US20060210579A1 - Nucleic acids and proteins from streptococcus groups A & B - Google Patents

Nucleic acids and proteins from streptococcus groups A & B Download PDF

Info

Publication number
US20060210579A1
US20060210579A1 US11/434,137 US43413706A US2006210579A1 US 20060210579 A1 US20060210579 A1 US 20060210579A1 US 43413706 A US43413706 A US 43413706A US 2006210579 A1 US2006210579 A1 US 2006210579A1
Authority
US
United States
Prior art keywords
protein
nucleic acid
sequence
antigen
amino acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US11/434,137
Inventor
John Telford
Vega Masignani
Immaculada Ros
Guido Grandi
Claire Fraser
Herve Tettelin
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Novartis Vaccines and Diagnostics Inc
J Craig Venter Institute Inc
Original Assignee
Novartis Vaccines and Diagnostics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from GB0026333A external-priority patent/GB0026333D0/en
Priority claimed from GB0028727A external-priority patent/GB0028727D0/en
Priority claimed from GB0105640A external-priority patent/GB0105640D0/en
Application filed by Novartis Vaccines and Diagnostics Inc filed Critical Novartis Vaccines and Diagnostics Inc
Priority to US11/434,137 priority Critical patent/US20060210579A1/en
Assigned to NOVARTIS VACCINES AND DIAGNOSTICS, INC. reassignment NOVARTIS VACCINES AND DIAGNOSTICS, INC. MERGER (SEE DOCUMENT FOR DETAILS). Assignors: CHIRON CORPORATION
Publication of US20060210579A1 publication Critical patent/US20060210579A1/en
Assigned to J. CRAIG VENTER INSTITUTE reassignment J. CRAIG VENTER INSTITUTE MERGER (SEE DOCUMENT FOR DETAILS). Assignors: THE INSTITUTE FOR GENOMIC RESEARCH, INC.
Assigned to NOVARTIS VACCINES AND DIAGNOSTICS, INC. reassignment NOVARTIS VACCINES AND DIAGNOSTICS, INC. MERGER (SEE DOCUMENT FOR DETAILS). Assignors: CHIRON CORPORATION
Assigned to NOVARTIS VACCINES AND DIAGNOSTICS, INC. reassignment NOVARTIS VACCINES AND DIAGNOSTICS, INC. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: SCARSELLI, MARIA
Assigned to NOVARTIS VACCINES AND DIAGNOSTICS SRL reassignment NOVARTIS VACCINES AND DIAGNOSTICS SRL CHANGE OF NAME (SEE DOCUMENT FOR DETAILS). Assignors: CHIRON SRL
Assigned to NOVARTIS VACCINES AND DIAGNOSTICS, INC. reassignment NOVARTIS VACCINES AND DIAGNOSTICS, INC. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: NOVARTIS VACCINES AND DIAGNOSTICS SRL
Abandoned legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/315Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Streptococcus (G), e.g. Enterococci
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/02Bacterial antigens
    • A61K39/09Lactobacillales, e.g. aerococcus, enterococcus, lactobacillus, lactococcus, streptococcus
    • A61K39/092Streptococcus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/02Stomatological preparations, e.g. drugs for caries, aphtae, periodontitis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P15/00Drugs for genital or sexual disorders; Contraceptives
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/16Otologicals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • A61P29/02Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID] without antiinflammatory effect
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/10Antimycotics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P33/00Antiparasitic agents
    • A61P33/02Antiprotozoals, e.g. for leishmaniasis, trichomoniasis, toxoplasmosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/12Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from bacteria
    • C07K16/1267Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from bacteria from Gram-positive bacteria
    • C07K16/1275Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from bacteria from Gram-positive bacteria from Streptococcus (G)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/40Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against enzymes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10Transferases (2.)
    • C12N9/1085Transferases (2.) transferring alkyl or aryl groups other than methyl groups (2.5)
    • C12N9/1088Glutathione transferase (2.5.1.18)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/53DNA (RNA) vaccination
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y205/00Transferases transferring alkyl or aryl groups, other than methyl groups (2.5)
    • C12Y205/01Transferases transferring alkyl or aryl groups, other than methyl groups (2.5) transferring alkyl or aryl groups, other than methyl groups (2.5.1)
    • C12Y205/01018Glutathione transferase (2.5.1.18)
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • This invention relates to nucleic acid and proteins from the bacteria Streptococcus agalactiae (GBS) and Streptococcus pyogenes (GAS).
  • GBS Gram-positive bacterium Streptococcus agalactiae
  • group B streptococcus is now known to cause serious disease, bacteremia and meningitis, in immunocompromised individuals and in neonates.
  • the second is a meningitis that occurs 10 to 60 days after birth. If pregnant women are vaccinated with type III capsule so that the infants are passively immunised, the incidence of the late onset meningitis is reduced but is not entirely eliminated.
  • the “B” in “GBS” refers to the Lancefield classification, which is based on the antigenicity of a carbohydrate which is soluble in dilute acid and called the C carbohydrate.
  • Lancefield identified 13 types of C carbohydrate, designated A to O, that could be serologically differentiated.
  • the organisms that most commonly infect humans are found in groups A, B, D, and G.
  • strains can be divided into 8 serotypes (Ia, Ib, Ia/c, II, III, IV, V, and VI) based on the structure of their polysaccharide capsule.
  • GAS Group A streptococcus
  • S.pyogenes is typically treated using antibiotics. Although S.agalactiae is inhibited by antibiotics, however, it is not killed by penicillin as easily as GAS. Prophylactic vaccination is thus preferable.
  • proteins which can be used in the development of such vaccines.
  • the proteins may also be useful for diagnostic purposes, and as targets for antibiotics.
  • FIG. 1A shows the pDEST15 vector.
  • FIG. 1B shows the pDEST17-1 vector.
  • the invention provides proteins comprising the S.agalactiae amino acid sequences disclosed in the examples, and proteins comprising the S.pyogenes amino acid sequences disclosed in the examples. These amino acid sequences are the even SEQ ID NOS: between 1 and 10960.
  • proteins comprising amino acid sequences having sequence identity to the S.agalactiae amino acid sequences disclosed in the examples, and proteins comprising amino acid sequences having sequence identity to the S.pyogenes amino acid sequences disclosed in the examples.
  • the degree of sequence identity is preferably greater than 50% (e.g. 60%, 70%, 80%, 90%, 95%, 99% or more).
  • a preferred protein of the invention is GAS16 (SEQ ID NO:7276).
  • the invention further provides proteins comprising fragments of the S.agalactiae amino acid sequences disclosed in the examples, and proteins comprising fragments of the S.pyogenes amino acid sequences disclosed in the examples.
  • the fragments should comprise at least n consecutive amino acids from the sequences and, depending on the particular sequence, n is 7 or more (e.g. 8, 10, 12, 14, 16, 18, 20, 30, 40, 50, 60, 70, 80, 90, 100 or more).
  • n is 7 or more (e.g. 8, 10, 12, 14, 16, 18, 20, 30, 40, 50, 60, 70, 80, 90, 100 or more).
  • the fragments comprise one or more epitopes from the sequence.
  • N-terminal signal peptides of the proteins disclosed in the examples are (a) the N-terminal signal peptides of the proteins disclosed in the examples, (b) the proteins disclosed in the examples, but without their N-terminal signal peptides, (c) fragments common to the related GAS and GBS proteins disclosed in the examples, and (d) the proteins disclosed in the examples, but without their N-terminal amino acid residue.
  • the proteins of the invention can, of course, be prepared by various means (e.g. recombinant expression, purification from GAS or GBS, chemical synthesis etc.) and in various forms (e.g. native, fusions, glycosylated, non-glycosylated etc.). They are preferably prepared in substantially pure form (i.e. substantially free from other streptococcal or host cell proteins) or substantially isolated form. Proteins of the invention are preferably streptococcal proteins.
  • the invention provides antibodies which bind to these proteins. These may be polyclonal or monoclonal and may be produced by any suitable means (e.g. by recombinant expression). To increase compatibility with the human immune system, the antibodies may be chimeric or humanised (e.g. Breedveld (2000) Lancet 355(9205):735-740; Gorman & Clark (1990) Semin. Immunol. 2:457-466), or fully human antibodies may be used. The antibodies may include a detectable label (e.g. for diagnostic assays).
  • the invention provides nucleic acid comprising the S.agalactiae nucleotide sequences disclosed in the examples, and nucleic acid comprising the S.pyogenes nucleotide sequences disclosed in the examples.
  • These nucleic acid sequences are the odd SEQ ID NOS: between 1 and 10966.
  • the invention provides nucleic acid comprising nucleotide sequences having sequence identity to the S.agalactiae nucleotide sequences disclosed in the examples, and nucleic acid comprising nucleotide sequences having sequence identity to the S.pyogenes nucleotide sequences disclosed in the examples. Identity between sequences is preferably determined by the Smith-Waterman homology search algorithm as described above.
  • the invention provides nucleic acid which can hybridise to the S.agalactiae nucleic acid disclosed in the examples, and nucleic acid which can hybridise to the S.pyogenes nucleic acid disclosed in the examples preferably under ‘high stringency’ conditions (e.g. 65° C. in 0.1 ⁇ SSC, 0.5% SDS solution).
  • high stringency e.g. 65° C. in 0.1 ⁇ SSC, 0.5% SDS solution.
  • Nucleic acid comprising fragments of these sequences are also provided. These should comprise at least n consecutive nucleotides from the S.agalactiae or S.pyogenes sequences and, depending on the particular sequence, n is 10 or more (e.g. 12, 14, 15, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200 or more).
  • the fragments may comprise sequences which are common to the related GAS and GBS sequences disclosed in the examples.
  • the invention provides nucleic acid encoding the proteins and protein fragments of the invention.
  • the invention also provides: nucleic acid comprising nucleotide sequence SEQ ID NO:7275; nucleic acid comprising nucleotide sequences having sequence identity to SEQ ID NO:7275; nucleic acid which can hybridise to SEQ ID NO:7275 (preferably under ‘high stringency’ conditions); nucleic acid comprising a fragment of at least n consecutive nucleotides from SEQ ID NO:7275, wherein n is 10 or more e.g.
  • Nucleic acids of the invention can be used in hybridisation reactions (e.g. Northern or Southern blots, or in nucleic acid microarrays or ‘gene chips’) and amplification reactions (e.g. PCR, SDA, SSSR, LCR, TMA, NASBA etc.) and other nucleic acid techniques.
  • hybridisation reactions e.g. Northern or Southern blots, or in nucleic acid microarrays or ‘gene chips’
  • amplification reactions e.g. PCR, SDA, SSSR, LCR, TMA, NASBA etc.
  • nucleic acid comprising sequences complementary to those described above (e.g. for antisense or probing, or for use as primers).
  • Nucleic acid according to the invention can, of course, be prepared in many ways (e.g. by chemical synthesis, from genomic or cDNA libraries, from the organism itself etc.) and can take various forms (e.g. single stranded, double stranded, vectors, primers, probes, labelled etc.).
