclonal antibody.
- In a highly preferred embodiment, the light chain variable regions of the humanized antibody are characterized by the formula:
FRL1-CDRL1-FRL2-CDRL2-FRL3-CDRL3-FRL4
wherein each FR is separately a framework region of a human antibody, and each CDR is separately in a complementarity-determining region of the light chains of MN-14, and the subscripts refer to light (“L”) chain regions. The heavy chain variable regions are characterized by the formula:
FRH1-CDRH1-FRH2-CDRH2-FRH3-CDRH3-FRH4
wherein FR and CDR have the same meanings as above, and wherein the subscripts “H” refer to heavy chain regions. - In one embodiment, CDRL1 has the amino acid sequence KASQDVGTSVA (SEQ. ID NO. 20); CDRL2 has the amino acid sequence WTSTRHT (SEQ. ID NO. 21); CDRL3 has the amino acid sequence QQYSLYRS (SEQ. ID NO. 22); CDRH1 has the amino acid sequence TYWMS (SEQ. ID. NO. 23); CDRH2 has the amino acid sequence EIHPD SSTINYAPSLKD (SEQ. ID NO. 24); and, CDRH3 has the amino acid sequence LYFGFPWFAY (SEQ. ID NO. 25).
- In another embodiment, FRL1 has the amino acid sequence DIQLTQSPSS LSASVGDRVTITC (SEQ. ID NO. 26); FRL2 has the amino acid sequence WYQQKPGKAP KLLIY (SEQ. ID NO. 27); FRL3 has the amino acid sequence GVP(S or D)RFSGS(G or V) SGTDFTFTISSLQPEDIATYYC (SEQ. ID NO. 28); FRL4 has the amino acid sequence FGQGTKVEIK (SEQ. ID NO. 29); FRH1 has the amino acid sequence EVQLVESGGG VVQPGRSLRLSCSSSGFDFT (SEQ. ID NO. 30), EVQLVESGGGVVQPGRSLRLSCSAS GFDFT (SEQ. ID NO. 31), or QVQLQ ESGPG LVRPS QTLSL TCTSS GFDFT (SEQ. ID NO. 32); FRH2 has the amino acid sequence WVRQAPGKGLEWVA (SEQ. ID NO. 33), WVRQAPGKGLEWIA (SEQ. ID NO. 34), or WVRQPPGRGLEWIA (SEQ. ID NO. 35); FRH3 has the amino acid sequence RFTISRDNSKNTLFLQMDSLRPEDTGVYFCAS (SEQ. ID NO. 36), RFTISRDNAKNTLFLQMDSLRPEDTGVYFC AS (SEQ. ID NO. 37), or RVTMLRDTSKNGSFLRLSSVTAADTAVYYCAS (SEQ. ID NO. 38); and FRH4 has the amino acid sequence WGQGTPVTVSS (SEQ. ID NO. 39), or WGQGTTVTVSS (SEQ. ID NO. 40); and wherein C may be in the sulfhydryl or disulfide form.
- Another preferred embodiment comprises a diagnostic or therapeutic agent complexed to Class III, anti-CEA humanized mAb in which the CDRs of the antibody are derived from those of the MN-14 murine mAb and the FRs are derived from those of the heterologous (human) antibody, wherein the conjugate retains the Class III, anti-CEA binding specificity of MN-14, but is in humans less immunogenic than is murine MN-14. In one such embodiment the light chain and heavy chain variable regions are characterized as shown above and have amino acid sequences also as described above.
- In yet another preferred embodiment, a method for diagnosing or treating a patient comprises the step of administering in an appropriate regimen the conjugate of the previous preferred embodiment.
- Another preferred embodiment comprises an isolated, purified DNA that encodes the light chain, the heavy chain or both chains of the humanized antibody described above.
- Another preferred embodiment comprises the DNA sequence of the CDRs and FRs described above.
- Other objects, features and advantages of the present invention will become apparent from the following detailed description and appended claims.
- The following terms or abbreviations are used in the present application. The meanings set out in this glossary are for illustrative purposes only. The full meaning of the terms will be apparent to those of skill in the art.
- “CDR” is used as an abbreviation for Complementarity Determining Region. These are the regions within the variable regions of an antibody that are primarily, but not exclusively, responsible for antigen-antibody binding.
- “FR” is an abbreviation for Framework Region. Broadly speaking, these are the portions of the variable regions of an antibody which lie adjacent to or flank the CDRs. In general, these regions have more of a structural function that affects the conformation of the variable region and are less directly responsible for the specific binding of antigen to antibody, although, nonetheless, the framework regions can affect the interaction.
- “Chimeric” refers to an antibody in which the variable region is derived from a mouse antibody and the constant region is derived from an antibody from a heterologous (other) species.
- “Humanized” refers to a chimeric antibody as defined above, but one in which the FR variable regions are derived from a human antibody.
- “HAMA” refers to human antibodies directed to a mouse antibody, that are produced when a mouse antibody is administered to a human subject.
- “HAHA” refers to human antibodies directed to a humanized mouse antibody.
- “CEA” refers to carcinoembryonic antigen, a 180 kDa glycoprotein that is expressed in most adenocarcinomas of endodermally-derived digestive system epithelia and in some other cancers such as breast cancer and non-small cell lung cancer.
- The letter “h” as a prefix means “humanized”.
- Other abbreviations are used in accordance with Roitt et al, IMMUNOLOGY, 3rd ed. Mosby Year Book Europe Ltd. (1993), the entirety of which is herein incorporated by reference.
- These and other terms used in the present disclosure are used in the same sense as ordinarily they are employed in the arts to which this invention pertains.
-
FIGS. 1A and 1B (SEQ. ID. NOS. 1 and 2) shows the consensus DNA sequence of murine NEWM MN-14 variable region heavy chain (“VH”) and its protein translation product. The CDRs are enclosed in boxes. -
FIGS. 2A and 2B (SEQ. ID. NOS. 3 and 4) shows the consensus DNA sequence of murine MN-14 variable region light chain (“VK”) and its protein translation product. The CDRs are enclosed in boxes. -
FIG. 3 shows a vector for the expression of chimeric or humanized MN-14 heavy chain gene. The schematic diagram shows both the chimeric and a reshaped heavy chain immunoglobulin (Ig) gene and the pSVgpt expression vector. The diagram at top, labeled “CHIMERIC,” is a map showing DNA encoding the MN-14 mouse VH region joined to DNA encoding a human IgG1 constant region. In the MN-14 VH region the three CDRs are indicated by the three dark areas. The FRs are indicated by the four stippled areas. The middle diagram, labeled “RESHAPED” shows the humanization of the MN-14 VH region in which the mouse FRs have been replaced by human FRs, indicated by the four clear areas in the “Human” VH region. The circular map of the expression vector pSVgpt at bottom shows the HindIII/BamHI insertion site for the reshaped MN-14 antibody gene just downstream from an Igh enhancer element. The map also indicates some important functional domains in the vector, including the replication origins for propagation in E. coli (colEl ori) and in mammalian cells (SV40 promoter region), and genes encoding selective markers for culturing bacterial (Apr) and mammalian (gpt) cells transformed with the vector. Expression of the antibody gene in this case is mediated by the Ig promoter indicated by the solid circles near the HindIII site in the maps of the antibody genes. -
FIG. 4 shows a vector for the expression of chimeric or humanized MN-14 kappa chain gene. The diagram shows a chimeric and a reshaped MN-14 kappa light chain gene and the pSVhyg expression vector. The diagram at top, labelled “CHIMERIC,” is a map showing DNA encoding the MN-14 mouse kappa light chain variable region (“VK”) joined to DNA encoding a human kappa constant (“CK”) region. In the mouse VK region the three CDRs are indicated by the three dark areas and the FRs are indicated by the four stippled areas. The middle diagram, labelled “RESHAPED” shows the humanization of the MN-14 VK region in which the mouse FRs have been replaced by human FRs, which are indicated by the four clear areas in the “Human” VK region. The circular map of the expression vector pSVhyg at bottom shows the HindIII/BamH1 insertion site for the reshaped MN-14 antibody gene just downstream from an Igh enhancer element. The map indicates some important functional domains in the vector, including the replication origins for E. coli (col E1 ori) and mammalian propagation (SV40 promoter region), and genes encoding selective markers for culturing bacterial (Apr) and mammalian (gpt) cells transformed with the vector. Expression of the antibody gene in this case is mediated by the Ig promoter schematized by the solid circles near the HindIII site in the maps of the antibody genes. -
FIGS. 5A and 5B shows the alignments of the murine MN-14 variable regions (SEQ. ID. NOS. 2 and 4) with the human variable regions NEWM VH (SEQ. ID NO. 5) and REI VK (SEQ. ID NO. 6) (FIG. 5A ). and with the human KOL VH region (SEQ. ID NO. 7) (FIG. 5B ). CDRs are boxed, and the murine VH FRs, which are incorporated into the humanized VH, are marked with their positions according to the numbering system of Kabat et al. SEQUENCES OF PROTEINS OF IMMUNOLOGICAL INTEREST, U.S. Government Printing Office, Washington, D.C., 1987. Murine residues outside the CDRs that were included in the KLHuVH are indicated by a filled circle. -
FIGS. 6A, 6B and 6C shows a comparison of the amino acid sequence between murine (SEQ. ID NO. 2) and humanized (SEQ. ID NOS. 57, 8-11, 58 and 12-15). MN-14 VH framework residues (FR). Only human FR residues different from the mouse are shown. CDAs for NEWM and KOL are also not shown. The position of the substitution is indicated according to the Kabat et al. numbering system. The 3 CDRs are boxed. -
FIG. 7 shows the DNA sequence and corresponding amino acid sequence (SEQ. ID NOS. 16 and 17) of the MN-14HuVH (KLHuVh) region. CDRs are boxed. -
FIG. 8 shows the DNA sequence and corresponding amino acid sequence (SEQ. ID NOS. 18 and 19) of the MN-14HuVK region. CDRs are boxed. -
FIG. 9 is a graph of MN-14 blocking (i.e., competition) assays comparing relative binding affinities of KLHuVH variants, including: (-∘-) KLHuVH/HuVK; (-▪-) KLHuVHAIG/HuVK; (-●-) KLHuVHAIGAY/HuVK; (-□-) KLHuVHAIGA/HuVK; (-▴-) chimeric control; and, (-Δ-) murine control. -
FIG. 10 shows MN-14 blocking assays comparing hMN-14 with HMN-14-NVT (glycosylated inFR 1 region). -
FIG. 11 is a radioautogram of the abdomen of a colon cancer patient following administration of 131I-labelled hMN14IgG (left panel) or mMN14IgG (right panel) in the same patient. - Notwithstanding past failures to develop an effective non-HAMA-inducing anti-CEA antibody having the CEA-binding characteristics of MN-14, it has been discovered that the CDRs of the MN-14 mAb can be grafted onto the FRs of a human antibody to provide antibodies and antibody-derived reagents that have the antigen binding properties of the MN-14 anti-CEA mAb, while also exhibiting reduced induction of HAMA and augmented effector activities.
- The murine anti-CEA IgG1 monoclonal antibody MN-14, and its production, have been described previously. Hansen et al., Cancer, 71: 3478 (1993); Primus et al., U.S. Pat. No. 4,818,709. MN-14 meets all of the criteria of a Class III, anti-CEA monoclonal antibody, being unreactive with meconium antigen by EIA and not reacting with normal tissues.
- Blocking studies are carried out according to Hansen et al. 1993, above, Losman et al., Int. Cancer, 56: 580 (1994); Hansen et al., Clin. Chem., 35: 146 (1989). Using the same conditions as described in those references for quantification of CEA, binding of humanized MN-14 may be assessed relative to a labeled MN-14 probe. A typical probe is MN-14 conjugated to horse radish peroxidase (HRP). Both labeled and unlabeled MN-14 are added to a CEA sample fixed to a solid support such as microtitre plate wells. The degree of “blocking” of labeled MN-14 binding to CEA is a direct reflection of unlabeled MN-14 activity. Using standard MN-14, the relative activity of an unknown sample of humanized MN-14 or derivatives thereof can be determined. Typically, the reactions are performed in the wells of a microtitre plate where wells are charged directly with CEA at a level of, for example, 25 μg/well or indirectly where the wells are precharged with an antibody reactive with CEA but to an epitope different than that to which MN-14 interacts; such an antibody may be the MN-15 mAb. CEA can thus be indirectly fixed to the well. A competitive binding EIA assay can then be performed with such a charged plate.
- Alternate to the aforementioned HRP-labeled mAbs, antibodies can be radioiodinated conventionally with, for example, 131I by the chloramine-T method to a specific activity of about 10 mCi/μg, and free radioisotopes removed by chromatography on acrylamide gel columns (see Hansen et al., 1993, above).
- Molecular biological techniques suitable to carrying out the invention as herein described also are known to those skilled in the art. Suitable teachings are described in numerous manuals and primary publications, including inter alia, Sambrook et al., MOLECULAR CLONING: A LABORATORY MANUAL, 2nd Ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989), PROTOCOLS IN MOLECULAR BIOLOGY, Ausubel et al., Eds., Green Publishing Associates and Wiley-Interscience, John Wiley and Sons, New York (1987, 1988, 1989), which are herein incorporated by reference in their entirety including supplements.
- MN-14 light and heavy chain CDRs disclosed herein, and modified MN-14 CDRs can be integrated into other antibodies using well-known recombinant techniques, such as those described in the above references.