  • the nucleic acid is preferably in substantially isolated form.
  • Nucleic acid according to the invention may be labelled e.g. with a radioactive or fluorescent label. This is particularly useful where the nucleic acid is to be used in nucleic acid detection techniques e.g. where the nucleic acid is a primer or as a probe for use in techniques such as PCR, LCR, TMA, NASBA etc.
  • nucleic acid includes DNA and RNA, and also their analogues, such as those containing modified backbones, and also peptide nucleic acids (PNA) etc.
  • PNA peptide nucleic acids
  • the invention provides vectors comprising nucleotide sequences of the invention (e.g. cloning or expression vectors) and host cells transformed with such vectors.
  • compositions comprising protein, antibody, and/or nucleic acid according to the invention.
  • These compositions may be suitable as immunogenic compositions, for instance, or as diagnostic reagents, or as vaccines.
  • the invention also provides nucleic acid, protein, or antibody according to the invention for use as medicaments (e.g. as immunogenic compositions or as vaccines) or as diagnostic reagents. It also provides the use of nucleic acid, protein, or antibody according to the invention in the manufacture of: (i) a medicament for treating or preventing disease and/or infection caused by streptococcus ; (ii) a diagnostic reagent for detecting the presence of streptococcus or of antibodies raised against streptococcus ; and/or (iii) a reagent which can raise antibodies against streptococcus .
  • Said streptococcus may be any species, group or strain, but is preferably S.agalactiae , especially serotype III or V, or S.pyogenes .
  • Said disease may be bacteremia, meningitis, puerperal fever, scarlet fever, erysipelas, pharyngitis, impetigo, necrotising fasciitis, myositis or toxic shock syndrome.
  • the invention also provides a method of treating a patient, comprising administering to the patient a therapeutically effective amount of nucleic acid, protein, and/or antibody of the invention.
  • the patient may either be at risk from the disease themselves or may be a pregnant woman (‘maternal immunisation’ e.g. Glezen & Alpers (1999) Clin. Infect. Dis. 28:219-224).
  • Administration of antibodies of the invention is another preferred method of treatment.
  • This method of passive immunisation is particularly useful for newborn children or for pregnant women.
  • This method will typically use monoclonal antibodies, which will be humanised or fully human.
  • the invention also provides a kit comprising primers (e.g. PCR primers) for amplifying a template sequence contained within a Streptococcus (e.g. S.pyogenes or S.agalactiae ) nucleic acid sequence, the kit comprising a first primer and a second primer, wherein the first primer is substantially complementary to said template sequence and the second primer is substantially complementary to a complement of said template sequence, wherein the parts of said primers which have substantial complementarity define the termini of the template sequence to be amplified.
  • the first primer and/or the second primer may include a detectable label (e.g. a fluorescent label).
  • the invention also provides a kit comprising first and second single-stranded oligonucleotides which allow amplification of a Streptococcus template nucleic acid sequence contained in a single- or double-stranded nucleic acid (or mixture thereof), wherein: (a) the first oligonucleotide comprises a primer sequence which is substantially complementary to said template nucleic acid sequence; (b) the second oligonucleotide comprises a primer sequence which is substantially complementary to the complement of said template nucleic acid sequence; (c) the first oligonucleotide and/or the second oligonucleotide comprise(s) sequence which is not complementary to said template nucleic acid; and (d) said primer sequences define the termini of the template sequence to be amplified.
  • the non-complementary sequence(s) of feature (c) are preferably upstream of (i.e. 5′ to) the primer sequences.
  • One or both of these (c) sequences may comprise a restriction site (e.g. EP-B-0509612) or a promoter sequence (e.g. EP-B-0505012).
  • the first oligonucleotide and/or the second oligonucleotide may include a detectable label (e.g. a fluorescent label).
  • the template sequence may be any part of a genome sequence (e.g. SEQ ID NO:7275).
  • it could be a rRNA gene (e.g. Turenne et al. (2000) J. Clin. Microbiol. 38:513-520; SEQ ID NOS: 12018-12024 herein) or a protein-coding gene.
  • the template sequence is preferably specific to GBS.
  • the invention also provides a computer-readable medium (e.g. a floppy disk, a hard disk, a CD-ROM, a DVD etc.) and/or a computer database containing one or more of the sequences in the sequence listing.
  • a computer-readable medium e.g. a floppy disk, a hard disk, a CD-ROM, a DVD etc.
  • the medium preferably contains one or both of SEQ ID NOS: 7276 and 7275.
  • the invention also provides a hybrid protein represented by the formula NH 2 -A-[-X-L-] n -B-COOH, wherein X is a protein of the invention, L is an optional linker amino acid sequence, A is an optional N-terminal amino acid sequence, B is an optional C-terminal amino acid sequence, and n is an integer greater than 1.
  • the value of n is between 2 and x, and the value of x is typically 3, 4, 5, 6, 7, 8, 9 or 10.
  • linker amino acid sequence -L- may be present or absent.
  • the hybrid may be NH 2 -X 1 -L 1 -X 2 -L 2 -COOH, NH 2 -X 1 -X 2 -COOH, NH 2 -X 1 -L 1 -X 2 -COOH, etc.
  • Linker amino acid sequence(s) -L- will typically be short (e.g. 20 or fewer amino acids i.e. 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1). Examples include short peptide sequences which facilitate cloning, poly-glycine linkers (i.e.
  • Other suitable linker amino acid sequences will be apparent to those skilled in the art.
  • -A- and -B- are optional sequences which will typically be short (e.g. 40 or fewer amino acids i.e. 39, 38, 37, 36, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1).
  • Examples include leader sequences to direct protein trafficking, or short peptide sequences which facilitate cloning or purification (e.g. histidine tags i.e.
  • each X will be a GBS sequence; in others, mixtures of GAS and GBS will be used.
  • the invention provides various processes.
  • a process for producing proteins of the invention comprising the step of culturing a host cell of to the invention under conditions which induce protein expression.
  • a process for producing protein or nucleic acid of the invention wherein the protein or nucleic acid is synthesised in part or in whole using chemical means.
  • a process for detecting polynucleotides of the invention comprising the steps of: (a) contacting a nucleic probe according to the invention with a biological sample under hybridising conditions to form duplexes; and (b) detecting said duplexes.
  • a process for detecting Streptococcus in a biological sample comprising the step of contacting nucleic acid according to the invention with the biological sample under hybridising conditions.
  • the process may involve nucleic acid amplification (e.g. PCR, SDA, SSSR, LCR, TMA, NASBA etc.) or hybridisation (e.g. microarrays, blots, hybridisation with a probe in solution etc.).
  • PCR detection of Streptococcus in clinical samples, in particular S.pyogenes has been reported [see e.g. Louie et al. (2000) CMAJ 163:301-309; Louie et al. (1998) J. Clin. Microbiol. 36:1769-1771].
  • Clinical assays based on nucleic acid are described in general in Tang et al. (1997) Clin. Chem. 43:2021-2038.
  • a process for detecting proteins of the invention comprising the steps of: (a) contacting an antibody of the invention with a biological sample under conditions suitable for the formation of an antibody-antigen complexes; and (b) detecting said complexes.
  • a process for identifying an amino acid sequence comprising the step of searching for putative open reading frames or protein-coding regions within a genome sequence of S.agalactiae . This will typically involve in silico searching the sequence for an initiation codon and for an in-frame termination codon in the downstream sequence. The region between these initiation and termination codons is a putative protein-coding sequence. Typically, all six possible reading frames will be searched. Suitable software for such analysis includes ORFFINDER (NCBI), GENEMARK [Borodovsky & McIninch (1993) Computers Chem. 17:122-133), GLIMMER [Salzberg et al. (1998) Nucleic Acids Res. 26:544-548; Salzberg et al.
  • the invention also provides a protein comprising the identified amino acid sequence. These proteins can then expressed using conventional techniques.
  • the invention also provides a process for determining whether a test compound binds to a protein of the invention. If a test compound binds to a protein of the invention and this binding inhibits the life cycle of the GBS bacterium, then the test compound can be used as an antibiotic or as a lead compound for the design of antibiotics.
  • the process will typically comprise the steps of contacting a test compound with a protein of the invention, and determining whether the test compound binds to said protein.
  • Preferred proteins of the invention for use in these processes are enzymes (e.g. tRNA synthetases), membrane transporters and ribosomal proteins.
  • Suitable test compounds include proteins, polypeptides, carbohydrates, lipids, nucleic acids (e.g.
  • test compounds may be provided individually, but will typically be part of a library (e.g. a combinatorial library).
  • Methods for detecting a binding interaction include NMR, filter-binding assays, gel-retardation assays, displacement assays, surface plasmon resonance, reverse two-hybrid etc.
  • a compound which binds to a protein of the invention can be tested for antibiotic activity by contacting the compound with GBS bacteria and then monitoring for inhibition of growth.
  • the invention also provides a compound identified using these methods.
  • the invention also provides a composition comprising a protein or the invention and one or more of the following antigens:
  • a saccharide or carbohydrate antigen is included, it is preferably conjugated to a carrier protein in order to enhance immunogenicity [e.g. Ramsay et al. (2001) Lancet 357(9251):195-196; Lindberg (1999) Vaccine 17 Suppl 2:S28-36; Conjugate Vaccines (eds. Cruse et al.) ISBN 3805549326, particularly vol. 10:48-114 etc.].
  • Preferred carrier proteins are bacterial toxins or toxoids, such as diphtheria or tetanus toxoids.
  • the CRM 197 diphtheria toxoid is particularly preferred.
  • Other suitable carrier proteins include the N.meningitidis outer membrane protein [e.g.
  • EP-0372501 synthetic peptides [e.g. EP-0378881, EP-0427347], heat shock proteins [e.g. WO93/17712], pertussis proteins [e.g. WO98/58668; EP-0471177], protein D from H.influenzae [e.g. WO00/56360], toxin A or B from C. difficile [e.g. WO00/61761], etc. Any suitable conjugation reaction can be used, with any suitable linker where necessary.
  • Toxic protein antigens may be detoxified where necessary (e.g. detoxification of pertussis toxin by chemical and/or genetic means).
  • diphtheria antigen is included in the composition it is preferred also to include tetanus antigen and pertussis antigens. Similarly, where a tetanus antigen is included it is preferred also to include diphtheria and pertussis antigens. Similarly, where a pertussis antigen is included it is preferred also to include diphtheria and tetanus antigens.
  • Antigens are preferably adsorbed to an aluminium salt.
  • Antigens in the composition will typically be present at a concentration of at least 1 ⁇ g/ml each. In general, the concentration of any given antigen will be sufficient to elicit an immune response against that antigen.
  • the invention also provides compositions comprising two or more proteins of the present invention.
  • the two or more proteins may comprise GBS sequences or may comprise GAS and GBS sequences.