- Specific methods suitable to this end are shown below in the examples. Based on the amino acid sequences set forth herein, oligonucleotides encoding MN-14 CDRs can be synthesized. Oligonucleotides that encode modified CDRs may be made, as well as those that encode exactly the amino acid sequences herein set forth. Also, the oligonucleotides may contain nucleotides in addition to those of an MN-14 CDRs, to facilitate cloning, for instance. Oligonucleotide synthesis techniques are well known, and can be carried out on automated equipment available from a number of manufacturers. Moreover, oligonucleotides of any specified sequence can be obtained commercially.
- Oligonucleotides encoding the MN-14 CDRs and/or specific FR residues. or representing the complementary strand thereof, may be used to introduce codons for these residues into VH or VK DNA by site-directed mutagenesis provided that the ends of the oligonucleotides, generally 12 nucleotides, are designed to anneal perfectly to the template DNA. The template DNAs are typically single-stranded DNAs representing M13 vectors that carry a variable region DNA encoding the required FRs. In one method, the mutagenic oligonucleotides are phosphorylated at their 5′ ends and, together with an oligonucleotide priming 5′ to variable region DNA, are annealedd to the ssDNA template. The oligonucleotides are extended using T7 polymerase and the fragments linked together by T4 DNA ligase to give a complete mutant strand covering the whole variable region. Using the mutant strand as a template, multiple copies of its complementary strand can be synthesized from a suitable primer using Taq DNA polymerase in a thermal cycling reaction. Once the mutant strand has been preferentially amplified in this manner, the DNA can be amplified by conventional PCR for cloning, sequencing and expression.
- Suitable antibody-encoding DNAs are illustrated by the disclosure herein, but include practically any such DNA. A variety of human antibody genes are available in the form of publically accessible deposits. Many sequences of antibodies and antibody-encoding genes have been published and suitable antibody genes can be synthesized from these sequences much as described above.
- The scope of this invention encompasses all alleles, variants and mutations of the DNA sequences described herein.
- CDR grafting in accordance with the present disclosure may be carried out using established techniques. Antibody-producing cell lines may be selected and cultured using techniques well known to the skilled artisan. Such techniques are described in a variety of laboratory manuals and primary publications. For instance, techniques suitable for use in the invention as described below are described in CURRENT PROTOCOLS IN IMMUNOLOGY, Coligan et al., Eds., Green Publishing Associates and Wiley-Interscience, John Wiley and Sons, New York (1991) which is herein incorporated by reference in its entirety, including supplements.
- RNA may be isolated from the original hybridoma cells by standard techniques, such as guanidinium isothiocyanate extraction and precipitation followed by centrifugation or chromatography. Where desirable, mRNA may be isolated from total RNA by standard techniques such as chromatography on oligodT cellulose. Techniques suitable to these purposes are well known in the art as described in the foregoing references.
- cDNAs that encode the light and the heavy chains of the antibody may be made, either simultaneously or separately, using reverse transcriptase and DNA polymerase in accordance with well known methods. It may be initiated by consensus constant region primers or by more specific primers based on the published heavy and light chain DNA and amino acid sequences.
- PCR also may be used to isolate DNA clones encoding the antibody light and heavy chains. In this case the libraries may be screened by consensus primers or larger homologous probes, such as mouse constant region probes. The necessary techniques are well known to those of skill in the art, are set forth in the foregoing Sambrook and Ausubel references and are illustrated by the examples set forth below.
- cDNAs that encode the light and the heavy chain of an antibody can be propagated in any suitable vector in any suitable host prior to isolation of the CDR. Often the clones will most conveniently be propagated for this purpose in E. coli as illustrated in the examples below. However, a variety of other vectors and host cells well knowN to those of skill profitably may be employed in this aspect of the invention. A variety of such vectors are described in the foregoing references.
- DNA, typically plasmid DNA, may be isolated from the cells, restriction mapped and sequenced in accordance with standard, well known techniques set forth in detail in the foregoing references relating to recombinant DNA techniques.
- DNAs encoding antibody heavy and light chains and fragments thereof in accordance with the vector are used to construct chimeric and CDR-grafted humanized MN-14 antibodies.
- The CDRs of the MN-14 anti-CEA mAb are herein identified and described, and illustrated in
FIGS. 1A and 1B and and 2A and 2B (SEQ. ID NOS. 2 and 4, respectively) Using these sequences, CDRs of the MN-14 heavy and light chain can be synthesized for use in the present invention. It is not necessary to redone MN-14 CDRs from a natural source. The DNA and amino acid sequences are set forth herein. Oligonucleotide synthesis techniques suitable to this aspect of the invention are well known to the skilled artisan and may be carried out using any of several commercially available automated synthesizers. In addition, DNAs encoding the CDRs set forth herein can be obtained through the services of commercial DNA synthesis vendors. - Polynucleotides synthesized in accordance with this aspect of the invention may include those not derived from an MN-14 CDR as well as those that make up the CDR. The additional bases may be included to facilitate joining the CDR to the FRs from a heterologous source. They may comprise restriction sites or overlapping complementary regions for this purpose. The synthesis of longer, double-stranded DNAs from shorter, overlapping, single-stranded DNAs is well known to those of skill in the art. Likewise, well known is the end-to-end joining of DNAs, including blunt-ended DNAs and those with at least partially overlapping complementary termini. These techniques are illustrated in the foregoing references on recombinant DNA techniques, for instance.
- The CDRs of the MN-14 heavy and light chains may also be modified particularly after incorporation into a chimeric or humanized antibody using well-known recombinant DNA techniques for deleting, inserting and altering bases in a cloned or synthetic DNA or RNA. Site-specific mutagenesis techniques suitable to this end are well known to those of skill in the art, and are illustrated in the foregoing references on recombinant DNA techniques. Also illustrated are deletional and insertional techniques. These methods can be used to introduce practically any desired alteration into polynucleotides that encode the MN-14 CDRs or into other regions of a closed heavy or light chain gene.
- MN-14 CDRs and modified MN-14 CDRs can be introduced into practically any set of FRs in accordance with the present invention. It will be appreciated by those of skill in the art that a variety of well known techniques for cloning and manipulating polynucleotides may be effectively employed in this regard. Such techniques are illustrated by the methods set forth in the foregoing recombinant DNA-related references.
- In a particularly preferred embodiment of the present invention, MN-14 CDRs are grafted into a human antibody. It will be understood that human antibody in this context refers to any antibody that occurs in a human or an engineered antibody that has been designed, in some respect, to be compatible with the human immune system. Particularly preferred for this purpose are antibodies that, broadly, do not engender an adverse immune response in a patient. More particularly, the expression “human antibody” is intended to mean an antibody encoded by a gene actually occurring in a human, or an allele, variant or mutant thereof.
- Once DNA encoding an MN-14-derived CDR-grafted antibody has been assembled from MN-14 VH and VK region DNAs and the variable regions thus formed combined with their respective light and heavy chains of human constant domains, it may be inserted into a vector for propagation and expression by conventional techniques. In this manner desired amounts of the antibody may be obtained.
- The MN-14 CDR-grafted human antibody can be used in imaging applications by administrating to a subject the humanized antibody or Fab′ thereof conjugated with an imaging compound or isotope.
- The antibody is conjugated to a label for imaging using conventional methods. Such conventional methods include, but are not restricted to: 1) direct radioiodination of the antibody protein or fragments thereof or 2) direct attachment to the antibody or fragments thereof of metallic nuclides (see, e.g., Hansen et al., Cancer, 73: 761 (1994)). The use of bifunctional chelates that can be used to bind various diagnostic or therepeutic metals to the antibody or fragment thereof is also within the scope of the present invention (see, Antibodies in Radiodiagnosis and Therapy, ed. M. R. Zalutsky, 1989, CRC Press, Boca Raton, Fla., and Cancer Therapy with Radiolabeled Antibodies, ed. D. M. Goldenberg, 1994, CRC Press, Boca Raton, Fla.). Following the conjugation procedure and characterization of the product, satisfactorily labelled conjugates are purified to homogeneity under conditions that conform to Good Manufacturing Procedures (“GMP”) appropriate to the production of diagnostic compositions for use in human patients.
- The reaction of serum antibody with the MN-14 CDR-grafted antibody and imaging agent portions of the conjugate can be determined over the course of the diagnostic procedures, including the reaction of control sera obtained prior to administration of conjugate. Similar determinations are made in other patients treated with similar conjugates of MN-14 itself. The sera antibody reactive with CDR-grafted MN-14 human antibodies detected by these tests is much less than the antibody reactive with antibody portion of the conjugate in patients treated with the murine MN-14-containing conjugates.
- Humanized MN-14 antibodies conjugated to aminodextran and to boron may be used for diagnostic purposes. MN-14 and CDR-grafted MN-14 antibodies can be prepared as set forth above for conjugation to an aminodextran-boron adduct. Amino-dextran-boron adducts can be prepared by reaction of a suitable boron cage compound (e.g., a 12-boron carborane suitably derivatized with an amino-dectran functional group). In a preferred embodiment, the amino-dextran is reacted with an excess of a haloacetyl acid ester or anhydride (such as iodoacetic anhydride), thereby producing an amino-dextran with a desired number of haloacetyl groups, usually ranging from 10-1000 groups, depending on the reaction conditions and the size of the amino-dextran. A suitable boron derivative such as mercaptocarborane-B12 is reacted, in a desired molar excess, with the haloacetyl-amino-dextran via an alkylation reaction. In a preferred embodiment, a number of haloacetyl groups on the boronated haloacetyl amino-dextran remain unreacted, and can be used as a “handle” to attach the adduct to protein thiol groups.
- MN-14 CDR-grafted humanized antibodies and their derivatives, because of their reduced immunogenicity, are useful in therapy, for passive immunization without negative immune reactions such as serum sickness or anaphylactic shock, for localization and in vivo imaging of tumors as described above, for specific treatment of disease cells, e.g., site directed delivery of cytotoxins, immunomodulators or other pharmaceutically active molecules where local concentration of the active agent is an important factor, or the like, thereby establishing the practical utility of these humanized antibodies. As described above, for in vivo imaging, the humanized, CDR-grafted MN-14 monoclonal antibody is radiolabeled or conjugated with a metal chelator complexed with a radionuclide, e.g., iodine, ytrium, technetium, or the like, and radio-scanning techniques may be used to detect primary and metastatic CEA tumors. To that end, the radioactive antibody is injected, e.g., intravenously, and the patient scanned with a gamma imager at regular intervals. Tumors expressing CEA will take up more radioantibodies than other tissues and will be easily recognized by the imaging camera. Preferentially, monoclonal antibodies labelled with 131I are used in amounts of 3 to 10 μg representing 15 to 30 μCi per kg body weight. For therapy with cytotoxic agents, the antibodies are conjugated to any of a variety of known therapeutic agents such as doxorubicin, methotrexate, taxol, ricin A, radioactive atoms, cytoxic agents, and the like, formulating such conjugate in a pharmaceutically acceptable sterile vehicle, and administering the formulation by conventional means. The therapeutic dosages can be readily determined conventionally by the user of average skills in these arts. The therapeutic dose for mammals is between about 1 mg and 5 mg per kg body weight for the monoclonal antibodies themselves, and between 0.1 mg and 5 mg per kg body weight for conjugates with cytotoxic drugs, depending on the status of the patient and the mode of administration. Alternately, the humanized antibodies can be used in combination with components of the host's immune system, e.g., complement or cell mediated responses, in order to remove from the subject CEA-presenting cancer cells. The immune responses of patients may be monitored in accordance with the foregoing procedures. For additional procedures for radioimaging and therapy, see
EP 0 323,806, Hansen et al., Cancer 71: 3478-85 (1993), and U.S. Pat. No. 4,818,709 and references contained therein, all of which are incorporated by reference. - Preferred are pharmaceutical preparations for parenteral administration, such as are described in Remington's Pharmaceutical Sciences, Mack Publishing Co., Easton, Pa., 1989. The final preparations contain from 0.01% to 50% of active ingredients. Methods for the production of such conjugates and their use in diagnostics and therapeutics are provided in, for example, Shih et al., U.S. Pat. No. 5,057,313; Shih et al., Int. J. Cancer 41:832 (1988); copending, commonly owned U.S. Ser. No. 08/162,912, now U.S. Pat. No. 5,443,953; and, McKearn et al., U.S. Pat. No. 5,156,840, the contents of which are incorporated by reference.
- As noted above, for purposes of therapy, a humanized antibody conjugate and a pharmaceutically acceptable carrier are administered to a patient in a therapeutically effective amount. A combination of a conjugate and a pharmaceutically acceptable carrier is said to be administered in a “therapeutically effective amount” if the amount administered is physiologically significant. An agent is “physiologically significant” if its presence results in a detectable change in the physiology of a recipient patient. A targeted therapeutic agent is “therapeutically effective” if it delivers a higher proportion of the administered dose to the intended target than accretes at the target upon systemic administration of the equivalent untargeted agent.