  • a composition containing X is “substantially free of” Y when at least 85% by weight of the total X+Y in the composition is X.
  • X comprises at least about 90% by weight of the total of X+Y in the composition, more preferably at least about 95% or even 99% by weight.
  • composition “comprising” means “including” as well as “consisting” e.g. a composition “comprising” X may consist exclusively of X or may include something additional e.g X+Y.
  • heterologous refers to two biological components that are not found together in nature.
  • the components may be host cells, genes, or regulatory regions, such as promoters.
  • heterologous components are not found together in nature, they can finction together, as when a promoter heterologous to a gene is operably linked to the gene.
  • a streptococcus sequence is heterologous to a mouse host cell.
  • a further examples would be two epitopes from the same or different proteins which have been assembled in a single protein in an arrangement not found in nature.
  • An “origin of replication” is a polynucleotide sequence that initiates and regulates replication of polynucleotides, such as an expression vector.
  • the origin of replication behaves as an autonomous unit of polynucleotide replication within a cell, capable of replication under its own control.
  • An origin of replication may be needed for a vector to replicate in a particular host cell. With certain origins of replication, an expression vector can be reproduced at a high copy number in the presence of the appropriate proteins within the cell. Examples of origins are the autonomously replicating sequences, which are effective in yeast; and the viral T-antigen, effective in COS-7 cells.
  • a “mutant” sequence is defined as DNA, RNA or amino acid sequence differing from but having sequence identity with the native or disclosed sequence. Depending on the particular sequence, the degree of sequence identity between the native or disclosed sequence and the mutant sequence is preferably greater than 50% (eg. 60%, 70%, 80%, 90%, 95%, 99% or more, calculated using the Smith-Waterman algorithm as described above).
  • an “allelic variant” of a nucleic acid molecule, or region, for which nucleic acid sequence is provided herein is a nucleic acid molecule, or region, that occurs essentially at the same locus in the genome of another or second isolate, and that, due to natural variation caused by, for example, mutation or recombination, has a similar but not identical nucleic acid sequence.
  • allelic variant typically encodes a protein having similar activity to that of the protein encoded by the gene to which it is being compared.
  • allelic variant can also comprise an alteration in the 5′ or 3′ untranslated regions of the gene, such as in regulatory control regions (eg. see U.S Pat. 5,753,235).
  • streptococcus nucleotide sequences can be expressed in a variety of different expression systems; for example those used with mammalian cells, baculoviruses, plants, bacteria, and yeast.
  • a mammalian promoter is any DNA sequence capable of binding mammalian RNA polymerase and initiating the downstream (3′) transcription of a coding sequence (eg. structural gene) into MRNA.
  • a promoter will have a transcription initiating region, which is usually placed proximal to the 5′ end of the coding sequence, and a TATA box, usually located 25-30 base pairs (bp) upstream of the transcription initiation site. The TATA box is thought to direct RNA polymerase II to begin RNA synthesis at the correct site.
  • a mammalian promoter will also contain an upstream promoter element, usually located within 100 to 200 bp upstream of the TATA box.
  • An upstream promoter element determines the rate at which transcription is initiated and can act in either orientation [Sambrook et al. (1989) “Expression of Cloned Genes in Mammalian Cells.” In Molecular Cloning: A Laboratory Manual, 2 nd ed.].
  • Mammalian viral genes are often highly expressed and have a broad host range; therefore sequences encoding mammalian viral genes provide particularly useful promoter sequences. Examples include the SV40 early promoter, mouse mammary tumor virus LTR promoter, adenovirus major late promoter (Ad MLP), and herpes simplex virus promoter. In addition, sequences derived from non-viral genes, such as the murine metallotheionin gene, also provide useful promoter sequences. Expression may be either constitutive or regulated (inducible), depending on the promoter can be induced with glucocorticoid in hormone-responsive cells.
  • Enhancer is a regulatory DNA sequence that can stimulate transcription up to 1000-fold when linked to homologous or heterologous promoters, with synthesis beginning at the normal RNA start site. Enhancers are also active when they are placed upstream or downstream from the transcription initiation site, in either normal or flipped orientation, or at a distance of more than 1000 nucleotides from the promoter [Maniatis et al. (1987) Science 236:1237; Alberts et al. (1989) Molecular Biology of the Cell, 2nd ed.]. Enhancer elements derived from viruses may be particularly useful, because they usually have a broader host range.
  • Examples include the SV40 early gene enhancer [Dijkema et al (1985) EMBO J. 4:761] and the enhancer/promoters derived from the long terminal repeat (LTR) of the Rous Sarcoma Virus [Gorman et al. (1982b) Proc. Natl. Acad. Sci. 79:6777] and from human cytomegalovirus [Boshart et al. (1985) Cell 41:521]. Additionally, some enhancers are regulatable and become active only in the presence of an inducer, such as a hormone or metal ion [Sassone-Corsi and Borelli (1986) Trends Genet. 2:215; Maniatis et al. (1987) Science 236:1237].
  • an inducer such as a hormone or metal ion
  • a DNA molecule may be expressed intracellularly in mammalian cells.
  • a promoter sequence may be directly linked with the DNA molecule, in which case the first amino acid at the N-terminus of the recombinant protein will always be a methionine, which is encoded by the ATG start codon. If desired, the N-terminus may be cleaved from the protein by in vitro incubation with cyanogen bromide.
  • foreign proteins can also be secreted from the cell into the growth media by creating chimeric DNA molecules that encode a fusion protein comprised of a leader sequence fragment that provides for secretion of the foreign protein in mammalian cells.
  • a leader sequence fragment that provides for secretion of the foreign protein in mammalian cells.
  • processing sites encoded between the leader fragment and the foreign gene that can be cleaved either in vivo or in vitro.
  • the leader sequence fragment usually encodes a signal peptide comprised of hydrophobic amino acids which direct the secretion of the protein from the cell.
  • the adenovirus tripartite leader is an example of a leader sequence that provides for secretion of a foreign protein in mammalian cells.
  • transcription termination and polyadenylation sequences recognized by mammalian cells are regulatory regions located 3′ to the translation stop codon and thus, together with the promoter elements, flank the coding sequence.
  • the 3′ terminus of the mature mRNA is formed by site-specific post-transcriptional cleavage and polyadenylation [Bimstiel et al. (1985) Cell 41:349; Proudfoot and Whitelaw (1988) “Termination and 3′ end processing of eukaryotic RNA. In Transcription and splicing (ed. B. D. Hames and D. M. Glover); Proudfoot (1989) Trends Biochem. Sci. 14:105].
  • transcription terminater/polyadenylation signals include those derived from SV40 [Sambrook et al (1989) “Expression of cloned genes in cultured mammalian cells.” In Molecular Cloning: A Laboratory Manual].
  • the above described components comprising a promoter, polyadenylation signal, and transcription termination sequence are put together into expression constructs.
  • Enhancers, introns with functional splice donor and acceptor sites, and leader sequences may also be included in an expression construct, if desired.
  • Expression constructs are often maintained in a replicon, such as an extrachromosomal element (eg. plasmids) capable of stable maintenance in a host, such as mammalian cells or bacteria.
  • Mammalian replication systems include those derived from animal viruses, which require trans-acting factors to replicate.
  • plasmids containing the replication systems of papovaviruses such as SV40 [Gluzman (1981) Cell 23:175] or polyomavirus, replicate to extremely high copy number in the presence of the appropriate viral T antigen.
  • mammalian replicons include those derived from bovine papillomavirus and Epstein-Barr virus.
  • the replicon may have two replication systems, thus allowing it to be maintained, for example, in mammalian cells for expression and in a prokaryotic host for cloning and amplification.
  • mammalian-bacteria shuttle vectors include pMT2 [Kaufman et al. (1989) Mol. Cell. Biol. 9:946] and pHEBO [Shimizu et al. (1986) Mol. Cell. Biol. 6:1074].
  • the transformation procedure used depends upon the host to be transformed.
  • Methods for introduction of heterologous polynucleotides into mammalian cells include dextran-mediated transfection, calcium phosphate precipitation, polybrene mediated transfection, protoplast fusion, electroporation, encapsulation of the polynucleotide(s) in liposomes, and direct microinjection of the DNA into nuclei.
  • Mammalian cell lines available as hosts for expression are known in the art and include many immortalized cell lines available from the American Type Culture Collection (ATCC), including but not limited to, Chinese hamster ovary (CHO) cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells (eg. Hep G2), and a number of other cell lines.
  • ATCC American Type Culture Collection
  • CHO Chinese hamster ovary
  • HeLa cells HeLa cells
  • BHK baby hamster kidney cells
  • COS monkey kidney cells
  • human hepatocellular carcinoma cells eg. Hep G2
  • the polynucleotide encoding the protein can also be inserted into a suitable insect expression vector, and is operably linked to the control elements within that vector.
  • Vector construction employs techniques which are known in the art.
  • the components of the expression system include a transfer vector, usually a bacterial plasmid, which contains both a fragment of the baculovirus genome, and a convenient restriction site for insertion of the heterologous gene or genes to be expressed; a wild type baculovirus with a sequence homologous to the baculovirus-specific fragment in the transfer vector (this allows for the homologous recombination of the heterologous gene in to the baculovirus genome); and appropriate insect host cells and growth media.
  • the vector and the wild type viral genome are transfected into an insect host cell where the vector and viral genome are allowed to recombine.
  • the packaged recombinant virus is expressed and recombinant plaques are identified and purified.
  • Materials and methods for baculovirus/insect cell expression systems are commercially available in kit form from, inter alia, Invitrogen, San Diego Calif. (“MaxBac” kit). These techniques are generally known to those skilled in the art and fully described in Summers and Smith, Texas Agricultural Experiment Station Bulletin No. 1555 (1987) (hereinafter “Summers and Smith”).
  • an intermediate transplacement construct Prior to inserting the DNA sequence encoding the protein into the baculovirus genome, the above described components, comprising a promoter, leader (if desired), coding sequence, and transcription termination sequence, are usually assembled into an intermediate transplacement construct (transfer vector).
  • This may contain a single gene and operably linked regulatory elements; multiple genes, each with its owned set of operably linked regulatory elements; or multiple genes, regulated by the same set of regulatory elements.
  • Intermediate transplacement constructs are often maintained in a replicon, such as an extra-chromosomal element (e.g. plasmids) capable of stable maintenance in a host, such as a bacterium.
  • the replicon will have a replication system, thus allowing it to be maintained in a suitable host for cloning and amplification.
  • pAc373 the most commonly used transfer vector for introducing foreign genes into AcNPV.
  • Many other vectors known to those of skill in the art, have also been designed. These include, for example, pVL985 (which alters the polyhedrin start codon from ATG to ATT, and which introduces a BamHI cloning site 32 basepairs downstream from the ATT; see Luckow and Summers, Virology (1989) 17:31.
  • the plasmid usually also contains the polyhedrin polyadenylation signal (Miller et al. (1988) Ann. Rev. Microbiol., 42:177) and a prokaryotic ampicillin-resistance (amp) gene and origin of replication for selection and propagation in E. coli.
  • polyhedrin polyadenylation signal iller et al. (1988) Ann. Rev. Microbiol., 42:177
  • amp prokaryotic ampicillin-resistance
  • Baculovirus transfer vectors usually contain a baculovirus promoter.
  • a baculovirus promoter is any DNA sequence capable of binding a baculovirus RNA polymerase and initiating the downstream (5′ to 3′) transcription of a coding sequence (eg. structural gene) into mRNA.
  • a promoter will have a transcription initiation region which is usually placed proximal to the 5′ end of the coding sequence. This transcription initiation region usually includes an RNA polymerase binding site and a transcription initiation site.
  • a baculovirus transfer vector may also have a second domain called an enhancer, which, if present, is usually distal to the structural gene. Expression may be either regulated or constitutive.
  • Structural genes abundantly transcribed at late times in a viral infection cycle, provide particularly useful promoter sequences. Examples include sequences derived from the gene encoding the viral polyhedron protein, Friesen et al., (1986) “The Regulation of Baculovirus Gene Expression,” in: The Molecular Biology of Baculoviruses (ed. Walter Doerfler); EPO Publ. Nos. 127 839 and 155 476; and the gene encoding the p10 protein, Vlak et al., (1988), J. Gen. Virol. 69:765.
  • DNA encoding suitable signal sequences can be derived from genes for secreted insect or baculovirus proteins, such as the baculovirus polyhedrin gene (Carbonell et al. (1988) Gene, 73:409).
  • the signals for mammalian cell posttranslational modifications such as signal peptide cleavage, proteolytic cleavage, and phosphorylation
  • the signals required for secretion and nuclear accumulation also appear to be conserved between the invertebrate cells and vertebrate cells
  • leaders of non-insect origin such as those derived from genes encoding human ⁇ -interferon, Maeda et al., (1985), Nature 315:592; human gastrin-releasing peptide, Lebacq-Verheyden et al., (1988), Molec.
  • a recombinant polypeptide or polyprotein may be expressed intracellularly or, if it is expressed with the proper regulatory sequences, it can be secreted.
  • Good intracellular expression of nonfused foreign proteins usually requires heterologous genes that ideally have a short leader sequence containing suitable translation initiation signals preceding an ATG start signal. If desired, methionine at the N-terminus may be cleaved from the mature protein by in vitro incubation with cyanogen bromide.
  • recombinant polyproteins or proteins which are not naturally secreted can be secreted from the insect cell by creating chimeric DNA molecules that encode a fusion protein comprised of a leader sequence fragment that provides for secretion of the foreign protein in insects.
  • the leader sequence fragment usually encodes a signal peptide comprised of hydrophobic amino acids which direct the translocation of the protein into the endoplasmic reticulum.
  • an insect cell host After insertion of the DNA sequence and/or the gene encoding the expression product precursor of the protein, an insect cell host is co-transformed with the heterologous DNA of the transfer vector and the genomic DNA of wild type baculovirus—usually by co-transfection.
  • the promoter and transcription termination sequence of the construct will usually comprise a 2-5 kb section of the baculovirus genome.
  • Methods for introducing heterologous DNA into the desired site in the baculovirus virus are known in the art. (See Summers and Smith supra; Ju et al. (1987); Smith et al., Mol. Cell. Biol. (1983) 3:2156; and Luckow and Summers (1989)).
  • the insertion can be into a gene such as the polyhedrin gene, by homologous double crossover recombination; insertion can also be into a restriction enzyme site engineered into the desired baculovirus gene. Miller et al., (1989), Bioessays 4:91.
  • the DNA sequence, when cloned in place of the polyhedrin gene in the expression vector, is flanked both 5′ and 3′ by polyhedrin-specific sequences and is positioned downstream of the polyhedrin promoter.
  • the newly formed baculovirus expression vector is subsequently packaged into an infectious recombinant baculovirus. Homologous recombination occurs at low frequency (between about 1% and about 5%); thus, the majority of the virus produced after cotransfection is still wild-type virus. Therefore, a method is necessary to identify recombinant viruses.
  • An advantage of the expression system is a visual screen allowing recombinant viruses to be distinguished.
  • the polyhedrin protein which is produced by the native virus, is produced at very high levels in the nuclei of infected cells at late times after viral infection. Accumulated polyhedrin protein forms occlusion bodies that also contain embedded particles.
  • occlusion bodies up to 15 ⁇ m in size, are highly refractile, giving them a bright shiny appearance that is readily visualized under the light microscope.
  • Cells infected with recombinant viruses lack occlusion bodies.
  • the transfection supernatant is plaqued onto a monolayer of insect cells by techniques known to those skilled in the art. Namely, the plaques are screened under the light microscope for the presence (indicative of wild-type virus) or absence (indicative of recombinant virus) of occlusion bodies. “Current Protocols in Microbiology” Vol. 2 (Ausubel et al. eds) at 16.8 (Supp. 10, 1990); Summers and Smith, supra; Miller et al. (1989).
  • Recombinant baculovirus expression vectors have been developed for infection into several insect cells.
  • recombinant baculoviruses have been developed for, inter alia: Aedes aegypti , Autographa californica, Bombyx mori, Drosophila melanogaster, Spodoptera frugiperda , and Trichoplusia ni (WO 89/046699; Carbonell et al., (1985) J. Virol. 56:153; Wright (1986) Nature 321:718; Smith et al., (1983) Mol. Cell. Biol. 3:2156; and see generally, Fraser, et al. (1989) In Vitro Cell. Dev. Biol. 25:225).
  • Cells and cell culture media are commercially available for both direct and fusion expression of heterologous polypeptides in a baculovirus/expression system; cell culture technology is generally known to those skilled in the art. See, eg. Summers and Smith supra.
  • the modified insect cells may then be grown in an appropriate nutrient medium, which allows for stable maintenance of the plasmid(s) present in the modified insect host.
  • the expression product gene is under inducible control, the host may be grown to high density, and expression induced.
  • the product will be continuously expressed into the medium and the nutrient medium must be continuously circulated, while removing the product of interest and augmenting depleted nutrients.
  • the product may be purified by such techniques as chromatography, eg. HPLC, affinity chromatography, ion exchange chromatography, etc.; electrophoresis; density gradient centrifugation; solvent extraction, etc.
  • the product may be further purified, as required, so as to remove substantially any insect proteins which are also present in the medium, so as to provide a product which is at least substantially free of host debris, eg. proteins, lipids and polysaccharides.
  • recombinant host cells derived from the transformants are incubated under conditions which allow expression of the recombinant protein encoding sequence. These conditions will vary, dependent upon the host cell selected. However, the conditions are readily ascertainable to those of ordinary skill in the art, based upon what is known in the art.
  • a desired polynucleotide sequence is inserted into an expression cassette comprising genetic regulatory elements designed for operation in plants.
  • the expression cassette is inserted into a desired expression vector with companion sequences upstream and downstream from the expression cassette suitable for expression in a plant host.
  • the companion sequences will be of plasmid or viral origin and provide necessary characteristics to the vector to permit the vectors to move DNA from an original cloning host, such as bacteria, to the desired plant host.
  • the basic bacterial/plant vector construct will preferably provide a broad host range prokaryote replication origin; a prokaryote selectable marker; and, for Agrobacterium transformations, T DNA sequences for Agrobacterium-mediated transfer to plant chromosomes.
  • the construct will preferably also have a selectable marker gene suitable for determining if a plant cell has been transformed.
  • a selectable marker gene suitable for determining if a plant cell has been transformed is found in Wilmink and Dons, 1993, Plant Mol. Biol. Reptr, 11(2):165-185.
  • Sequences suitable for permitting integration of the heterologous sequence into the plant genome are also recommended. These might include transposon sequences and the like for homologous recombination as well as Ti sequences which permit random insertion of a heterologous expression cassette into a plant genome. Suitable prokaryote selectable markers include resistance toward antibiotics such as ampicillin or tetracycline. Other DNA sequences encoding additional functions may also be present in the vector, as is known in the art.
  • the nucleic acid molecules of the subject invention may be included into an expression cassette for expression of the protein(s) of interest.
  • the recombinant expression cassette will contain in addition to the heterologous protein encoding sequence the following elements, a promoter region, plant 5′ untranslated sequences, initiation codon depending upon whether or not the structural gene comes equipped with one, and a transcription and translation termination sequence.
  • Unique restriction enzyme sites at the 5′ and 3′ ends of the cassette allow for easy insertion into a pre-existing vector.
  • a heterologous coding sequence may be for any protein relating to the present invention.
  • the sequence encoding the protein of interest will encode a signal peptide which allows processing and translocation of the protein, as appropriate, and will usually lack any sequence which might result in the binding of the desired protein of the invention to a membrane. Since, for the most part, the transcriptional initiation region will be for a gene which is expressed and translocated during germination, by employing the signal peptide which provides for translocation, one may also provide for translocation of the protein of interest. In this way, the protein(s) of interest will be translocated from the cells in which they are expressed and may be efficiently harvested.
  • the ultimate expression of the desired gene product will be in a eucaryotic cell it is desirable to determine whether any portion of the cloned gene contains sequences which will be processed out as introns by the host's splicosome machinery. If so, site-directed mutagenesis of the “intron” region may be conducted to prevent losing a portion of the genetic message as a false intron code, Reed and Maniatis, Cell 41:95-105, 1985.
  • the vector can be microinjected directly into plant cells by use of micropipettes to mechanically transfer the recombinant DNA. Crossway, Mol. Gen. Genet, 202:179-185, 1985.
  • the genetic material may also be transferred into the plant cell by using polyethylene glycol, Krens, et al., Nature, 296, 72-74, 1982.
  • Another method of introduction of nucleic acid segments is high velocity ballistic penetration by small particles with the nucleic acid either within the matrix of small beads or particles, or on the surface, Klein, et al., Nature, 327, 70-73, 1987 and Knudsen and Muller, 1991, Planta, 185:330-336 teaching particle bombardment of barley endosperm to create transgenic barley.
  • Yet another method of introduction would be fusion of protoplasts with other entities, either minicells, cells, lysosomes or other fusible lipid-surfaced bodies, Fraley, et al., Proc. Natl. Acad. Sci. USA, 79, 1859-1863, 1982.
  • the vector may also be introduced into the plant cells by electroporation. (Fromm et al., Proc. Natl Acad. Sci. USA 82:5824, 1985).
  • plant protoplasts are electroporated in the presence of plasmids containing the gene construct. Electrical impulses of high field strength reversibly permeabilize biomembranes allowing the introduction of the plasmids. Electroporated plant protoplasts reform the cell wall, divide, and form plant callus.