- To be therapeutically effective the conjugate and carrier may need to be administered in combination with other therapeutic agents or as part of a broader treatment regimen. Physicians are currently of the opinion that the effectiveness of targeted therapeutics can often be greatly increased when used in a combination therapy approach. For example, high-dose radioimmunotherapy for B-cell lymphomas, which causes severe hematologic toxicity when used alone, has been shown to be highly effective when used in combination with autologous bone marrow reinfusion. Press et al., “Treatment of Relapsed B Cell Lymphomas with High Dose Radioimmunotherapy and Bone Marrow Transplantation” in CANCER THERAPY WITH RADIOLABELED ANTIBODIES, Goldenberg, ed. (CRC Press, Boca Raton, 1994) ch. 17. In another example a five-fold enhancement of tumor uptake of a radiolabeled antibody is observed when the tumor is preirradiated. Leichner et al., Int. J. Radiat. Oncol. Biol. Phys. 14:1033 (1987). Mechanisms which have been shown to have the potential for improving the clinical efficacy of radioimmunotherapy are also discussed in DeNardo et al., “Overview of Obstacles and Opportunities for Radioimmunotherapy of Cancer” in CANCER THERAPY WITH RADIOLABELED ANTIBODIES, Goldenberg, Ed. (CRC Press, Boca Raton, 1994) ch. 11. Methods of developing such combination protocols, as well as to investigate dose-limiting side effects and to potentiate and amplify targeting, uptake, and beneficial side effects, are well known to skilled clinical artisans in this field and would not require undue experimentation to develop.
- In vivo experiments using conjugates of the humanized MN-14 with diagnostic and therapeutic agents have been carried out with animal models and with human patients (see Example 11 below). The CDR-grafted humanized antibody conjugate exhibited a better therapeutic profile and could be used in longer treatment regimens than the parental MN-14 antibody conjugate. The CDR-grafted antibody conjugate provided a better therapeutic effect and fewer deleterious side effects than the control murine antibody conjugates.
- For example, the antibody was covalently complexed to aminodextran-conjugated methotrexate using the method described by Shih et al., above using carbohydrate hydroxyl groups for derivatization purposes. In order to determine the contribution of antibody carbohydrate groups on immunoactivity, a mutation can be introduced at position 18-20 in the VK FR1 region of hMN-14 (the prefix “h” is intended to mean “humanized”) so as to introduce a glycosylation site, NVT, prior to expression of the blocking gene in mammalian cells. Comparison of hMN-14 antibody with mutated hMN-14-NVT in a blocking cell binding assay (
FIG. 8 ) has demonstrated that the carbohydrate moiety at position 18 is without influence on immunoreactivity of this humanized antibody. - Aminodextran, average
molecular mass 40 kDa, is oxidized by NaIO4 to form aldehydes (by the oxidation of hydroxyl groups). About 50 to 150 moles of aldehydic groups are introduced per mole of aminodextran by careful control of the reaction conditions and timing. The aldehydes then are reacted with an excess of 1,3-diamino-2-hydroxypropane to form Schiff bases with virtually all of the aldehydes. The Schiff bases are then reduced by treatment with excess NaBH4. The amine-derivatized dextran then is purified by gel-exclusion chromatography. - The cytotoxic drug methotrexate (MTX) is activated by treatment with dicyclocarbodiamide, followed by reaction with N-hydroxysuccinimide, both in dimethylformamide. Activated MTX is mixed in a 50:1 ratio with the amino derivatized dextran in aqueous solution. The product provides, after purification, MTX-derivatized dextran having about 35 MTX moles per mole. The MTX adduct thus obtained is conjugated to a MN-14 CDR-grafted antibody using methods described in Shih, et al., supra. For example, the antibody carbohydrates are oxidized and the resultant aldehydes are reacted with the remaining amines on the dextran in the adduct. The Schiff-base product obtained thereby is reduced by treatment with sodium cyanoborohydride in 10-fold molar excess over antibody. The reduced antibody-dextran-MTX product is thoroughly purified prior to assay, and formulated for administration to patients.
- Parental MN-14 antibody is conjugated to dextran-MTX in the same way, as a control.
- The purified CDR-grafted antibody conjugate can be administered to patients with a CEA-producing cancer (see above). The response to therapy is monitored, including adverse side effects, particularly those which are mediated by the patient's immune systems. Patients treated with the CDR-grafted antibody conjugate show improved therapeutic results, decreased immune response to the agent and notably decreased immune-mediated adverse effects of therapy. Therapy with the CDR-grafted antibody conjugate can be carried out at higher dosages and for longer periods of time then with the parental murine MN-14 antibody, allowing more aggressive therapies and improved responses.
- The present invention is further described by reference to the following, illustrative examples. It will be appreciated that the techniques related to isolating DNA clones encoding MN-14 light and heavy chain genes are illustrated by cloning techniques useful to isolate light and heavy chain genes of any antibody from producing cells. There is no necessity, given the disclosed sequence, to reisolate MN-14 heavy and light chain genes to carry out the invention.
- It should be understood that the detailed description and the specific examples, while indicating preferred embodiments of the invention, are given by way of illustration only, since various changes and modifications within the spirit and scope of the invention will become apparent to those skilled in the art from the following illustrative description.
- A mouse/mouse hybridoma cell line producing Class III, anti-CEA monoclonal antibodies was established according to Hansen et al. (1993) above and Primus et al. (1983) above.
- Cells were selected for secretion of kappa IgG1 by testing conditioned medium using standard isotyping techniques. A variety of kits for this purpose are commercially available. Such cells were screened for production of antibody by testing conditioned medium using a standard blocking assay described above. Stocks of producer cells that proved out in the assay were expanded and frozen in liquid nitrogen.
- MN-14-producing cells were expanded in culture, collected by centrifugation and washed. Total RNA was isolated from the cells in the pellet according to Favaloro et al., Methods in Enzymology 65: 718 (1980) and Orlandi et al., Proc. Nat'l Acad. Sci., USA 86: 3833 (1989), which are incorporated by reference.
- mRNA from MN-14 producing cells was used to synthesize cDNA using standard techniques of cDNA synthesis and DNA amplification by PCR, as described below. In general, the primers used for PCR included a restriction endonuclease cleavage site at their 5′ ends to facilitate cloning of the amplification product. An oligonucleotide complementary to the end of the sense strand of the DNA encoding the first constant region domain of the murine IgG1 heavy chain (“CH1”) was used to prime first strand cDNA synthesis by reverse transcriptase. The sequence of this primer, CG1FOR, is shown in Table 1. Table 1 below provides other oligonucleotide sequences used herein.
TABLE 1 OLIGONUCLEOTIDE SEQUENCES SEQ. ID NO. CG1FOR 41 5′ GGAAGCTTAGACAGATGGGGGTGTCGTTTTG 3′VH1FOR 42 5′ TGAGGAGACGGTGACCGTGGTCCCTTGGCCCCAG 3′VH1BACK 43 5′ AGGTSMARCTGCAGSAGTCWGG 3′SH1BACK 44 5′ TGGAATTCATGGRATGGAGCTGGRTCWTBHTCTT 3′SH2BACK 45 5′ TGGAATTCATGRACTTCDGGYTCAACTKRRTTT CK2FOR 46 5′ GGAAGCTTGAAGATGGATACAGTTGGTGCAGC 3′VK1FOR 47 5′ GTTAGATCTCCAGCTTGGTCCC 3′VK3FOR 48 5′ GTTAGATCTCCAGTTTGGTGCCT 3′VK1BACK 49 5′ GACATTCAGCTGACCCAGTCTCCA 3′VK2BACK 50 5′ GACRTTCAGCTGACCCAGGMTGMA 3′VK3BACK 51 5′ GACATTCAGCTGACCCA 3′VK4BACK 52 5′ GACATTGAGCTCACCCAGTCTCCA 3′VK5BACK 53 5′ TTGAATTCGGTGCCAGAKCWSAHATYGTKATG 3′VK6BACK 54 5′ TTGAATTCGGTGCCAGAKCWSAHATYGTKCTC 3′VK7BACK 55 5′ TTGAATTCGGAGCTGATGGGAACATTGTAATG 3′VK8BACK 56 5′ CWGAGAAATTCAGCTGACCCAGTCTC 3′ - Restriction sites incorporated in primers to facilitate cloning are underlined.
- The variable region of the heavy chain (“VH”) cDNA then was amplified by the PCR using the same primer, CG1FOR, and a primer based on the consensus sequence of the 5′ end of VH genes (VH1BACK), as described in Orlandi et al. (1989) cited above. The PCR product of this reaction was analyzed by agarose gel electrophoresis, which, upon ethidium bromide staining and fluorescence illumination, revealed one major band of about 400 bp, as expected.
- For confirmatory sequences from a second cDNA preparation, signal sequence primers were used in the PCR to allow determination of the authentic amino acids of the N-terminus. SH1BACK and SH2BACK, degenerate oligonucleotides based on heavy chain signal sequence coding regions, were used in separate reactions in concert with CG1FOR. A diffuse product band was obtained from CG1FOR, SH1BACK amplification.
- In order to increase the VH content of the product it was excised from low melting point agarose and amplified using SH1BACK and an oligonucleotide complementary to a fourth framework region consensus sequence, VH1FOR. This product of this reaction was a discrete band when analyzed by agarose gel electrophoresis.
- The amplification product obtained using the CG1FOR, VH1BACK primer pair was digested with HindIII and PstI separately. The cleavage sites of these enzymes are included in the PCR primers. It was preferable to determine whether there were also sites internal to the VH. Agarose gel analysis of the restriction fragments indicated the presence of an internal PstI site close to one end of the DNA. The PCR product was digested with HindIII and PstI, cloned into M13mp18 and 19 and the DNA sequence of the inserts of representative clones determined. The majority of the clones contained inserts of the same VH DNA.
- The sequencing confirmed the presence of this additional, unexpected PstI site, which was close to the 3′ end of the sequence of the CG1FOR primer partially encoding the final two amino acids of the VH. Although several full length VH clones were obtained by this method, further PCR product DNA was cloned as PstI-PstI fragments. These clones thus contained full VH sequences but none of the constant region given by CG1FOR. A total of 16 full-length clones were obtained from the VK1BACK, CG1FOR product. In these experiments about 25% of the clones that were analyzed contained inserts unrelated to the VH region.
- In order to confirm the VH sequence from a second cDNA preparation and, at the same time, to obtain the authentic, rather than primer-dictated, DNA sequence corresponding to the N-terminus of the VH, the PCR product from VH1FOR and SH1BACK primers was cloned. These primers contain BstEII and EcoR1 restriction sites, rather than the PstI and HindIII sites of CG1FOR and VH1BACK described above. The PCR product of this reaction was cloned by digesting with BstEII, filling in the BstEII ends, digesting with EcoRI, and ligating the EcoRI and blunt ends to the vector, which had been digested with EcoRI and HindIII. The sequences of the cloned fragments were determined. The yield of VH fragments was relatively low, perhaps reflecting a lack of specificity in the PCR caused by degeneracy of SH1BACK. However, four of the 18 clones that were sequenced contained DNA encoding the MN-14 VH region as previously sequenced. The other inserts did not derive from VH-encoding DNA.
- In all, 20 full-length MN-14 VH clones were obtained. Five transition mutations were observed amongst the sequences in the MN-14 VH region clones. These mutations are likely to have been introduced during amplification as a result of misincorporation by Taq polymerase.
- The amino acid sequence of murine MN-14 heavy chain variable region, translated from the VH DNA sequence, is shown in
FIGS. 1A and 1B (SEQ. ID. NOS. 1 and 2). Comparison of this sequence with sequences representing the murine VH subgroups indicated that the variable heavy region of MN-14 belongs to subgroup IIIB (see, Kabat et al. SEQUENCES OF PROTEINS OF IMMUNOLOGICAL INTEREST, U.S. Government Printing Office, 1987). - The MN-14 CDR sequences are different from any of those reported by Kabat et al. (1987), supra. Furthermore, the amino acids at four positions in the MN-14 heavy chain VH framework regions are different from those in the framework regions of other subgroup IIIB VH sequences. These four substitutions (Ser 14,
Thr 30,Ser 98 and Pro 108) have been observed in other murine VH regions outside the IIIB VH subgroup, however, with the proline in Kabat position 108 being the most unusual. - Any unusual residues in the VH or VK may represent somatic mutations which proved advantageous to the binding of murine MN-14.
- cDNA encoding the kappa light chain of MN-14 was cloned in much the same fashion as the cDNA encoding the variable region of the heavy chain, as described above. Several primers were used to prime reverse transcriptase for synthesis of the first strand of the kappa chain cDNA. The sequence of one primer, CK2FOR, was derived from the sequence of the 5′ end of the constant region of kappa light chain genes (“CK”). The sequences of two other primers, VK1FOR and VK3FOR, were based on the sequence of the 3′ end of the variable region of kappa light chain genes (“VK”).
- The first strand DNA product was amplified by PCR using a number of primer pairs. Synthesis in one direction was primed by the primers used to make the first strand. Polymerization in the other, “backward,” direction initiated from a series of kappa light chain-specific primers which had sequences based on either the sequence at the 5′ end of the VK region, VK1BACK, VK2BACK, VK3BACK, VK4BACK and VK8BACK, or the sequence encoding the last four amino acids of the signal peptide and the first four amino acids of the variable region, VK5BACK, VK6BACK and VK7BACK. In addition, cDNA primed by CK2FOR also was amplified using VK1FOR and VK8BACK.
- The amplification products were analyzed by gel electrophoresis in the manner described in the Examples above. The products from the reactions primed by VK1BACK, VK3BACK, VK5BACK, VK7BACK and VK8BACK gave rise to the expected 350 bp band.
- Selected PCR products were cloned into M13mp18 and 19 using the restriction sites included in the amplification primers in a manner similar to that described for VH in Example 4 above. Nucleotide sequencing revealed that most inserts were not VK-related. This is not uncommon when attempting to clone VK cDNAs and it appears to be more difficult to design VK-specific primers than VH specific primers.