  • All plants from which protoplasts can be isolated and cultured to give whole regenerated plants can be transformed by the present invention so that whole plants are recovered which contain the transferred gene. It is known that practically all plants can be regenerated from cultured cells or tissues, including but not limited to all major species of sugarcane, sugar beet, cotton, fruit and other trees, legumes and vegetables.
  • Some suitable plants include, for example, species from the genera Fragaria, Lotus, Medicago, Onobrychis, Trifolium, Trigonella, Vigna, Citrus, Linum, Geranium, Manihot, Daucus, Arabidopsis, Brassica, Raphanus, Sinapis, Atropa, Capsicum, Datura, Hyoscyamus, Lycopersion, Nicotiana, Solanum, Petunia, Digitalis, Majorana, Cichorium, Helianthus, Lactuca, Bromus, Asparagus, Antirrhinum, Hererocallis, Nemesia, Pelargonium, Panicum, Pennisetum, Ranunculus, Senecio, Salpiglossis, Cucumis, Browaalia, Glycine, Lolium, Zea, Triticum, Sorghum , and Datura.
  • Means for regeneration vary from species to species of plants, but generally a suspension of transformed protoplasts containing copies of the heterologous gene is first provided. Callus tissue is formed and shoots may be induced from callus and subsequently rooted. Alternatively, embryo formation can be induced from the protoplast suspension. These embryos germinate as natural embryos to form plants.
  • the culture media will generally contain various amino acids and hormones, such as auxin and cytokinins. It is also advantageous to add glutamic acid and proline to the medium, especially for such species as corn and alfalfa. Shoots and roots normally develop simultaneously. Efficient regeneration will depend on the medium, on the genotype, and on the history of the culture. If these three variables are controlled, then regeneration is fully reproducible and repeatable.
  • the desired protein of the invention may be excreted or alternatively, the protein may be extracted from the whole plant. Where the desired protein of the invention is secreted into the medium, it may be collected. Alternatively, the embryos and embryoless-half seeds or other plant tissue may be mechanically disrupted to release any secreted protein between cells and tissues. The mixture may be suspended in a buffer solution to retrieve soluble proteins. Conventional protein isolation and purification methods will be then used to purify the recombinant protein. Parameters of time, temperature pH, oxygen, and volumes will be adjusted through routine methods to optimize expression and recovery of heterologous protein.
  • a bacterial promoter is any DNA sequence capable of binding bacterial RNA polymerase and initiating the downstream (3′ ) transcription of a coding sequence (eg. structural gene) into MRNA.
  • a promoter will have a transcription initiation region which is usually placed proximal to the 5′ end of the coding sequence. This transcription initiation region usually includes an RNA polymerase binding site and a transcription initiation site.
  • a bacterial promoter may also have a second domain called an operator, that may overlap an adjacent RNA polymerase binding site at which RNA synthesis begins. The operator permits negative regulated (inducible) transcription, as a gene repressor protein may bind the operator and thereby inhibit transcription of a specific gene.
  • Constitutive expression may occur in the absence of negative regulatory elements, such as the operator.
  • positive regulation may be achieved by a gene activator protein binding sequence, which, if present is usually proximal (5′ ) to the RNA polymerase binding sequence.
  • An example of a gene activator protein is the catabolite activator protein (CAP), which helps initiate transcription of the lac operon in Escherichia coli ( E.coli ) [Raibaud et al. (1984) Annu. Rev. Genet. 18:173].
  • Regulated expression may therefore be either positive or negative, thereby either enhancing or reducing transcription.
  • Sequences encoding metabolic pathway enzymes provide particularly useful promoter sequences. Examples include promoter sequences derived from sugar metabolizing enzymes, such as galactose, lactose (lac) [Chang et al. (1977) Nature 198:1056], and maltose. Additional examples include promoter sequences derived from biosynthetic enzymes such as tryptophan (trp) [Goeddel et al. (1980) Nuc. Acids Res. 8:4057; Yelverton et al. (1981) Nucl. Acids Res. 9:731; U.S. Pat. No. 4,738,921; EP-A-0036776 and EP-A-0121775].
  • sugar metabolizing enzymes such as galactose, lactose (lac) [Chang et al. (1977) Nature 198:1056]
  • maltose additional examples include promoter sequences derived from biosynthetic enzymes such as tryptophan (
  • synthetic promoters which do not occur in nature also finction as bacterial promoters.
  • transcription activation sequences of one bacterial or bacteriophage promoter may be joined with the operon sequences of another bacterial or bacteriophage promoter, creating a synthetic hybrid promoter [U.S. Pat. No. 4,551,433].
  • the tac promoter is a hybrid trp-lac promoter comprised of both trp promoter and lac operon sequences that is regulated by the lac repressor [Amann et al. (1983) Gene 25:167; de Boer et al. (1983) Proc. Natl. Acad. Sci. 80:21].
  • a bacterial promoter can include naturally occurring promoters of non-bacterial origin that have the ability to bind bacterial RNA polymerase and initiate transcription.
  • a naturally occurring promoter of non-bacterial origin can also be coupled with a compatible RNA polymerase to produce high levels of expression of some genes in prokaryotes.
  • the bacteriophage T7 RNA polymerase/promoter system is an example of a coupled promoter system [Studier et al. (1986) J. Mol. Biol. 189:113; Tabor et al. (1985) Proc Natl. Acad. Sci. 82:1074].
  • a hybrid promoter can also be comprised of a bacteriophage promoter and an E.coli operator region (EPO-A-0 267 851).
  • an efficient ribosome binding site is also useful for the expression of foreign genes in prokaryotes.
  • the ribosome binding site is called the Shine-Dalgarno (SD) sequence and includes an initiation codon (ATG) and a sequence 3-9 nucleotides in length located 3-11 nucleotides upstream of the initiation codon [Shine et al. (1975) Nature 254:34].
  • SD sequence is thought to promote binding of mRNA to the ribosome by the pairing of bases between the SD sequence and the 3′ and of E.coli 16S rRNA [Steitz et al.
  • a DNA molecule may be expressed intracellularly.
  • a promoter sequence may be directly linked with the DNA molecule, in which case the first amino acid at the N-terminus will always be a methionine, which is encoded by the ATG start codon. If desired, methionine at the N-terminus may be cleaved from the protein by in vitro incubation with cyanogen bromide or by either in vivo on in vitro incubation with a bacterial methionine N-terminal peptidase (EP-A-0 219 237).
  • Fusion proteins provide an alternative to direct expression. Usually, a DNA sequence encoding the N-terminal portion of an endogenous bacterial protein, or other stable protein, is fused to the 5′ end of heterologous coding sequences. Upon expression, this construct will provide a fusion of the two amino acid sequences.
  • the bacteriophage lambda cell gene can be linked at the 5′ terminus of a foreign gene and expressed in bacteria.
  • the resulting fusion protein preferably retains a site for a processing enzyme (factor Xa) to cleave the bacteriophage protein from the foreign gene [Nagai et al. (1984) Nature 309:810]. Fusion proteins can also be made with sequences from the lacZ [Jia et al.
  • the DNA sequence at the junction of the two amino acid sequences may or may not encode a cleavable site.
  • a ubiquitin fusion protein is made with the ubiquitin region that preferably retains a site for a processing enzyme (eg. ubiquitin specific processing-protease) to cleave the ubiquitin from the foreign protein.
  • a processing enzyme eg. ubiquitin specific processing-protease
  • foreign proteins can also be secreted from the cell by creating chimeric DNA molecules that encode a fusion protein comprised of a signal peptide sequence fragment that provides for secretion of the foreign protein in bacteria [U.S. Pat. No. 4,336,336].
  • the signal sequence fragment usually encodes a signal peptide comprised of hydrophobic amino acids which direct the secretion of the protein from the cell.
  • the protein is either secreted into the growth media (gram-positive bacteria) or into the periplasmic space, located between the inner and outer membrane of the cell (gram-negative bacteria).
  • processing sites which can be cleaved either in vivo or in vitro encoded between the signal peptide fragment and the foreign gene.
  • DNA encoding suitable signal sequences can be derived from genes for secreted bacterial proteins, such as the E.coli outer membrane protein gene (ompA) [Masui et al. (1983), in: Experimental Manipulation of Gene Expression ; Ghrayeb et al. (1984) EMBO J. 3:2437] and the E.coli alkaline phosphatase signal sequence (phoA) [Oka et al. (1985) Proc. Natl. Acad. Sci. 82:7212].
  • the signal sequence of the alpha-amylase gene from various Bacillus strains can be used to secrete heterologous proteins from B. subtilis [Palva et al. (1982) Proc. Nat. Acad. Sci. USA 79:5582; EP-A-0 244 042].
  • transcription termination sequences recognized by bacteria are regulatory regions located 3′ to the translation stop codon, and thus together with the promoter flank the coding sequence. These sequences direct the transcription of an mRNA which can be translated into the polypeptide encoded by the DNA. Transcription termination sequences frequently include DNA sequences of about 50 nucleotides capable of forming stem loop structures that aid in terminating transcription. Examples include transcription termination sequences derived from genes with strong promoters, such as the trp gene in E. coli as well as other biosynthetic genes.
  • expression constructs are often maintained in a replicon, such as an extrachromosomal element (eg. plasmids) capable of stable maintenance in a host, such as bacteria.
  • a replicon will have a replication system, thus allowing it to be maintained in a prokaryotic host either for expression or for cloning and amplification.
  • a replicon may be either a high or low copy number plasmid.
  • a high copy number plasmid will generally have a copy number ranging from about 5 to about 200, and usually about 10 to about 150.
  • a host containing a high copy number plasmid will preferably contain at least about 10, and more preferably at least about 20 plasmids. Either a high or low copy number vector may be selected, depending upon the effect of the vector and the foreign protein on the host.
  • the expression constructs can be integrated into the bacterial genome with an integrating vector.
  • Integrating vectors usually contain at least one sequence homologous to the bacterial chromosome that allows the vector to integrate. Integrations appear to result from recombinations between homologous DNA in the vector and the bacterial chromosome.
  • integrating vectors constructed with DNA from various Bacillus strains integrate into the Bacillus chromosome (EP-A-0 127 328). Integrating vectors may also be comprised of bacteriophage or transposon sequences.
  • extrachromosomal and integrating expression constructs may contain selectable markers to allow for the selection of bacterial strains that have been transformed.
  • Selectable markers can be expressed in the bacterial host and may include genes which render bacteria resistant to drugs such as ampicillin, chloramphenicol, erythromycin, kanamycin (neomycin), and tetracycline [Davies et al. (1978) Annu. Rev. Microbiol. 32:469].
  • Selectable markers may also include biosynthetic genes, such as those in the histidine, tryptophan, and leucine biosynthetic pathways.
  • Transformation vectors are usually comprised of a selectable market that is either maintained in a replicon or developed into an integrating vector, as described above.
  • Expression and transformation vectors have been developed for transformation into many bacteria.
  • expression vectors have been developed for, inter alia, the following bacteria: Bacillus subtilis [Palva et al. (1982) Proc. Natl. Acad. Sci. USA 79:5582; EP-A-0 036 259 and EP-A-0 063 953; WO 84/04541], Escherichia coli [Shimatake et al. (1981) Nature 292:128; Amann et al. (1985) Gene 40:183; Studier et al. (1986) J. Mol. Biol.
  • Methods of introducing exogenous DNA into bacterial hosts are well-known in the art, and usually include either the transformation of bacteria treated with CaCl 2 or other agents, such as divalent cations and DMSO.
  • DNA can also be introduced into bacterial cells by electroporation. Transformation procedures usually vary with the bacterial species to be transformed. See eg. [Masson et al. (1989) FEMS Microbiol. Lett. 60:273; Palva et al. (1982) Proc. Natl. Acad. Sci. USA 79:5582; EP-A-0 036 259 and EP-A-0 063 953; WO 84/04541, Bacillus ], [Miller et al. (1988) Proc. Natl. Acad.
  • a yeast promoter is any DNA sequence capable of binding yeast RNA polymerase and initiating the downstream (3′ ) transcription of a coding sequence (eg. structural gene) into mRNA.
  • a promoter will have a transcription initiation region which is usually placed proximal to the 5′ end of the coding sequence. This transcription initiation region usually includes an RNA polymerase binding site (the “TATA Box”) and a transcription initiation site.
  • a yeast promoter may also have a second domain called an upstream activator sequence (UAS), which, if present, is usually distal to the structural gene.
  • the UAS permits regulated (inducible) expression. Constitutive expression occurs in the absence of a UAS. Regulated expression may be either positive or negative, thereby either enhancing or reducing transcription.
  • Yeast is a fermenting organism with an active metabolic pathway, therefore sequences encoding enzymes in the metabolic pathway provide particularly useful promoter sequences. Examples include alcohol dehydrogenase (ADH) (EP-A-0 284 044), enolase, glucokinase, glucose-6-phosphate isomerase, glyceraldehyde-3-phosphate-dehydrogenase (GAP or GAPDH), hexokinase, phosphofructokinase, 3-phosphoglycerate mutase, and pyruvate kinase (PyK) (EPO-A-0 329 203).
  • the yeast PHO5 gene encoding acid phosphatase, also provides useful promoter sequences [Myanohara et al. (1983) Proc. Natl. Acad. Sci. USA 80:1].
  • synthetic promoters which do not occur in nature also finction as yeast promoters.
  • UAS sequences of one yeast promoter may be joined with the transcription activation region of another yeast promoter, creating a synthetic hybrid promoter.
  • hybrid promoters include the ADH regulatory sequence linked to the GAP transcription activation region (U.S. Pat. Nos. 4,876,197 and 4,880,734).
  • Other examples of hybrid promoters include promoters which consist of the regulatory sequences of either the ADH2, GAL4, GAL10, OR PHO5 genes, combined with the transcriptional activation region of a glycolytic enzyme gene such as GAP or PyK (EP-A-0 164 556).
  • a yeast promoter can include naturally occurring promoters of non-yeast origin that have the ability to bind yeast RNA polymerase and initiate transcription. Examples of such promoters include, inter alia, [Cohen et al. (1980) Proc. Natl. Acad. Sci. USA 77:1078; Henikoff et al. (1981) Nature 283:835; Hollenberg et al. (1981) Curr. Topics Microbiol. Immunol. 96:119; Hollenberg et al. (1979) “The Expression of Bacterial Antibiotic Resistance Genes in the Yeast Saccharomyces cerevisiae ,” in: Plasmids of Medical, Environmental and Commercial Importance (eds. K. N. Timmis and A. Puhler); Mercerau-Puigalon et al. (1980) Gene 11:163; Panthier et al. (1980) Curr. Genet. 2:109;].
  • a DNA molecule may be expressed intracellularly in yeast.
  • a promoter sequence may be directly linked with the DNA molecule, in which case the first amino acid at the N-terminus of the recombinant protein will always be a methionine, which is encoded by the ATG start codon. If desired, methionine at the N-terminus may be cleaved from the protein by in vitro incubation with cyanogen bromide.
  • Fusion proteins provide an alternative for yeast expression systems, as well as in mammalian, baculovirus, and bacterial expression systems.
  • a DNA sequence encoding the N-terninal portion of an endogenous yeast protein, or other stable protein is fused to the 5′ end of heterologous coding sequences.
  • this construct will provide a fusion of the two amino acid sequences.
  • the yeast or human superoxide dismutase (SOD) gene can be linked at the 5′ terminus of a foreign gene and expressed in yeast.
  • the DNA sequence at the junction of the two amino acid sequences may or may not encode a cleavable site. See eg. EP-A-0 196 056.
  • a ubiquitin fusion protein is made with the ubiquitin region that preferably retains a site for a processing enzyme (eg. ubiquitin-specific processing protease) to cleave the ubiquitin from the foreign protein.
  • a processing enzyme eg. ubiquitin-specific processing protease
  • native foreign protein can be isolated (eg. WO88/024066).
  • foreign proteins can also be secreted from the cell into the growth media by creating chimeric DNA molecules that encode a fusion protein comprised of a leader sequence fragment that provide for secretion in yeast of the foreign protein.
  • a leader sequence fragment that provide for secretion in yeast of the foreign protein.
  • processing sites encoded between the leader fragment and the foreign gene that can be cleaved either in vivo or in vitro.
  • the leader sequence fragment usually encodes a signal peptide comprised of hydrophobic amino acids which direct the secretion of the protein from the cell.
  • DNA encoding suitable signal sequences can be derived from genes for secreted yeast proteins, such as the yeast invertase gene (EP-A-0 012 873; JPO. 62,096,086) and the A-factor gene (U.S. Pat. No. 4,588,684).
  • leaders of non-yeast origin such as an interferon leader, exist that also provide for secretion in yeast (EP-A-0 060 057).
  • a preferred class of secretion leaders are those that employ a fragment of the yeast alpha-factor gene, which contains both a “pre” signal sequence, and a “pro” region.
  • the types of alpha-factor fragments that can be employed include the full-length pre-pro alpha factor leader (about 83 amino acid residues) as well as truncated alpha-factor leaders (usually about 25 to about 50 amino acid residues) (U.S. Pat. Nos. 4,546,083 and 4,870,008; EP-A-0 324 274).
  • Additional leaders employing an alpha-factor leader fragment that provides for secretion include hybrid alpha-factor leaders made with a presequence of a first yeast, but a pro-region from a second yeast alphafactor. (eg. see WO 89/02463.)
  • transcription termination sequences recognized by yeast are regulatory regions located 3′ to the translation stop codon, and thus together with the promoter flank the coding sequence. These sequences direct the transcription of an mRNA which can be translated into the polypeptide encoded by the DNA. Examples of transcription terminator sequence and other yeast-recognized termination sequences, such as those coding for glycolytic enzymes.
  • Expression constructs are often maintained in a replicon, such as an extrachromosomal element (eg. plasmids) capable of stable maintenance in a host, such as yeast or bacteria.
  • the replicon may have two replication systems, thus allowing it to be maintained, for example, in yeast for expression and in a prokaryotic host for cloning and amplification.
  • yeast-bacteria shuttle vectors include YEp24 [Botstein et al. (1979) Gene 8:17-24], pCl/1 [Brake et al. (1984) Proc. Natl. Acad.
  • a replicon may be either a high or low copy number plasmid.
  • a high copy number plasmid will generally have a copy number ranging from about 5 to about 200, and usually about 10 to about 150.
  • a host containing a high copy number plasmid will preferably have at least about 10, and more preferably at least about 20. Enter a high or low copy number vector may be selected, depending upon the effect of the vector and the foreign protein on the host. See eg. Brake et al., supra.
  • the expression constructs can be integrated into the yeast genome with an integrating vector.
  • Integrating vectors usually contain at least one sequence homologous to a yeast chromosome that allows the vector to integrate, and preferably contain two homologous sequences flanking the expression construct. Integrations appear to result from recombinations between homologous DNA in the vector and the yeast chromosome [Orr-Weaver et al. (1983) Methods in Enzymol. 101:228-245].
  • An integrating vector may be directed to a specific locus in yeast by selecting the appropriate homologous sequence for inclusion in the vector. See Orr-Weaver et al., supra.
  • One or more expression construct may integrate, possibly affecting levels of recombinant protein produced [Rine et al.
  • the chromosomal sequences included in the vector can occur either as a single segment in the vector, which results in the integration of the entire vector, or two segments homologous to adjacent segments in the chromosome and flanking the expression construct in the vector, which can result in the stable integration of only the expression construct.
  • extrachromosomal and integrating expression constructs may contain selectable markers to allow for the selection of yeast strains that have been transformed.
  • Selectable markers may include biosynthetic genes that can be expressed in the yeast host, such as ADE2, HIS4, LEU2, TRP1, and ALG7, and the G418 resistance gene, which confer resistance in yeast cells to tunicamycin and G418, respectively.
  • a suitable selectable marker may also provide yeast with the ability to grow in the presence of toxic compounds, such as metal.
  • the presence of CUP1 allows yeast to grow in the presence of copper ions [Butt et al. (1987) Microbiol, Rev. 51:351].
  • Transformation vectors are usually comprised of a selectable marker that is either maintained in a replicon or developed into an integrating vector, as described above.
  • Expression and transformation vectors have been developed for transformation into many yeasts.
  • expression vectors have been developed for, inter alia, the following yeasts: Candida albicans [Kurtz, et al. (1986) Mol. Cell. Biol. 6:142], Candida maltosa [Kunze, et al. (1985) J. Basic Microbiol. 25:141]. Hansenula polymorpha [Gleeson, et al. (1986) J. Gen. Microbiol. 132:3459; Roggenkamp et al. (1986) Mol. Gen. Genet. 202:302], Kluyveromyces fragilis [Das, et al. (1984) J.
  • Methods of introducing exogenous DNA into yeast hosts are well-known in the art, and usually include either the transformation of spheroplasts or of intact yeast cells treated with alkali cations. Transformation procedures usually vary with the yeast species to be transformed. See eg. [Kurtz et al. (1986) Mol. Cell. Biol. 6:142; Kunze et al. (1985) J. Basic Microbiol. 25:141; Candida ]; [Gleeson et al. (1986) J. Gen. Microbiol. 132:3459; Roggenkamp et al. (1986) Mol. Gen. Genet. 202:302; Hansenula ]; [Das et al. (1984) J. Bacteriol.
  • antibody refers to a polypeptide or group of polypeptides composed of at least one antibody combining site.
  • An “antibody combining site” is the three-dimensional binding space with an internal surface shape and charge distribution complementary to the features of an epitope of an antigen, which allows a binding of the antibody with the antigen.
  • Antibody includes, for example, vertebrate antibodies, hybrid antibodies, chimeric antibodies, humanised antibodies, altered antibodies, univalent antibodies, Fab proteins, and single domain antibodies.