- From the VK1FOR/VK8BACK combination, a VK cDNA insert was obtained, but this did not yield a functional VK due to a frameshift within the cDNA encoding CDRL3 and absence of the invariant Cys at position 23. This VK cDNA has been isolated from other hybridoma cells and it is derived from the Sp2/0 fusion partner. CK2FOR/VK1BACK product yielded a further four different aberrant VK cDNA inserts, in this case lacking the conserved residues of
framework 4. A fifth VK insert obtained using this primer pair was that of a functional VK with the exception of a frameshift at the 3′end of VK1BACK, a phenomenon apparently due to mismatch-induced slippage of the primer. This problem may be avoided by the use of VK8BACK which does not extend as far into the VK gene. However, analysis of further clones from VK1FOR/VK8BACK product did not yield the desired insert. - In order to amplify preferentially the putative VK, VK3FOR was designed from its genuine fourth framework sequence, and synthesized as an alternative to VK1FOR. This strategy proved successful when amplification of VK3FOR-primed cDNA with VK3FOR and VK8BACK yielded 4 clones containing the desired VK.
- The DNA and amino acid sequence of the murine MN-14 kappa light chain variable region is set out in
FIGS. 2A and 2B (SEQUENCE ID. NOS. 3 and 4). This MN-14 VK can be placed in Kabat's VK subgroup V. Only 3 residues in the MN-14 VK framework regions (Met 10,Val 66 and Thr 76) do not appear in other members of this subgroup. Met 10 andVal 66 are the most unusual of the three. They are not found in any murine VK listed in Kabat. None of the MN-14 VK CDRs are previosuly-reported sequences in Kabat. - In the production of a chimeric antibody consisting of murine variable regions and human constant regions, testing alongside the parent mouse antibody served to check that the correct variable region cDNAs have been isolated. A successful chimeric antibody also acts as a useful control when assessing the binding of humanized versions. The scheme used in cloning the variable regions for expression is described by Orlandi et al. (1989) supra, and is illustrated in
FIGS. 3 and 4 . - VH DNA was amplified from the M13 clone MNVH41 using the PCR with oligonucleotides VH1BACK and VH1FOR. The PstI and BstEII restriction sites in the primers allowed the VH to be inserted into M13VHPCR1 in the correct context for expression. At this point, the internal BamHI restriction site of the VH was removed by site directed mutagenesis. The reaction product, which encompassed the entire HindIII-BamHI fragment of M13VHPCR1 was cloned into pSVgpt and the VH sequence confirmed.
- The human IgG1 constant region gene, published by Takahashi et al., Cell, 29: 671-679 (1962) above then was added to the construct as a BamHI fragment, which yielded the vector referred to as pSVgptMN14MuVHHuIgG1.
- VK DNA was similarly obtained from the M13 clone MNVK154 by PCR amplification with the primers VK8BACK and VK3FOR and the PvuII, BglII-digested product cloned into M13VKPCR1, whereupon the sequence of the variable region was checked. The HindIII-BamHI fragment was excised from RF DNA and transferred to the plasmid pSVhyg. The construct already contains a human kappa constant region gene as described in Hieter et al., Cell, 22: 197-207 (1980). The final vector thus obtained was designated pSVhygMN14MuVKHuCK.
- The HindIII-BamHI fragment of M13KLHuVHAIGA was inserted into a plasmid pSVgpt to yield the expression vector pSVgptKLHuAIGAHuIgG1. Similarly, the HindIII-BamHI fragment of M13HuVK was inserted into the plasmid pSVhyg to yield the expression vector pSVhygMN14REIHuVKHuCK. About 5 μg pSVgptMN14MuVHHuIgG1 and 10 μg pSVhygMN14MuVKHuCK DNAs were linearized with Pvul and transferred into about 107 subconfluent SP2/0 myeloma cells by electroporation conventionally using a BioRad Model 165BR1160 Gene Pulser Electroporator with a single pulse of 170 V, 960° F. Cells were selected for the expression of the gpt gene in 24-well plates by addition of mycophenolic acid and xanthine to the DMEM+10% FCS growth medium.
- Wells which contained colonies of surviving cells were identified. The supernatant medium was removed from these wells and assayed for human antibody. Colonies that secreted antibodies were expanded to give 0.5 L of conditioned medium for isolation of larger amounts of antibody.
- Antibody was purified conventionally from the medium by protein-A agarose affinity chromatography, initially. The purified antibody was characterized further with reference to native MN-14 antibody, human antibodies and other controls.
- The antibody was also characterized by its reaction profile in a MN-14 blocking assay, which provided an informative comparison of CEA binding affinities of the hybrid antibodies with CEA binding by the MN-14 murine antibody which served as a positive control.
- The human NEWM VH, KOL VH and REI VK frameworks were chosen as the basis for reshaping the antibody, as they are likely to be tolerated in humans. Alignments of the MN-14 VH (SEQ. ID NO. 2) and VK (SEQ. ID NO. 4) with these human variable regions are shown in
FIGS. 5A and 5B (SEQ. ID. NOS. 5-7). - A. NEWM Based Humanization.
- The starting points for the introduction of MN-14 CDRs are DNAs encoding the required FRs and irrelevant CDRs. These template variable regions are in a form compatable with the expression vectors used, that is, within HindIII-BamHI fragments, that also include promotor regions, signal peptide and intron DNA (
FIGS. 3 and 4 ). For the NEWM VH version, the template is M13VHPCR1 (Orlandi et al, above, and section 8.3 below). A derivative of this template, containing KOL FRs and irrelevant CDRs, was used to generate the KOL coding region. A derivative of M13VKPCR1 (Orlandi et al. above) was used in the creation of the HuVK vector. The resulting vectors were termed M13NMHuVH, M13KLHuVH and M13HuVK. The HindIII-BamHI fragments containing the humanized MN-14 variable region DNAs were transferred from these M13 vectors to the expression vectors essentially as described for the construction of the chimeric MN-14 expression vectors in Example 8.1. - The NEWM FR is described in Poljak et al. Biochemistry 16: 3412-20 (1977). Construction of a hMN-14 with an affinity for CEA comparable to that of its murine counterpart was achieved in a stepwise approach. Production of the chimeric antibody provided a useful control when assessing the binding of the humanized versions. The human NEWM VH and REI VK frameworks were initially chosen as the basis for reshaping the antibody as they are known to be tolerated in man. MN-14 residues Phe27, Asp28 and Thr30 were retained because, although not part of the Kabat's hypervariable region, CDR1 residues 31-35, those amino acids are part of the CDR1 structural loop (Chothia et al., J. Mol. Biol. 176: 901-917 (1987)). In addition, the following residues were also selected for incorporation into the humanized VH for the following reasons: Ala24, this residue contacts CDR1; Arg71, the side chain of this residue pokes through the center of the domain to interact with
CDRs (i) Gln77Phe78Ser79 to ThrLeuTyr (NMHuVhHTLY, SEQ. ID NO. 9) (ii) Ser82Thr83Ala84Ala85 to LysArgSerGlu (NMHuVhHKRSE, SEQ. ID NO. 10) (iii) Arg66Val67Thr68Met69Leu70 to LysPhelleValSer (NMHuVhKFIVS, SEQ. ID NO. 11) - The alignment of the different versions of the NEWM VH frameworks (SEQ. ID NOS. 5 and 8-11) with the MN-14 VH (SEQ. ID NO. 2) is shown in
FIGS. 6A, 6B , and 6C. Each of these versions has been paired with the same HuVK. The inclusion of either the TLY or KFIVS motifs gave about a two-fold improvement. - There are 2 differences from the NEWN framework sequences given in Kabat et. al (1987) above: S107 to T and L108 to T. Kabat lists
residue 1 as PCA and residues 5 and 6 as E or Q. - B. KOL Based Humanization.
- In parallel to the use of NEWM VH, we have also reshaped the human KOL VH. KOL VH is described in Schmidt et al., Z. physiol. Chem, 364: 713-747 (1987). The FR used for humanizing the antibody is as given in Kabat. The original version of the KOL-based VH contained the MN-14 CDRs, as defined in terms of residue variability (Kabat et al., above) and three additional murine residues. As with the NEWM VH, two of these substitutions were made because the actual peptide CDR1 structural loop, which extends from the β-sheet framework, consists of residues 25 to 32 (Chothia et al. 1987, above). Changes at
positions 28 and 30 allowed this loop to be transplanted as a whole from the murine antibody. MN-14residue 94 was included because the Arg residue of the KOL VH is involved in a salt bridge withAsp 110 and, like with the NEWM VH, it was felt that retention ofArg 94 might perturb the MN-14 CDR3 structure. The side-chain ofresidue 94 may also interact with residues of CDR1. Other changes made to this basis MN-14 KOLHuVH (SEQ. ID NO. 12) were as follows:(i) Ser24 to Ala24 and Val48Ala49 to IleGly (KLHuVhAIG, SEQ. ID NO. 13). (ii) Ser24 to Ala24, Val48Ala49 to IleGly and Ser74 to Ala (KLHuVhAIGA, SEQ. ID NO. 14). (iii) Ser 24 to Ala24, VAl48Ala49 to IleGly, Ser74to Ala and Phe79 to Tyr (KLHuVhAIGAY, SEQ. ID NO. 15).
Mutation Rationale - Ala24—The loop of CDR1 is anchored by the penetration of the side chain of residue 29 into the framework.
Residue 24 is one of those with which it interacts (Chothia et al., J. Mol. Biol. 227: 799-817 (1992)). - Ile48Gly49—Although both these residues are adjacent to the CDR2 hypervariable region they are far removed from the actual structural loop. Both residues are completely buried (Padlan, Mol. Immunolog. 28: 489-498, 1991) and it was considered possible that these would effect binding via their packing interaction.
- Ala74—This residue is part of the fourth loop found at the VH antigen-binding surface and its side chain is almost completely exposed to solvent (Padlan, 1991 above). Direct interaction of this residue with antigen could be envisaged.
- Tyr79—Like
residue 74, this residue is close to the antigen-binding site and could effect binding. - The alignment of the different versions of KOL VH frameworks (SEQ. ID NOS. 7 and 12-15) with NEWM based versions (SEQ. ID NOS. 5 and 8-11) and the murine MN14 (SEQ. ID NO. 2) is shown in
FIGS. 6A, 6B , and 6C. - The DNA sequences and translation products of MN14HuVH and MN14HuVL are shown in
FIGS. 7 and 8 , 0respectively (SEQ. ID NOS. 16-19, respectively). - The humanized KLHuVH varients, such as antibody KLHuVHAIGA/HuVK, were purified and tested in a blocking assay carried out as follows. Antibodies were added at the indicated concentrations together with HRP-labeled MN-14 to a final volume of 0.1 ml. Following 30 mins. of incubation at 371C, and washing to remove unbound antibodies, the relative affinities of the antibodies were determined from the remaining bound peroxidase activity. A shown by the assay data of
FIG. 9 , the activity of the “reshaped” (i.e., CDR-engrafted on FR) humanized antibody was similar to that of chimeric and murine positive controls. - Results obtained using supernatant fluids from cells secreting KLHuVHAIG/HuVK and KLHuVHAIGAY/HuVK antibodies suggests that these have blocking activities that are similar to that of the KLHuVHAIGA/HuVK antibody.
- C. REI Based Humanization
- REI VL is described in Epp et al., Eur. J. Biochem., 45: 513-24 (1974). No change4s were made in REI framework to improve binding. The changes from the sequences given in Kabat et al. (1987) are: M4 to L; T39 to K: Y71 to F; L104 to V; Q105 to E: and T107 to K. These changes preexisted in the template used when grafting the MN-14 CDRs and were not made specifically to improve binding. The M4 to L change incorporates a restriction site but the remaining differences eliminate unusual residues in the REI framework. A similar framework has been referred to as a consensus of huma kappa subgroup I by Foote et al., J. Mol. Biol. 224: 487-9 (1992).
- Cells that were stably transformed for expression of the MN-14 CDR-grafted human antibodies were selected in the manner described above and cloned out to establish individual producer lines. Each of the lines was assayed to determine production of the correct antibody and to assess the efficiency of production. The antibody class was determined and the anti-CEA binding affinity assessed.
- The best producers were further characterized for the overall amount of the antibody produced and, for the best of these, sequences were obtained from the mRNA to insure that the mutation has not occurred in the antibody genes during transfection, integration, propagation or selection.
- The best producer lines of the MN-14 CDR-grafted human antibody were cultured, the growth medium collected and filtered through a 0.2 micron membrane. The antibody was then purified by protein A chromatography followed by other conventional purification steps such as ion exchange and size exclusion chromatography. The cells were pelleted and from the supernatant by conventional centrifugation. The antibody was purified from the supernatant fluid as described above.
- A. Animal Studies
- The biodistribution of labeled humanized MN-14 IgG in nude mice bearing human colon cancer was determined. For radiolocalization studies, at 4-5 weeks female athymic mice (nu/nu, Harlan, Indianapolis, Ind.) were given s.c. 0.2 ml of a 10% suspension of LS174T human colon adenocarcinoma prepared from a xenograft serially propagated in an athymic mouse (Sharkey et al., Cancer Res., 50: 828-34 (1990)). After waiting 2 weeks for tumor development, the mice were injected i.v. with 20 μCi (about 2 μg) of 131-labelled humanized MN-14 monoclonal antibodies. Groups of 4-5 mice were sacrificed at intervals thereafter, and radioactivity localized in tissues according to Sharkey et al., above. The data of Table 2 show the % injected dose/g tissue and tumor:nontumor ratios.
- The results show excellent tumor accretion of the antibody, with maximum accretion occuring within 2 days. Blood clearance of the hMN-14 antibody was more rapid than the parental mMN-14 antibody. In addition, there was higher uptake of hMN-14 by the spleen than there was of mMN-14, reflecting the fact that the former antibody is “foreign” to the mouse. Tumor:nontumor ratios were excellent. These results demonstrate that the inventive hMN-14 mAb is capable of targeting CEA-producing tumors.
TABLE 2 Time Post-Injection 131I-hMN-14 IgG Tissue 4 hour 1 day 2 days 5 days 7 days 14 days Percent Injected Dose Per Gram Tissue (N = 4 to 5 animals) LS174T 11.8 ± 2.9 18.1 ± 14.9 32.6 ± 17.2 30.2 ± 13.4 10.6 ± 15.2 11.6 ± 5.6 Weight 0.31 ± 0.07 0.37 ± 0.02 0.27 ± 0.08 0.31 ± 0.9 0.3 ± 0.2 0.40 ± 0.07 Liver 10.8 ± 2.1 6.0 ± 3.3 2.8 ± 0.5 0.8 ± 0.4 0.5 ± 0.7 0.08 ± 0.05 Spleen 17.0 ± 4.8 10.5 ± 8.8 4.9 ± 0.4 1.3 ± 0.6 0.6 ± 0.8 0.14 ± 0.09 Kidney 7.0 ± 0.8 3.1 ± 0.7 2.3 ± 0.9 0.9 ± 0.4 0.4 ± 0.6 0.07 ± 0.04 Lungs 8.7 ± 0.4 3.7 ± 1.4 3.7 ± 1.4 1.4 ± 0.6 0.6 ± 1.0 0.11 ± 0.06 Blood 15.4 ± 6.6 5.5 ± 4.7 6.8 ± 4.1 2.3 ± 1.2 0.9 ± 1.8 0.14 ± 0.13 Tumor (LS174T)/Nontumor Ratios (N = 4 to 5 amimals) Liver 1.1 ± 0.3 5.0 ± 5.0 11.1 ± 4.7 39.5 ± 7.5 24.6 ± 4.8 160 ± 28 Spleen 0.7 ± 0.3 4.2 ± 4.6 6.6 ± 3.4 24.7 ± 7.8 15.8 ± 4.4 91 ± 21 Kidney 1.7 ± 0.5 5.3 ± 3.5 13.3 ± 3.6 36.1 ± 4.0 38.4 ± 12.9 173 ± 41 Lungs 1.4 ± 0.4 4.2 ± 2.2 8.2 ± 2.1 22.3 ± 2.1 25.4 ± 7.3 112 ± 15 Blood 0.9 ± 0.5 3.7 ± 0.9 5.4 ± 1.4 14.2 ± 2.9 26.0 ± 12.9 111 ± 35 - Patients were entered into an Institutional Review Board-approved protocol at the Center for Molecular Medicine and Immunology, Newark, N.J. for a pilot investigation of the targeting and pharmacokinetic behavior of the humanized MN-14 IgG. In the case the results of which are shown in
FIG. 12 , the male patient had colorectal cancer that had metastasized to the liver. He was injected i.v. with 131I-hMN-14 IgG (8 mCi, 0.6 mg antibody) and images were taken over a six day period. The patient was subsequently injected with an identical dose of mMN-14 IgG. The images shown inFIG. 12 shaw the anterior abdominal view about 140 h after each injection. The images are adjusted to exactly the same intensity so that they are directly comparable. The results indicate that the humanized antibody is taken up by the CEA-producing tumor as well as the parental murine antibody. These experiments establish the practical utility of diagnosing human CEA-producing colon cancers with the inventive humanized MN-14 mAb.
Claims (61)
1. A method for treating a patient comprising administering a humanized Class III, anti-CEA, monoclonal antibody (mAb) to said patient in an effective amount for treatment.
2. The method of claim 1 , wherein the constant regions of said mAb are from a human IgG1 antibody.
3. The method of claim 1 , wherein said mAb comprises a complementarity-determining region (CDR) selected from the group consisting of KASQDVGTSVA (SEQ ID NO:20), WTSTRHT (SEQ ID NO:21), QQYSLYRS (SEQ ID NO:22), TYWMS (SEQ.ID NO:23), EIHPDSSTINYAPSLKD (SEQ ID NO:24), LYFGFPWFAY (SEQ ID NO:25), and a combination thereof, wherein said mAb is unreactive with meconium antigen by enzyme immunoassay.
4. The method of claim 3 , wherein said mAb retains the binding specificity of a parental murine Class III, anti-CEA mAb which comprises said CDRs.
5. The method of claim 1 , wherein said treatment comprises administering said mAb to patients with a CEA-producing cancer.
6. The method of claim 5 , wherein said CEA-producing cancer is selected from the group consisting of colon cancer, breast cancer and lung cancer.
7. The method of claim 1 , wherein said mAb further comprises framework regions (FRs) of light and heavy chain variable regions from a human antibody.
8. The method of claim 1 , wherein said mAb further comprises framework regions (FRs) in the light and heavy chain variable regions, wherein each FR is separately a FR of a human antibody.
9. The method of claim 8 , wherein each of said light and heavy chain variable regions chains comprise FRs from at least two human antibodies.
10. The method of claim 7 , wherein the light chain variable region comprises a framework region (FR) selected from the group consisting of DIQLTQSPSSLSASVGDRVTITC (SEQ ID NO:26); WYQQKPGKAPKLLIY (SEQ ID NO:27); GVP(S or D)RFSGS(G or V) SGTDFTFTISSLQPEDIATYYC (SEQ ID NO:28); FGQGTKVEIK (SEQ ID NO:29) or a combination thereof; and the heavy chain variable region comprises a framework region (FR) selected from the group consisting of EVQLVESGGGVVQPG RSLRLSCSSSGFDFT (SEQ ID NO:30), EVQLVESGGG VVQPGRSLRLSCSASGFDFT (SEQ ID NO:31); WVRQAPGKGLEWVA (SEQ ID NO:33); RFTIS RDNSKNTLFLQMDSLRPEDTGVYFCAS (SEQ ID NO:36), RFTISRDNAKNTLFLQMDSLRPEDTGVYFCAS (SEQ ID NO:37); WGQGTPVTVSS (SEQ ID NO:39); and a combination thereof; and
wherein C may be in the sulfhydryl or disulfide form.
11. The method of claim 10 , wherein the light chain and heavy chain variable regions comprise FRs comprising:
and wherein C may be in the sulfhydryl or disulfide form.
12. A method for treating a patient comprising administering a conjugate to said patient in an effective amount for treatment, wherein said conjugate comprises:
a therapeutic agent bound to a humanized Class III, anti-CEA, monoclonal antibody (mAb) or a fragment thereof, wherein said mAb or fragment thereof comprises a complementarity-determining region (CDR) selected from the group consisting of KASQDVGTSVA (SEQ ID NO:20), WTSTRHT (SEQ ID NO:21), QQYSLYRS (SEQ ID NO:22), TYWMS (SEQ.ID NO:23), EIHPDSSTINYAPSLKD (SEQ ID NO:24), LYFGFPWFAY (SEQ ID NO:25), and a combination thereof, wherein said mAb is unreactive with meconium antigen by enzyme immunoassay.
13. The method of claim 12 , wherein said mAb retains the binding specificity of a parental murine Class III, anti-CEA mAb which comprises said CDRs.
14. The method of claim 12 , wherein said therapeutic agent comprises a cytotoxic agent or an immunomodulator.
15. The method of claim 14 , wherein said cytotoxic agent comprises doxorubicin, methotrexate, taxol, ricin A or a radionuclide.
16. The method of claim 15 , wherein said radionuclide comprises 131I.
17. The method of claim 12 , further comprising administering a second therapeutic agent to said patient.
18. The method of claim 17 , wherein said second therapeutic agent is doxorubicin, methotrexate, taxol, ricin A, or a radionuclide.
19. The method of claim 14 , wherein said cytotoxic agent is a radionuclide, and said method further comprises administering a second therapeutic agent or performing a treatment regimen to said patient.
20. The method of claim 19 , wherein said treatment regimen is a bone marrow reinfusion.
21. The method of claim 19 , wherein said radionuclide is 131I.
22. The method of claim 12 , wherein said mAb retains the binding specificity of a parental murine Class III, anti-CEA mAb which comprises said CDRs.
23. The method of claim 12 , wherein said treatment comprises administering said conjugate to a patient with a CEA-producing cancer.
24. The method of claim 23 , wherein said CEA-producing cancer is selected from the group consisting of colon cancer, breast cancer and lung cancer.
25. The method of claim 12 , said mAb or fragment thereof further comprises framework regions (FRs) of light and heavy chain variable regions from a human antibody.
26. The method of claim 12 , wherein said mAb further comprises framework regions (FRs) in the light and heavy chain variable regions, wherein each FR is separately a FR of a human antibody.
27. The method of claim 26 , wherein each of said light and heavy chain variable regions chains comprise FRs from at least two human antibodies.
28. The method of claim 25 , wherein the light chain variable region comprises a framework region (FR) selected from the group consisting of DIQLTQSPSSLSASVGDRVTITC (SEQ ID NO:26); WYQQKPGKAPKLLIY (SEQ ID NO:27); GVP(S or D)RFSGS(G or V) SGTDFTFTISSLQPEDIATYYC (SEQ ID NO:28); FGQGTKVEIK (SEQ ID NO:29) and a combination thereof; and the heavy chain variable region comprises a framework region (FR) selected from the group consisting of EVQLVESGGGVVQPG RSLRLSCSSSGFDFT (SEQ ID NO:30), EVQLVESGGG VVQPGRSLRLSCSASGFDFT (SEQ ID NO:31); WVRQAPGKGLEWVA (SEQ ID NO:33); RFTIS RDNSKNTLFLQMDSLRPEDTGVYFCAS (SEQ ID NO:36), RFTISRDNAKNTLFLQMDSLRPEDTGVYFCAS (SEQ ID NO:37); WGQGTPVTVSS (SEQ ID NO:39); and a combination thereof; and
wherein C may be in the sulfhydryl or disulfide form.
29. The method of claim 28 , wherein the light chain and heavy chain variable regions comprise FRs comprising:
and wherein C may be in the sulfhydryl or disulfide form.
30. A method for diagnosing a patient comprising administering a conjugate to said patient in an effective amount for diagnosis, wherein said conjugate comprises:
a diagnostic agent bound to a humanized Class III, anti-CEA, monoclonal antibody (mAb) or a fragment thereof, wherein said mAb or fragment thereof comprises a complementarity-determining region (CDR) selected from the group consisting of KASQDVGTSVA (SEQ ID NO:20), WTSTRHT (SEQ ID NO:21), QQYSLYRS (SEQ ID NO:22), TYWMS (SEQ.ID NO:23), EIHPDSSTINYAPSLKD (SEQ ID NO:24), LYFGFPWFAY (SEQ ID NO:25), and a combination thereof, wherein said mAb is unreactive with meconium antigen by enzyme immunoassay.
31. The method of claim 30 , wherein said mAb retains the binding specificity of a parental murine Class III, anti-CEA mAb which comprises said CDRs.
32. The method of claim 30 , wherein said diagnostic agent comprises an imaging agent.
33. The method of claim 32 , wherein said imaging agent is a radionuclide or a metal chelator complexed radionuclide.
34. The method of claim 33 , wherein said radionuclide is iodine, yttrium or technetium.
35. The method of claim 34 , wherein said radionuclide is 131I.
36. The method of claim 30 , wherein said diagnosis comprises administering said conjugate to a patient with a CEA-producing cancer.
37. The method of claim 36 , wherein said CEA-producing cancer is selected from the group consisting of colon cancer, breast cancer and lung cancer.
38. The method of claim 30 , said mAb or fragment thereof further comprises framework regions (FRs) of light and heavy chain variable regions from a human antibody.
39. The method of claim 30 , wherein said mAb further comprises framework regions (FRs) in the light and heavy chain variable regions, wherein each FR is separately a FR of a human antibody.
40. The method of claim 39 , wherein each of said light and heavy chain variable regions chains comprise FRs from at least two human antibodies.
41. The method of claim 38 , wherein the light chain variable region comprises a framework region (FR) selected from the group consisting of DIQLTQSPSSLSASVGDRVTITC (SEQ ID NO:26); WYQQKPGKAPKLLIY (SEQ ID NO:27); GVP(S or D)RFSGS(G or V) SGTDFTFTISSLQPEDIATYYC (SEQ ID NO:28); FGQGTKVEIK (SEQ ID NO:29) and a combination thereof; and the heavy chain variable region comprises a framework region (FR) selected from the group consisting of EVQLVESGGGVVQPG RSLRLSCSSSGFDFT (SEQ ID NO:30), EVQLVESGGG VVQPGRSLRLSCSASGFDFT (SEQ ID NO:31); WVRQAPGKGLEWVA (SEQ ID NO:33); RFTIS RDNSKNTLFLQMDSLRPEDTGVYFCAS (SEQ ID NO:36), RFTISRDNAKNTLFLQMDSLRPEDTGVYFCAS (SEQ ID NO:37); WGQGTPVTVSS (SEQ ID NO:39); and a combination thereof; and
wherein C may be in the sulfhydryl or disulfide form.