  • Antibodies against the proteins of the invention are useful for affinity chromatography, immunoassays, and distinguishing/identifying streptococcus proteins.
  • Antibodies to the proteins of the invention may be prepared by conventional methods.
  • the protein is first used to immunize a suitable animal, preferably a mouse, rat, rabbit or goat. Rabbits and goats are preferred for the preparation of polyclonal sera due to the volume of serum obtainable, and the availability of labeled anti-rabbit and anti-goat antibodies.
  • Immunization is generally performed by mixing or emulsifying the protein in saline, preferably in an adjuvant such as Freund's complete adjuvant, and injecting the mixture or emulsion parenterally (generally subcutaneously or intramuscularly). A dose of 50-200 ⁇ g/injection is typically sufficient.
  • Immunization is generally boosted 2-6 weeks later with one or more injections of the protein in saline, preferably using Freund's incomplete adjuvant.
  • Polyclonal antisera is obtained by bleeding the immunized animal into a glass or plastic container, incubating the blood at 25° C. for one hour, followed by incubating at 4° C. for 2-18 hours. The serum is recovered by centrifugation (eg. 1,000g for 10 minutes). About 20-50 ml per bleed may be obtained from rabbits.
  • Monoclonal antibodies are prepared using the standard method of Kohler & Milstein [ Nature (1975) 256:495-96], or a modification thereof.
  • a mouse or rat is immunized as described above.
  • the spleen (and optionally several large lymph nodes) is removed and dissociated into single cells.
  • the spleen cells may be screened (after removal of nonspecifically adherent cells) by applying a cell suspension to a plate or well coated with the protein antigen.
  • B-cells expressing membrane-bound immunoglobulin specific for the antigen bind to the plate, and are not rinsed away with the rest of the suspension.
  • Resulting B-cells, or all dissociated spleen cells are then induced to fuse with myeloma cells to form hybridomas, and are cultured in a selective medium (eg hypoxanthine, aminopterin, thymidine medium, “HAT”).
  • a selective medium eg hypoxanthine, aminopterin, thymidine medium, “HAT”.
  • the resulting hybridomas are plated by limiting dilution, and are assayed for production of antibodies which bind specifically to the immunizing antigen (and which do not bind to unrelated antigens).
  • the selected MAb-secreting hybridomas are then cultured either in vitro (eg. in tissue culture bottles or hollow fiber reactors), or in vivo (as ascites in mice).
  • the antibodies may be labeled using conventional techniques. Suitable labels include fluorophores, chromophores, radioactive atoms (particularly 32 P and 25 I), electron-dense reagents, enzymes, and ligands having specific binding partners. Enzymes are typically detected by their activity. For example, horseradish peroxidase is usually detected by its ability to convert 3,3′,5,5′-tetramethylbenzidine (TMB) to a blue pigment, quantifiable with a spectrophotometer. “Specific binding partner” refers to a protein capable of binding a ligand molecule with high specificity, as for example in the case of an antigen and a monoclonal antibody specific therefor.
  • 125 I may serve as a radioactive label or as an electron-dense reagent.
  • HRP may serve as enzyme or as antigen for a MAb.
  • MAbs and avidin also require labels in the practice of this invention: thus, one might label a MAb with biotin, and detect its presence with avidin labeled with 125 I, or with an anti-biotin MAb labeled with HRP.
  • Other permutations and possibilities will be readily apparent to those of ordinary skill in the art, and are considered as equivalents within the scope of the instant invention.
  • compositions can comprise either polypeptides, antibodies, or nucleic acid of the invention.
  • the pharmaceutical compositions will comprise a therapeutically effective amount of either polypeptides, antibodies, or polynucleotides of the claimed invention.
  • therapeutically effective amount refers to an amount of a therapeutic agent to treat, ameliorate, or prevent a desired disease or condition, or to exhibit a detectable therapeutic or preventative effect.
  • the effect can be detected by, for example, chemical markers or antigen levels.
  • Therapeutic effects also include reduction in physical symptoms, such as decreased body temperature.
  • the precise effective amount for a subject will depend upon the subject's size and health, the nature and extent of the condition, and the therapeutics or combination of therapeutics selected for administration. Thus, it is not useful to specify an exact effective amount in advance. However, the effective amount for a given situation can be determined by routine experimentation and is within the judgement of the clinician.
  • an effective dose will be from about 0.01 mg/ kg to 50 mg/kg or 0.05 mg/kg to about 10 mg/kg of the molecule of the invention in the individual to which it is administered.
  • a pharmaceutical composition can also contain a pharmaceutically acceptable carrier.
  • pharmaceutically acceptable carrier refers to a carrier for administration of a therapeutic agent, such as antibodies or a polypeptide, genes, and other therapeutic agents.
  • the term refers to any pharmaceutical carrier that does not itself induce the production of antibodies harmful to the individual receiving the composition, and which may be administered without undue toxicity.
  • Suitable carriers may be large, slowly metabolized macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, and inactive virus particles. Such carriers are well known to those of ordinary skill in the art.
  • Pharmaceutically acceptable salts can be used therein, for example, mineral acid salts such as hydrochlorides, hydrobromides, phosphates, sulfates, and the like; and the salts of organic acids such as acetates, propionates, malonates, benzoates, and the like.
  • mineral acid salts such as hydrochlorides, hydrobromides, phosphates, sulfates, and the like
  • organic acids such as acetates, propionates, malonates, benzoates, and the like.
  • compositions may contain liquids such as water, saline, glycerol and ethanol. Additionally, auxiliary substances, such as wetting or emulsifying agents, pH buffering substances, and the like, may be present in such vehicles.
  • the therapeutic compositions are prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection may also be prepared. Liposomes are included within the definition of a pharmaceutically acceptable carrier.
  • compositions of the invention can be administered directly to the subject.
  • the subjects to be treated can be animals; in particular, human subjects can be treated.
  • Direct delivery of the compositions will generally be accomplished by injection, either subcutaneously, intraperitoneally, intravenously or intramuscularly or delivered to the interstitial space of a tissue.
  • the compositions can also be administered into a lesion.
  • Other modes of administration include oral and pulmonary administration, suppositories, and transdermal or transcutaneous applications (eg. see WO98/20734), needles, and gene guns or hyposprays.
  • Dosage treatment may be a single dose schedule or a multiple dose schedule.
  • Vaccines according to the invention may either be prophylactic (ie. to prevent infection) or therapeutic (ie. to treat disease after infection).
  • Such vaccines comprise immunising antigen(s), immunogen(s), polypeptide(s), protein(s) or nucleic acid, usually in combination with “pharmaceutically acceptable carriers,” which include any carrier that does not itself induce the production of antibodies harmful to the individual receiving the composition.
  • Suitable carriers are typically large, slowly metabolized macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, lipid aggregates (such as oil droplets or liposomes), and inactive virus particles.
  • Such carriers are well known to those of ordinary skill in the art. Additionally, these carriers may function as immunostimulating agents (“adjuvants”).
  • the antigen or immunogen may be conjugated to a bacterial toxoid, such as a toxoid from diphtheria, tetanus, cholera, H. pylori , etc. pathogens.
  • a bacterial toxoid such as a toxoid from diphtheria, tetanus, cholera, H. pylori , etc. pathogens.
  • Preferred adjuvants to enhance effectiveness of the composition include, but are not limited to: (1) oil-in-water emulsion formulations (with or without other specific immunostimulating agents such as muramyl peptides (see below) or bacterial cell wall components), such as for example (a) MF59TM (WO90/14837; Chapter 10 in Vaccine Design—the subunit and adjuvant approach (1995) ed.
  • Span 85 (optionally containing MTP-PE) formulated into submicron particles using a microfluidizer, (b) SAF, containing 10% Squalane, 0.4% Tween 80, 5% pluronic-blocked polymer L121, and thr-MDP either microfluidized into a submicron emulsion or vortexed to generate a larger particle size emulsion, and (c) RIBITM adjuvant system (RAS), (Ribi Immunochem, Hamilton, Mont.) containing 2% Squalene, 0.2% Tween 80, and one or more bacterial cell wall components from the group consisting of monophosphorylipid A (MPL), trehalose dimycolate (TDM), and cell wall skeleton (CWS), preferably MPL+CWS (DETOXTM); (2) saponin adjuvants, such as QS21 or STIMULONTM (Cambridge Bio).
  • RAS RIBITM adjuvant system
  • MPL monophosphorylipid A
  • cytokines such as interleukins (e.g. IL-1, IL-2, IL-4, IL-5, IL-6, IL-7, IL-12 (WO99/44636), etc.), interferons (e.g. gamma interferon), macrophage colony stimulating factor (M-CSF), tumor necrosis factor (TNF), etc.; (5) monophosphoryl lipid A (MPL) or 3-O-deacylated MPL (3dMPL) e.g.
  • MPL monophosphoryl lipid A
  • 3dMPL 3-O-deacylated MPL
  • WO01/21207 or a polyoxyethylene alkyl ether or ester surfactant in combination with at least one additional non-ionic surfactant such as an octoxynol (e.g. WO01/21152); (10) an immunostimulatory oligonucleotide (e.g. a CpG oligonucleotide) and a saponin e.g. WO00/62800; (11) an immunostimulant and a particle of metal salt e.g. WO00/23105; (12) a saponin and an oil-in-water emulsion e.g. WO99/11241; (13) a saponin (e.g.
  • aluminium salts preferably hydroxide or phosphate, but any other suitable salt may also be used (e.g. hydroxyphosphate, oxyhydroxide, orthophosphate, sulphate etc. [e.g. see chapters 8 & 9 of Powell & Newman]). Mixtures of different aluminium salts may also be used.
  • the salt may take any suitable form (e.g. gel, crystalline, amorphous etc.); (15) other substances that act as immunostimulating agents to enhance the efficacy of the composition. Aluminium salts and/or MF59TM are preferred.
  • muramyl peptides include, but are not limited to, N-acetyl-muramyl-L-threonyl-D-isoglutamine (thr-MDP), N-acetyl-normuramyl-L-alanyl-D-isoglutamine (nor-MDP), N-acetylmuramyl-L-alanyl-D-isoglutaminyl-L-alanine-2-(1′-2′-dipalmitoyl-sn-glycero-3-hydroxyphos-phoryloxy) -ethylamine (MTP-PE), etc.
  • thr-MDP N-acetyl-muramyl-L-threonyl-D-isoglutamine
  • nor-MDP N-acetyl-normuramyl-L-alanyl-D-isoglutamine
  • MTP-PE N-acetylmuramyl-L-alany
  • the immunogenic compositions typically will contain diluents, such as water, saline, glycerol, ethanol, etc. Additionally, auxiliary substances, such as wetting or emulsifying agents, pH buffering substances, and the like, may be present in such vehicles.
  • the immunogenic compositions are prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection may also be prepared.