42. The method of claim 41 , wherein the light chain and heavy chain variable regions comprise FRs comprising:
and wherein C may be in the sulfhydryl or disulfide form.
43. A Class III, anti-CEA monoclonal antibody (mAb) or antigen-binding fragment thereof comprising a complementarity-determining region (CDR) selected from the group consisting of KASQDVGTSVA (SEQ ID NO:20), WTSTRHT (SEQ ID NO:21), QQYSLYRS (SEQ ID NO:22), TYWMS (SEQ.ID NO:23), EIHPDSSTINYAPSLKD (SEQ ID NO:24), LYFGFPWFAY (SEQ ID NO:25), and a combination thereof, wherein said mAb is unreactive with meconium antigen by enzyme immunoassay.
44. The mAb or fragment thereof of claim 43 , wherein said mAb retains the binding specificity of a parental murine Class III, anti-CEA mAb which comprises said CDRs.
45. The mAb or fragment thereof of claim 44 , wherein the light chain variable region of said mAb or fragment thereof comprises CDRL1 comprising KASQDVGTSVA (SEQ ID NO:20), CDRL2 comprising WTSTRHT (SEQ ID NO:21), and CDRL3 comprising QQYSLYRS (SEQ ID NO:22), and the heavy chain variable region of said mAb or fragment thereof comprises CDRH1 comprising TYWMS (SEQ.ID NO:23), CDRH2 comprising EIHPDSSTINYAPSLKD (SEQ ID NO:24) and CDRH3 comprising LYFGFPWFAY (SEQ ID NO:25).
46. The mAb of claim 45 , said mAb or fragment thereof is a humanized Class III, anti-CEA mAb and further comprises framework regions (FRs) of light and heavy chain variable regions from a human antibody.
47. The mAb of claim 46 , wherein:
FRL1-CDRL1-FRL2-CDRL2-FRL3-CDRL3-FRL4,
FRH1—CDRH1—FRH2-CDRH2—FRH3-CDRH3—FRH4,
(a) the light chain variable regions are characterized by the formula:
FRL1-CDRL1-FRL2-CDRL2-FRL3-CDRL3-FRL4,
wherein each FR is a different framework region of a human antibody, and
FRL1 comprises a region of about 23 amino acids that occurs naturally in the FRL1 of a human antibody;
FRL2 comprises a region of about 15 amino acids that occurs naturally in the FRL2 of a human antibody;
FRL3 comprises a region of about 32 amino acids that occurs naturally in the FRL3 of a human antibody;
FRL4 comprises a region of about 10 amino acids that occurs naturally in the FRL4 of a human antibody; and
(b) the heavy chain variable regions are characterized by the formula:
FRH1—CDRH1—FRH2-CDRH2—FRH3-CDRH3—FRH4,
wherein each FR is a different framework region of a human antibody, and
FRH1 comprises a region of 28-32 amino acids that occurs naturally in the FRH1 of a human antibody;
FRH2 comprises a region of 12-16 amino acids that occurs naturally in the FRH2 of a human antibody;
FRH3 comprises a region of 30-34 amino acids that occurs naturally in the FRH3 of a human antibody; and
FRH4 comprises a region of 9-13 amino acids that occurs naturally in the FRH4 of a human antibody.
48. The mAb of claim 47 , wherein
49. A humanized Class III, anti-CEA mAb comprising framework regions (FRs) of light and heavy chain variable regions from a human antibody, wherein the light chain variable region comprises a framework region (FR) selected from the group consisting of DIQLTQSPSSLSASVGDRVTITC (SEQ ID NO:26); WYQQKPGKAPKLLIY (SEQ ID NO:27); GVP(S or D)RFSGS(G or V) SGTDFTFTISSLQPEDIATYYC (SEQ ID NO:28); FGQGTKVEIK (SEQ ID NO:29) and a combination thereof; and the heavy chain variable region comprises a framework region (FR) selected from the group consisting of EVQLVESGGGVVQPG RSLRLSCSSSGFDFT (SEQ ID NO:30), EVQLVESGGG VVQPGRSLRLSCSASGFDFT (SEQ ID NO:31); WVRQAPGKGLEWVA (SEQ ID NO:33); RFTIS RDNSKNTLFLQMDSLRPEDTGVYFCAS (SEQ ID NO:36), RFTISRDNAKNTLFLQMDSLRPEDTGVYFCAS (SEQ ID NO:37); WGQGTPVTVSS (SEQ ID NO:39); and a combination thereof; and
wherein C may be in the sulfhydryl or disulfide form; and
wherein said mAb is unreactive with meconium antigen by enzyme immunoassay and unreactive with normal tissue.
50. The mAb of claim 49 , wherein the light chain and heavy chain variable regions comprise FRs comprising:
and wherein C may be in the sulfhydryl or disulfide form.
51. An isolated polynucleotide comprising a nucleic acid sequence encoding the mAb or fragment thereof of claim 43 .
52. An expression vector comprising the isolated polynucleotide of claim 51 .
53. A transformed cell comprising the isolated polynucleotide of claim 51 .
54. The transformed cell of claim 53 , wherein said cell is a mammalian cell.
55. A method of producing a Class III, anti-CEA mAb comprising
(a) transforming a cell with the isolated polynucleotide of claim 51; and
(b) expressing said polynucleotide by culturing said cell; and
(c) producing said mAb.
56. A complementarity determining region (CDR) comprising KASQDVGTSVA (SEQ ID NO:20).
57. A complementarity determining region (CDR) comprising WTSTRHT (SEQ ID NO:21).
58. A complementarity determining region (CDR) comprising QQYSLYRS (SEQ ID NO:22).
59. A complementarity determining region (CDR) comprising TYWMS (SEQ.ID NO:23).
60. A complementarity determining region (CDR) comprising EIHPDSSTINYAPSLKD (SEQ ID NO:24).
61. A complementarity determining region (CDR) comprising LYFGFPWFAY (SEQ ID NO:25).
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US10/755,382 US20050089538A1 (en) | 1994-10-05 | 2004-01-13 | CDR grafted type III anti-CEA humanized mouse monoclonal antibodies |
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US08/318,157 US5874540A (en) | 1994-10-05 | 1994-10-05 | CDR-grafted type III anti-CEA humanized mouse monoclonal antibodies |
US09/253,794 US6676924B2 (en) | 1994-10-05 | 1999-02-22 | CDR-grafted type III anti-CEA humanized mouse monoclonal antibodies |
US10/755,382 US20050089538A1 (en) | 1994-10-05 | 2004-01-13 | CDR grafted type III anti-CEA humanized mouse monoclonal antibodies |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US09/253,794 Continuation US6676924B2 (en) | 1994-10-05 | 1999-02-22 | CDR-grafted type III anti-CEA humanized mouse monoclonal antibodies |
Publications (1)
Publication Number | Publication Date |
---|---|
US20050089538A1 true US20050089538A1 (en) | 2005-04-28 |
Family
ID=23236916
Family Applications (3)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US08/318,157 Expired - Lifetime US5874540A (en) | 1994-10-05 | 1994-10-05 | CDR-grafted type III anti-CEA humanized mouse monoclonal antibodies |
US09/253,794 Expired - Fee Related US6676924B2 (en) | 1994-10-05 | 1999-02-22 | CDR-grafted type III anti-CEA humanized mouse monoclonal antibodies |
US10/755,382 Abandoned US20050089538A1 (en) | 1994-10-05 | 2004-01-13 | CDR grafted type III anti-CEA humanized mouse monoclonal antibodies |
Family Applications Before (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US08/318,157 Expired - Lifetime US5874540A (en) | 1994-10-05 | 1994-10-05 | CDR-grafted type III anti-CEA humanized mouse monoclonal antibodies |
US09/253,794 Expired - Fee Related US6676924B2 (en) | 1994-10-05 | 1999-02-22 | CDR-grafted type III anti-CEA humanized mouse monoclonal antibodies |
Country Status (8)
Country | Link |
---|---|
US (3) | US5874540A (en) |
EP (3) | EP1967528B1 (en) |
JP (3) | JP3437580B2 (en) |
AT (2) | ATE395068T1 (en) |
CA (1) | CA2200868C (en) |
DE (2) | DE69536072D1 (en) |
ES (1) | ES2307294T3 (en) |
WO (1) | WO1996011013A1 (en) |
Families Citing this family (141)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7354587B1 (en) * | 1994-07-06 | 2008-04-08 | Immunomedics, Inc. | Use of immunoconjugates to enhance the efficacy of multi-stage cascade boosting vaccines |
US5798100A (en) | 1994-07-06 | 1998-08-25 | Immunomedics, Inc. | Multi-stage cascade boosting vaccine |
WO1997034636A1 (en) * | 1996-03-20 | 1997-09-25 | Immunomedics, Inc. | Humanization of an anti-carcinoembryonic antigen anti-idiotype antibody and use as a tumor vaccine and for targeting applications |
HUP9901562A3 (en) | 1996-05-04 | 2000-06-28 | Astrazeneca Ab | Monoclonal antibody to cea, conjugates comprising said antibody, and their therapeutic use in an adept system |
US6417337B1 (en) * | 1996-10-31 | 2002-07-09 | The Dow Chemical Company | High affinity humanized anti-CEA monoclonal antibodies |
US6703488B1 (en) * | 1998-01-15 | 2004-03-09 | Center For Molecular Medicine And Immunology | Antibody/receptor targeting moiety for enhanced delivery of armed ligand |
CA2321947A1 (en) * | 1998-02-25 | 1999-09-02 | The Dow Chemical Company | High affinity humanized anti-cea monoclonal antibodies |
US6962702B2 (en) * | 1998-06-22 | 2005-11-08 | Immunomedics Inc. | Production and use of novel peptide-based agents for use with bi-specific antibodies |
MY133346A (en) * | 1999-03-01 | 2007-11-30 | Biogen Inc | Kit for radiolabeling ligands with yttrium-90 |
US20020102208A1 (en) | 1999-03-01 | 2002-08-01 | Paul Chinn | Radiolabeling kit and binding assay |
US20030099629A1 (en) * | 1999-03-11 | 2003-05-29 | Immunomedics, Inc. | Recombinant onconase and chemical conjugates and fusion proteins of recombinant onconase |
US8119101B2 (en) | 1999-05-10 | 2012-02-21 | The Ohio State University | Anti-CD74 immunoconjugates and methods of use |
US7527787B2 (en) * | 2005-10-19 | 2009-05-05 | Ibc Pharmaceuticals, Inc. | Multivalent immunoglobulin-based bioactive assemblies |
US7829064B2 (en) * | 1999-05-10 | 2010-11-09 | Immunomedics, Inc. | Anti-CD74 immunoconjugates and methods |
US8383081B2 (en) * | 1999-05-10 | 2013-02-26 | Immunomedics, Inc. | Anti-CD74 immunoconjugates and methods of use |
US20030224415A1 (en) * | 2001-06-29 | 2003-12-04 | Gala Design, Inc. | Selection free growth of host cells containing multiple integrating vectors |
JP2004524805A (en) * | 2000-07-03 | 2004-08-19 | ギャラ デザイン インコーポレイテッド | Host cells containing multiple integrating vectors |
CA2413156C (en) * | 2000-07-03 | 2009-08-18 | Gala Design, Inc. | Expression vectors |
US20040235173A1 (en) * | 2000-07-03 | 2004-11-25 | Gala Design, Inc. | Production of host cells containing multiple integrating vectors by serial transduction |
AU2001271614B2 (en) | 2000-07-03 | 2007-05-31 | Catalent Pharma Solutions, Llc | Host cells containing multiple integrating vectors |
AU2001283496A1 (en) * | 2000-07-25 | 2002-02-05 | Immunomedics, Inc. | Multivalent target binding protein |
US20020165360A1 (en) * | 2000-11-30 | 2002-11-07 | Junghans Richard P. | Chimeric effector cell receptors against carcinoembryonic antigen |
EP1372741B1 (en) * | 2001-03-30 | 2006-08-09 | University of Massachusetts | Morpholino imaging and therapy |
CA2463616C (en) * | 2001-10-15 | 2011-07-12 | Immunomedics, Inc. | Affinity enhancement agents |
US7591994B2 (en) | 2002-12-13 | 2009-09-22 | Immunomedics, Inc. | Camptothecin-binding moiety conjugates |
US7585491B2 (en) * | 2002-12-13 | 2009-09-08 | Immunomedics, Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
DK1483294T3 (en) | 2002-03-01 | 2010-11-08 | Immunomedics Inc | Internalizing anti-CD74 antibodies and methods for their use |
AU2003209446B2 (en) * | 2002-03-01 | 2008-09-25 | Immunomedics, Inc. | Bispecific antibody point mutations for enhancing rate of clearance |
DE60325184D1 (en) | 2002-03-01 | 2009-01-22 | Immunomedics Inc | RS7 ANTIBODY |
US9770517B2 (en) | 2002-03-01 | 2017-09-26 | Immunomedics, Inc. | Anti-Trop-2 antibody-drug conjugates and uses thereof |
US20160279239A1 (en) | 2011-05-02 | 2016-09-29 | Immunomedics, Inc. | Subcutaneous administration of anti-cd74 antibody for systemic lupus erythematosus and autoimmune disease |
US20040038304A1 (en) * | 2002-03-28 | 2004-02-26 | Gala Design, Inc. | Antibody libraries |
US7384738B2 (en) * | 2002-03-28 | 2008-06-10 | Bremel Robert D | Retrovirus-based genomic screening |
ATE461713T1 (en) * | 2002-05-29 | 2010-04-15 | Immunomedics Inc | COMPOSITIONS FOR RADIOIMMUNOTHERAPY OF BRAIN TUMORS |
CN101658672B (en) * | 2002-10-08 | 2017-09-26 | 免疫医疗公司 | Therapeutic alliance is carried out with the anti-CEA monoclonal antibodies of Group III and therapeutic agent |
JP4790413B2 (en) | 2002-10-08 | 2011-10-12 | イミューノメディクス、インコーポレイテッド | Antibody therapy |
US8420086B2 (en) | 2002-12-13 | 2013-04-16 | Immunomedics, Inc. | Camptothecin conjugates of anti-CD22 antibodies for treatment of B cell diseases |
KR20060041205A (en) * | 2003-07-01 | 2006-05-11 | 이뮤노메딕스, 인코오포레이티드 | Multivalent carriers of bi-specific antibodies |
US8038983B2 (en) * | 2003-07-29 | 2011-10-18 | Immunomedics, Inc. | Fluorinated carbohydrate conjugates |
US6878531B1 (en) * | 2003-11-10 | 2005-04-12 | Medical College Of Georgia Research Institute | Method for multiple site-directed mutagenesis |
US20050132544A1 (en) * | 2003-12-23 | 2005-06-23 | Jayshree Seth | Split hook fastener |
US20050221429A1 (en) * | 2004-01-16 | 2005-10-06 | Cardinal Health Pts, Llc | Host cells containing multiple integrating vectors comprising an amplifiable marker |
US8551480B2 (en) | 2004-02-13 | 2013-10-08 | Immunomedics, Inc. | Compositions and methods of use of immunotoxins comprising ranpirnase (Rap) show potent cytotoxic activity |
US20110020273A1 (en) * | 2005-04-06 | 2011-01-27 | Ibc Pharmaceuticals, Inc. | Bispecific Immunocytokine Dock-and-Lock (DNL) Complexes and Therapeutic Use Thereof |
US9481878B2 (en) | 2004-02-13 | 2016-11-01 | Immunomedics, Inc. | Compositions and methods of use of immunotoxins comprising ranpirnase (Rap) show potent cytotoxic activity |
US8491914B2 (en) * | 2004-02-13 | 2013-07-23 | Ibc Pharmaceuticals, Inc. | Dock-and-lock (DNL) complexes for delivery of interference RNA |
US20110064754A1 (en) * | 2005-03-03 | 2011-03-17 | Center For Molecular Medicine And Immunology | Immunoconjugates Comprising Poxvirus-Derived Peptides and Antibodies Against Antigen-Presenting Cells for Subunit-Based Poxvirus Vaccines |
US9550838B2 (en) | 2004-02-13 | 2017-01-24 | Ibc Pharmaceuticals, Inc. | Dock-and-lock (DNL) complexes for therapeutic and diagnostic use |
US8883160B2 (en) * | 2004-02-13 | 2014-11-11 | Ibc Pharmaceuticals, Inc. | Dock-and-lock (DNL) complexes for therapeutic and diagnostic use |
US8562988B2 (en) * | 2005-10-19 | 2013-10-22 | Ibc Pharmaceuticals, Inc. | Strategies for improved cancer vaccines |
US8652484B2 (en) | 2004-02-13 | 2014-02-18 | Immunomedics, Inc. | Delivery system for cytotoxic drugs by bispecific antibody pretargeting |
US8435539B2 (en) * | 2004-02-13 | 2013-05-07 | Immunomedics, Inc. | Delivery system for cytotoxic drugs by bispecific antibody pretargeting |
US20060127311A1 (en) * | 2004-11-17 | 2006-06-15 | Duke University | Radiation dosimetry and blocking antibodies and methods and uses therefor in the treatment of cancer |
US20160355591A1 (en) | 2011-05-02 | 2016-12-08 | Immunomedics, Inc. | Subcutaneous anti-hla-dr monoclonal antibody for treatment of hematologic malignancies |
US9707302B2 (en) | 2013-07-23 | 2017-07-18 | Immunomedics, Inc. | Combining anti-HLA-DR or anti-Trop-2 antibodies with microtubule inhibitors, PARP inhibitors, bruton kinase inhibitors or phosphoinositide 3-kinase inhibitors significantly improves therapeutic outcome in cancer |
US10058621B2 (en) | 2015-06-25 | 2018-08-28 | Immunomedics, Inc. | Combination therapy with anti-HLA-DR antibodies and kinase inhibitors in hematopoietic cancers |
US8349332B2 (en) | 2005-04-06 | 2013-01-08 | Ibc Pharmaceuticals, Inc. | Multiple signaling pathways induced by hexavalent, monospecific and bispecific antibodies for enhanced toxicity to B-cell lymphomas and other diseases |
US8475794B2 (en) | 2005-04-06 | 2013-07-02 | Ibc Pharmaceuticals, Inc. | Combination therapy with anti-CD74 antibodies provides enhanced toxicity to malignancies, Autoimmune disease and other diseases |
US20060257317A1 (en) * | 2005-05-04 | 2006-11-16 | Duke University | Combination therapy in the treatment of cancer |
CN101534865A (en) * | 2005-10-19 | 2009-09-16 | Ibc药品公司 | Methods and compositions for generating bioactive assemblies of increased complexity and uses |
EP3501538A1 (en) | 2006-12-01 | 2019-06-26 | Novartis AG | Anti-p-selectin antibodies and methods of using the same to treat inflammatory diseases |
EP2860260A1 (en) | 2008-04-11 | 2015-04-15 | Merrimack Pharmaceuticals, Inc. | Human serum albumin linkers and conjugates thereof |
CN102186499B (en) * | 2008-08-20 | 2015-05-20 | Ibc医药公司 | Dock-and-lock (DNL) vaccines for cancer therapy |
EP4083072A1 (en) | 2008-10-06 | 2022-11-02 | Minerva Biotechnologies Corporation | Muc1* antibodies |
KR20110112301A (en) | 2008-11-18 | 2011-10-12 | 메리맥 파마슈티컬즈, 인크. | Human serum albumin linkers and conjugates thereof |
LT3912643T (en) | 2009-02-13 | 2023-02-10 | Immunomedics Inc. | Immunoconjugates with an intracellularly-cleavable linkage |
EP3009455A1 (en) | 2009-09-16 | 2016-04-20 | Immunomedics Inc. | Class i anti-cea antibodies and uses thereof |
CA2782194C (en) | 2009-12-02 | 2018-01-16 | Immunomedics, Inc. | Combination of radiolabelled antibodies (rait) and antibody-drug conjugates (adc) for treatment of pancreatic cancer |
EP2523680A4 (en) * | 2010-01-11 | 2013-06-19 | Ct Molecular Med & Immunology | Enhanced cytotoxicity of anti-cd74 and anti-hla-dr antibodies with interferon-gamma |
CN101928347B (en) * | 2010-05-05 | 2013-03-27 | 上海海抗中医药科技发展有限公司 | Anti-carcinoembryonic-antigen (CEA) antibody and application thereof |
EA031044B1 (en) * | 2010-10-13 | 2018-11-30 | Янссен Байотек, Инк. | Human oncostatin m antibodies and methods of use thereof |
JP2012171088A (en) * | 2011-02-24 | 2012-09-10 | Olympus Corp | Master operation input device, and master-slave manipulator |
PL2681244T3 (en) * | 2011-03-02 | 2018-04-30 | Roche Glycart Ag | Cea antibodies |
EA201892619A1 (en) | 2011-04-29 | 2019-04-30 | Роше Гликарт Аг | IMMUNOCONJUGATES CONTAINING INTERLEUKIN-2 MUTANT POLYPETIPS |
CN103501825B (en) | 2011-05-02 | 2017-03-15 | 免疫医疗公司 | The ultrafiltration concentration of the antibody selected for the allotype that small size is applied |
EP2788020A4 (en) | 2011-12-05 | 2015-04-29 | Immunomedics Inc | Therapeutic use of anti-cd22 antibodies for inducing trogocytosis |
US9757458B2 (en) | 2011-12-05 | 2017-09-12 | Immunomedics, Inc. | Crosslinking of CD22 by epratuzumab triggers BCR signaling and caspase-dependent apoptosis in hematopoietic cancer cells |
WO2014028560A2 (en) | 2012-08-14 | 2014-02-20 | Ibc Pharmaceuticals, Inc. | T-cell redirecting bispecific antibodies for treatment of disease |
US20150202287A1 (en) | 2012-08-30 | 2015-07-23 | Merrimack Pharmaceuticals, Inc. | Combination therapies comprising anti-erbb3 agents |
US9492566B2 (en) | 2012-12-13 | 2016-11-15 | Immunomedics, Inc. | Antibody-drug conjugates and uses thereof |
US10206918B2 (en) | 2012-12-13 | 2019-02-19 | Immunomedics, Inc. | Efficacy of anti-HLA-DR antiboddy drug conjugate IMMU-140 (hL243-CL2A-SN-38) in HLA-DR positive cancers |
US9931417B2 (en) | 2012-12-13 | 2018-04-03 | Immunomedics, Inc. | Antibody-SN-38 immunoconjugates with a CL2A linker |
US10744129B2 (en) | 2012-12-13 | 2020-08-18 | Immunomedics, Inc. | Therapy of small-cell lung cancer (SCLC) with a topoisomerase-I inhibiting antibody-drug conjugate (ADC) targeting Trop-2 |
WO2015012904A2 (en) | 2012-12-13 | 2015-01-29 | Immunomedics, Inc. | Antibody-sn-38 immunoconjugates with a cl2a linker |
CN107753954A (en) | 2012-12-13 | 2018-03-06 | 免疫医疗公司 | The dosage of the antibody that effect is improved and toxicity reduces and SN 38 immunoconjugates |
US10137196B2 (en) | 2012-12-13 | 2018-11-27 | Immunomedics, Inc. | Dosages of immunoconjugates of antibodies and SN-38 for improved efficacy and decreased toxicity |
US10413539B2 (en) | 2012-12-13 | 2019-09-17 | Immunomedics, Inc. | Therapy for metastatic urothelial cancer with the antibody-drug conjugate, sacituzumab govitecan (IMMU-132) |
EP2774930A1 (en) | 2013-03-07 | 2014-09-10 | Aptenia S.R.L. | Metallocene compounds and labeled molecules comprising the same for in vivo imaging. |
US11253606B2 (en) | 2013-07-23 | 2022-02-22 | Immunomedics, Inc. | Combining anti-HLA-DR or anti-Trop-2 antibodies with microtubule inhibitors, PARP inhibitors, Bruton kinase inhibitors or phosphoinositide 3-kinase inhibitors significantly improves therapeutic outcome in cancer |
CA2924398A1 (en) * | 2013-11-05 | 2015-05-14 | Immunomedics, Inc. | Humanized anti-ceacam5 antibody and uses thereof |
WO2015126548A1 (en) | 2014-02-21 | 2015-08-27 | Ibc Pharmaceuticals, Inc. | Disease therapy by inducing immune response to trop-2 expressing cells |
CN106029098A (en) | 2014-02-25 | 2016-10-12 | 免疫医疗公司 | Humanized RFB4 anti-CD22 antibody |
HUE055693T2 (en) | 2014-04-03 | 2021-12-28 | Igm Biosciences Inc | Modified j-chain |
EP3160504B1 (en) | 2014-06-24 | 2020-09-16 | Immunomedics, Inc. | Anti-histone therapy for vascular necrosis in severe glomerulonephritis |
EP3191136A1 (en) | 2014-09-08 | 2017-07-19 | Michaela Arndt | Construct for the delivery of a molecule into the cytoplasm of a cell |
CN117138060A (en) | 2014-10-07 | 2023-12-01 | 免疫医疗公司 | New adjuvant use of antibody-drug conjugates |
CN116199790A (en) | 2015-02-10 | 2023-06-02 | 米纳瓦生物技术公司 | Humanized anti-MUCl antibodies |
CN107428837A (en) | 2015-04-22 | 2017-12-01 | 免疫医疗公司 | Circulate separation, detection, diagnosis and/or the identification of the positive cancer cells of TROP 2 |
SI3313443T1 (en) | 2015-06-25 | 2023-11-30 | Immunomedics, Inc. | Combining anti-hla-dr or anti-trop-2 antibodies with microtubule inhibitors, parp inhibitors, bruton kinase inhibitors or phosphoinositide 3-kinase inhibitors significantly improves therapeutic outcome in cancer |
US10195175B2 (en) | 2015-06-25 | 2019-02-05 | Immunomedics, Inc. | Synergistic effect of anti-Trop-2 antibody-drug conjugate in combination therapy for triple-negative breast cancer when used with microtubule inhibitors or PARP inhibitors |
SI3316885T1 (en) | 2015-07-01 | 2021-09-30 | Immunomedics, Inc. | Antibody-sn-38 immunoconjugates with a cl2a linker |
US10618978B2 (en) | 2015-09-30 | 2020-04-14 | Igm Biosciences, Inc. | Binding molecules with modified J-chain |