  • the preparation also may be emulsified or encapsulated in liposomes for enhanced adjuvant effect, as discussed above under pharmaceutically acceptable carriers.
  • Immunogenic compositions used as vaccines comprise an immunologically effective amount of the antigenic or immunogenic polypeptides, as well as any other of the above-mentioned components, as needed.
  • immunologically effective amount it is meant that the administration of that amount to an individual, either in a single dose or as part of a series, is effective for treatment or prevention. This amount varies depending upon the health and physical condition of the individual to be treated, the taxonomic group of individual to be treated (eg. nonhuman primate, primate, etc.), the capacity of the individual's immune system to synthesize antibodies, the degree of protection desired, the formulation of the vaccine, the treating doctor's assessment of the medical situation, and other relevant factors. It is expected that the amount will fall in a relatively broad range that can be determined through routine trials.
  • the immunogenic compositions are conventionally administered parenterally, eg. by injection, either subcutaneously, intramuscularly, or transdermally/transcutaneously (eg. WO98/20734). Additional formulations suitable for other modes of administration include oral and pulmonary formulations, suppositories, and transdermal applications. Dosage treatment may be a single dose schedule or a multiple dose schedule.
  • the vaccine may be administered in conjunction with other immunoregulatory agents.
  • DNA vaccination may be used [eg. Robinson & Torres (1997) Seminars in Immunol 9:271-283; Donnelly et al. (1997) Annu Rev Immunol 15:617-648; later herein].
  • Gene therapy vehicles for delivery of constructs including a coding sequence of a therapeutic of the invention, to be delivered to the mammal for expression in the mammal can be administered either locally or systemically.
  • constructs can utilize viral or non-viral vector approaches in in vivo or ex vivo modality. Expression of such coding sequence can be induced using endogenous mammalian or heterologous promoters. Expression of the coding sequence in vivo can be either constitutive or regulated.
  • the invention includes gene delivery vehicles capable of expressing the contemplated nucleic acid sequences.
  • the gene delivery vehicle is preferably a viral vector and, more preferably, a retroviral, adenoviral, adeno-associated viral (AAV), herpes viral, or alphavirus vector.
  • the viral vector can also be an astrovirus, coronavirus, orthomyxovirus, papovavirus, paramyxovirus, parvovirus, picornavirus, poxvirus, or togavirus viral vector. See generally, Jolly (1994) Cancer Gene Therapy 1:51-64; Kimura (1994) Human Gene Therapy 5:845-852; Connelly (1995) Human Gene Therapy 6:185-193; and Kaplitt (1994) Nature Genetics 6:148-153.
  • Retroviral vectors are well known in the art and we contemplate that any retroviral gene therapy vector is employable in the invention, including B, C and D type retroviruses, xenotropic retroviruses (for example, NZB-X1, NZB-X2 and NZB9-1 (see O'Neill (1985) J. Virol. 53:160) polytropic retroviruses eg. MCF and MCF-MLV (see Kelly (1983) J. Virol. 45:291), spumaviruses and lentiviruses. See RNA Tumor Viruses, Second Edition, Cold Spring Harbor Laboratory, 1985.
  • xenotropic retroviruses for example, NZB-X1, NZB-X2 and NZB9-1 (see O'Neill (1985) J. Virol. 53:160)
  • polytropic retroviruses eg. MCF and MCF-MLV (see Kelly (1983) J. Virol. 45:291)
  • retroviral gene therapy vector may be derived from different retroviruses.
  • retrovector LTRs may be derived from a Murine Sarcoma Virus, a tRNA binding site from a Rous Sarcoma Virus, a packaging signal from a Murine Leukemia Virus, and an origin of second strand synthesis from an Avian Leukosis Virus.
  • Retroviral vectors may be used to generate transduction competent retroviral vector particles by introducing them into appropriate packaging cell lines (see U.S. Pat. No. 5,591,624).
  • Retrovirus vectors can be constructed for site-specific integration into host cell DNA by incorporation of a chimeric integrase enzyme into the retroviral particle (see WO96/37626). It is preferable that the recombinant viral vector is a replication defective recombinant virus.
  • Packaging cell lines suitable for use with the above-described retrovirus vectors are well known in the art, are readily prepared (see WO95/30763 and WO92/05266), and can be used to create producer cell lines (also termed vector cell lines or “VCLs”) for the production of recombinant vector particles.
  • the packaging cell lines are made from human parent cells (eg. HT1080 cells) or mink parent cell lines, which eliminates inactivation in human serum.
  • Preferred retroviruses for the construction of retroviral gene therapy vectors include Avian Leukosis Virus, Bovine Leukemia, Virus, Murine Leukemia Virus, Mink-Cell Focus-Inducing Virus, Murine Sarcoma Virus, Reticuloendotheliosis Virus and Rous Sarcoma Virus.
  • Particularly preferred Murine Leukemia Viruses include 4070A and 1504A (Hartley and Rowe (1976) J Virol 19:19-25), Abelson (ATCC No. VR-999), Friend (ATCC No. VR-245), Graffi, Gross (ATCC Nol VR-590), Kirsten, Harvey Sarcoma Virus and Rauscher (ATCC No.
  • Retroviruses may be obtained from depositories or collections such as the American Type Culture Collection (“ATCC”) in Rockville, Md. or isolated from known sources using commonly available techniques.
  • ATCC American Type Culture Collection
  • Exemplary known retroviral gene therapy vectors employable in this invention include those described in patent applications GB2200651, EP0415731, EP0345242, EP0334301, WO89/02468; WO89/05349, WO89/09271, WO90/02806, WO90/07936, WO94/03622, WO93/25698, WO93/25234, WO93/1 1230, WO93/10218, WO91/02805, WO91/02825, WO95/07994, U.S. Pat. Nos. 5,219,740, 4,405,712, 4,861,719, 4,980,289, 4,777,127, 5,591,624.
  • Human adenoviral gene therapy vectors are also known in the art and employable in this invention. See, for example, Berkner (1988) Biotechniques 6:616 and Rosenfeld (1991) Science 252:431, and WO93/07283, WO93/06223, and WO93/07282.
  • Exemplary known adenoviral gene therapy vectors employable in this invention include those described in the above referenced documents and in WO94/12649, WO93/03769, WO93/19191, WO94/28938, WO95/11984, WO95/00655, WO95/27071, WO95/29993, WO95/34671, WO96/05320, WO94/08026, WO94/11506, WO93/06223, WO94/24299, WO95/14102, WO95/24297, WO95/02697, WO94/28152, WO94/24299, WO95/09241, WO95/25807, WO95/05835, WO94/18922 and WO95/09654.
  • the gene delivery vehicles of the invention also include adenovirus associated virus (AAV) vectors.
  • AAV adenovirus associated virus
  • Leading and preferred examples of such vectors for use in this invention are the AAV-2 based vectors disclosed in Srivastava, WO93/09239.
  • Most preferred AAV vectors comprise the two AAV inverted terminal repeats in which the native D-sequences are modified by substitution of nucleotides, such that at least 5 native nucleotides and up to 18 native nucleotides, preferably at least 10 native nucleotides up to 18 native nucleotides, most preferably 10 native nucleotides are retained and the remaining nucleotides of the D-sequence are deleted or replaced with non-native nucleotides.
  • the native D-sequences of the AAV inverted terminal repeats are sequences of 20 consecutive nucleotides in each AAV inverted terminal repeat (ie. there is one sequence at each end) which are not involved in HP formation.
  • the non-native replacement nucleotide may be any nucleotide other than the nucleotide found in the native D-sequence in the same position.
  • Other employable exemplary AAV vectors are pWP-19, pWN-1, both of which are disclosed in Nahreini (1993) Gene 124:257-262.
  • Another example of such an AAV vector is psub201 (see Samulski (1987) J. Virol. 61:3096).
  • Another exemplary AAV vector is the Double-D ITR vector. Construction of the Double-D ITR vector is disclosed in U.S. Pat. No. 5,478,745. Still other vectors are those disclosed in Carter U.S. Pat. No. 4,797,368 and Muzyczka U.S. Pat. No.
  • AAV vector employable in this invention is SSV9AFABTKneo, which contains the AFP enhancer and albumin promoter and directs expression predominantly in the liver. Its structure and construction are disclosed in Su (1996) Human Gene Therapy 7:463-470. Additional AAV gene therapy vectors are described in U.S. Pat. Nos. 5,354,678, 5,173,414, 5,139,941, and 5,252,479.
  • the gene therapy vectors of the invention also include herpes vectors.
  • Leading and preferred examples are herpes simplex virus vectors containing a sequence encoding a thymidine kinase polypeptide such as those disclosed in U.S. Pat. No. 5,288,641 and EP0176170 (Roizman).
  • herpes simplex virus vectors include HFEM/ICP6-LacZ disclosed in WO95/04139 (Wistar Institute), pHSVlac described in Geller (1988) Science 241:1667-1669 and in WO90/09441 and WO92/07945, HSV Us3::pgC-lacZ described in Fink (1992) Human Gene Therapy 3:11-19 and HSV 7134, 2 RH 105 and GAL4 described in EP 0453242 (Breakefield), and those deposited with the ATCC with accession numbers VR-977 and VR-260.
  • alpha virus gene therapy vectors that can be employed in this invention.
  • Preferred alpha virus vectors are Sindbis viruses vectors. Togaviruses, Semliki Forest virus (ATCC VR-67; ATCC VR-1247), Middleberg virus (ATCC VR-370), Ross River virus (ATCC VR-373; ATCC VR-1246), Venezuelan equine encephalitis virus (ATCC VR923; ATCC VR-1250; ATCC VR-1249; ATCC VR-532), and those described in U.S. Pat. Nos. 5,091,309, 5,217,879, and WO92/10578. More particularly, those alpha virus vectors described in U.S. Ser. No. 08/405,627, filed Mar.
  • alpha viruses may be obtained from depositories or collections such as the ATCC in Rockville, Md. or isolated from known sources using commonly available techniques. Preferably, alphavirus vectors with reduced cytotoxicity are used (see U.S. Ser. No. 08/679640).
  • DNA vector systems such as eukaryotic layered expression systems are also useful for expressing the nucleic acids of the invention. See WO95/07994 for a detailed description of eukaryotic layered expression systems.
  • the eukaryotic layered expression systems of the invention are derived from alphavirus vectors and most preferably from Sindbis viral vectors.
  • viral vectors suitable for use in the present invention include those derived from poliovirus, for example ATCC VR-58 and those described in Evans, Nature 339 (1989) 385 and Sabin (1973) J. Biol. Standardization 1:115; rhinovirus, for example ATCC VR- 1110 and those described in Arnold (1990) J Cell Biochem L401; pox viruses such as canary pox virus or vaccinia virus, for example ATCC VR-111 and ATCC VR-2010 and those described in Fisher-Hoch (1989) Proc Natl Acad Sci 86:317; Flexner (1989) Ann NY Acad Sci