CN108463472A (en) | 2015-09-30 | 2018-08-28 | Igm生物科学有限公司 | The binding molecule of J- chains with modification |
CN108601841A (en) | 2016-02-10 | 2018-09-28 | 免疫医疗公司 | The combination of ABCG2 inhibitor and SACITUZUMAB GOVITECAN (IMMU-132) overcome the resistance to SN-38 in the cancer for expressing TROP-2 |
WO2017189279A1 (en) | 2016-04-27 | 2017-11-02 | Immunomedics, Inc. | Efficacy of anti-trop-2-sn-38 antibody drug conjugates for therapy of tumors relapsed/refractory to checkpoint inhibitors |
CN110392570A (en) | 2017-03-27 | 2019-10-29 | 免疫医疗公司 | With husky trastuzumab lattice dimension for the triple negative breast cancer of health and RAD51 inhibitor for treating expression TROP-2 |
EP3606964A4 (en) | 2017-04-03 | 2020-12-09 | Immunomedics, Inc. | Subcutaneous administration of antibody-drug conjugates for cancer therapy |
SG11202101982RA (en) | 2018-09-26 | 2021-03-30 | Ascendis Pharma As | Degradable hyaluronic acid hydrogels |
WO2020252294A1 (en) | 2019-06-13 | 2020-12-17 | Bolt Biotherapeutics, Inc. | Aminobenzazepine compounds, immunoconjugates, and uses thereof |
AR119382A1 (en) | 2019-07-12 | 2021-12-15 | Hoffmann La Roche | PRE-TARGETING ANTIBODIES AND METHODS OF USE |
US20220313835A1 (en) | 2019-09-03 | 2022-10-06 | Bolt Biotherapeutics, Inc. | Aminoquinoline compounds, immunoconjugates, and uses thereof |
CA3152601A1 (en) | 2019-09-30 | 2021-04-08 | Bolt Biotherapeutics, Inc. | Amide-linked, aminobenzazepine immunoconjugates, and uses thereof |
CA3155077A1 (en) | 2019-10-25 | 2021-04-29 | Romas Kudirka | Thienoazepine immunoconjugates, and uses thereof |
WO2021226440A1 (en) | 2020-05-08 | 2021-11-11 | Bolt Biotherapeutics, Inc. | Elastase-substrate, peptide linker immunoconjugates, and uses thereof |
US20230256114A1 (en) | 2020-07-07 | 2023-08-17 | Bionecure Therapeutics, Inc. | Novel maytansinoids as adc payloads and their use for the treatment of cancer |
CN115803010A (en) | 2020-07-09 | 2023-03-14 | 豪夫迈·罗氏有限公司 | Concentrated protein compositions, their preparation and use |
MX2023000339A (en) | 2020-07-10 | 2023-02-09 | Hoffmann La Roche | Antibodies which bind to cancer cells and target radionuclides to said cells. |
KR20230051189A (en) | 2020-08-13 | 2023-04-17 | 볼트 바이오테라퓨틱스 인코퍼레이티드 | Pyrazolozepine Immunoconjugates and Uses Thereof |
IL300497A (en) | 2020-08-20 | 2023-04-01 | A2 Biotherapeutics Inc | Compositions and methods for treating ceacam positive cancers |
MX2023002041A (en) | 2020-08-20 | 2023-04-27 | A2 Biotherapeutics Inc | Compositions and methods for treating mesothelin positive cancers. |
US20220195066A1 (en) | 2020-12-11 | 2022-06-23 | Bolt Biotherapeutics, Inc. | Anti-cea immunoconjugates, and uses thereof |
JP2024501453A (en) | 2020-12-11 | 2024-01-12 | ボルト バイオセラピューティクス、インコーポレーテッド | Anti-CEA immunoconjugates and their uses |
EP4277705A1 (en) | 2021-01-12 | 2023-11-22 | F. Hoffmann-La Roche AG | Split antibodies which bind to cancer cells and target radionuclides to said cells |
CA3204291A1 (en) | 2021-01-13 | 2022-07-21 | F. Hoffmann-La Roche Ag | Combination therapy |
WO2022204536A1 (en) | 2021-03-26 | 2022-09-29 | Bolt Biotherapeutics, Inc. | 2-amino-4-carboxamide-benzazepine immunoconjugates, and uses thereof |
KR20230163450A (en) | 2021-03-26 | 2023-11-30 | 볼트 바이오테라퓨틱스 인코퍼레이티드 | 2-Amino-4-carboxamide-benzazepine immunoconjugate and uses thereof |
EP4342497A1 (en) | 2021-05-10 | 2024-03-27 | Kawasaki Institute of Industrial Promotion | Antibody having reduced binding affinity for antigen |
WO2023016488A1 (en) | 2021-08-13 | 2023-02-16 | 昆山新蕴达生物科技有限公司 | Microtubule inhibitor-based antibody-drug conjugate |
WO2023024949A1 (en) | 2021-08-24 | 2023-03-02 | 昆山新蕴达生物科技有限公司 | Antibody-drug conjugate conjugated via breakable linker |
WO2023076983A1 (en) | 2021-10-28 | 2023-05-04 | Gilead Sciences, Inc. | Pyridizin-3(2h)-one derivatives |
US11919869B2 (en) | 2021-10-29 | 2024-03-05 | Gilead Sciences, Inc. | CD73 compounds |
WO2023076599A1 (en) | 2021-10-29 | 2023-05-04 | Bolt Biotherapeutics, Inc. | Tlr agonist immunoconjugates with cysteine-mutant antibodies, and uses thereof |
WO2023122615A1 (en) | 2021-12-22 | 2023-06-29 | Gilead Sciences, Inc. | Ikaros zinc finger family degraders and uses thereof |
US20240124412A1 (en) | 2021-12-22 | 2024-04-18 | Gilead Sciences, Inc. | Ikaros zinc finger family degraders and uses thereof |
TW202340168A (en) | 2022-01-28 | 2023-10-16 | 美商基利科學股份有限公司 | Parp7 inhibitors |
WO2023178181A1 (en) | 2022-03-17 | 2023-09-21 | Gilead Sciences, Inc. | Ikaros zinc finger family degraders and uses thereof |
WO2023180489A1 (en) | 2022-03-23 | 2023-09-28 | Synaffix B.V. | Antibody-conjugates for targeting of tumours expressing carcinoembyronic antigen |
WO2023201268A1 (en) | 2022-04-13 | 2023-10-19 | Gilead Sciences, Inc. | Combination therapy for treating tumor antigen expressing cancers |
WO2023201267A1 (en) | 2022-04-13 | 2023-10-19 | Gilead Sciences, Inc. | Combination therapy for treating trop-2 expressing cancers |
WO2023205719A1 (en) | 2022-04-21 | 2023-10-26 | Gilead Sciences, Inc. | Kras g12d modulating compounds |
US20240116928A1 (en) | 2022-07-01 | 2024-04-11 | Gilead Sciences, Inc. | Cd73 compounds |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5618920A (en) * | 1985-11-01 | 1997-04-08 | Xoma Corporation | Modular assembly of antibody genes, antibodies prepared thereby and use |
US20030040606A1 (en) * | 2001-06-27 | 2003-02-27 | Leung Shawn Shui-On | Reducing immunogenicities of immunoglobulins by framework-patching |
Family Cites Families (15)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5156840A (en) | 1982-03-09 | 1992-10-20 | Cytogen Corporation | Amine-containing porphyrin derivatives |
US4818709A (en) * | 1983-01-21 | 1989-04-04 | Primus Frederick J | CEA-family antigens, Anti-CEA antibodies and CEA immunoassay |
US5057313A (en) | 1986-02-25 | 1991-10-15 | The Center For Molecular Medicine And Immunology | Diagnostic and therapeutic antibody conjugates |
GB8607679D0 (en) * | 1986-03-27 | 1986-04-30 | Winter G P | Recombinant dna product |
GB8800078D0 (en) * | 1988-01-05 | 1988-02-10 | Ciba Geigy Ag | Novel antibodies |
AU625613B2 (en) * | 1988-01-05 | 1992-07-16 | Novartis Ag | Novel chimeric antibodies |
US5530101A (en) * | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
US5081235A (en) * | 1989-07-26 | 1992-01-14 | City Of Hope | Chimeric anti-cea antibody |
GB8928874D0 (en) * | 1989-12-21 | 1990-02-28 | Celltech Ltd | Humanised antibodies |
GB9014932D0 (en) * | 1990-07-05 | 1990-08-22 | Celltech Ltd | Recombinant dna product and method |
LU91067I2 (en) * | 1991-06-14 | 2004-04-02 | Genentech Inc | Trastuzumab and its variants and immunochemical derivatives including immotoxins |
US5443953A (en) | 1993-12-08 | 1995-08-22 | Immunomedics, Inc. | Preparation and use of immunoconjugates |
US5798100A (en) * | 1994-07-06 | 1998-08-25 | Immunomedics, Inc. | Multi-stage cascade boosting vaccine |
WO1996004925A1 (en) * | 1994-08-12 | 1996-02-22 | Immunomedics, Inc. | Immunoconjugates and humanized antibodies specific for b-cell lymphoma and leukemia cells |
IL115177A0 (en) * | 1994-09-16 | 1995-12-31 | Immunomedics Inc | Phosphorus-32 labeling of antibodies for cancer therapy |
-
1994
- 1994-10-05 US US08/318,157 patent/US5874540A/en not_active Expired - Lifetime
-
1995
- 1995-09-28 AT AT95935020T patent/ATE395068T1/en not_active IP Right Cessation
- 1995-09-28 AT AT06076426T patent/ATE464906T1/en not_active IP Right Cessation
- 1995-09-28 EP EP08008840.4A patent/EP1967528B1/en not_active Expired - Lifetime
- 1995-09-28 EP EP06076426A patent/EP1736163B1/en not_active Expired - Lifetime
- 1995-09-28 WO PCT/US1995/011964 patent/WO1996011013A1/en active Application Filing
- 1995-09-28 JP JP51258896A patent/JP3437580B2/en not_active Expired - Fee Related
- 1995-09-28 DE DE69536072T patent/DE69536072D1/en not_active Expired - Lifetime
- 1995-09-28 EP EP95935020A patent/EP0783313B1/en not_active Expired - Lifetime
- 1995-09-28 CA CA2200868A patent/CA2200868C/en not_active Expired - Lifetime
- 1995-09-28 DE DE69535755T patent/DE69535755D1/en not_active Expired - Lifetime
- 1995-09-28 ES ES95935020T patent/ES2307294T3/en not_active Expired - Lifetime
-
1999
- 1999-02-22 US US09/253,794 patent/US6676924B2/en not_active Expired - Fee Related
-
2001
- 2001-11-22 JP JP2001357367A patent/JP2002218990A/en active Pending
-
2004
- 2004-01-13 US US10/755,382 patent/US20050089538A1/en not_active Abandoned
-
2009
- 2009-11-16 JP JP2009260907A patent/JP5183611B2/en not_active Expired - Lifetime
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5618920A (en) * | 1985-11-01 | 1997-04-08 | Xoma Corporation | Modular assembly of antibody genes, antibodies prepared thereby and use |
US20030040606A1 (en) * | 2001-06-27 | 2003-02-27 | Leung Shawn Shui-On | Reducing immunogenicities of immunoglobulins by framework-patching |
Also Published As
Publication number | Publication date |
---|---|
JPH10508466A (en) | 1998-08-25 |
EP1736163B1 (en) | 2010-04-21 |
EP0783313B1 (en) | 2008-05-14 |
JP2002218990A (en) | 2002-08-06 |
ATE395068T1 (en) | 2008-05-15 |
ATE464906T1 (en) | 2010-05-15 |
AU3719695A (en) | 1996-05-02 |
WO1996011013A1 (en) | 1996-04-18 |
ES2307294T3 (en) | 2008-11-16 |
EP1967528A3 (en) | 2008-12-17 |
EP0783313A1 (en) | 1997-07-16 |
US6676924B2 (en) | 2004-01-13 |
DE69536072D1 (en) | 2010-06-02 |
JP5183611B2 (en) | 2013-04-17 |
US20020018750A1 (en) | 2002-02-14 |
JP3437580B2 (en) | 2003-08-18 |
AU689331B2 (en) | 1998-03-26 |
CA2200868A1 (en) | 1996-04-18 |
EP1736163A1 (en) | 2006-12-27 |
CA2200868C (en) | 2010-04-13 |
JP2010075190A (en) | 2010-04-08 |
EP0783313A4 (en) | 2005-01-12 |
EP1967528A2 (en) | 2008-09-10 |
US5874540A (en) | 1999-02-23 |
EP1967528B1 (en) | 2015-03-04 |
DE69535755D1 (en) | 2008-06-26 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US6676924B2 (en) | CDR-grafted type III anti-CEA humanized mouse monoclonal antibodies | |
US6417337B1 (en) | High affinity humanized anti-CEA monoclonal antibodies | |
US5874060A (en) | Recombinant human anti-Lewis Y antibodies | |
CA2073124C (en) | Tumor antigen specific antibody | |
US6307026B1 (en) | Humanized antibodies directed against A33 antigen | |
AU675268B2 (en) | Humanised antibodies directed against A33 antigen | |
US5645817A (en) | Granulocyte-binding antibody constructs, their preparation and use | |
JP4080692B2 (en) | High affinity humanized anti-TAG-72 monoclonal antibody | |
AU752494B2 (en) | High affinity humanized ANTI-CEA monoclonal antibodies | |
AU723073B2 (en) | CDR-grafted type III anti-CEA humanized mouse monoclonal antibodies | |
AU689331C (en) | CDR-grafted type III anti-CEA humanized mouse monoclonal antibodies | |
MXPA00008391A (en) | High affinity humanized anti-cea monoclonal antibodies |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |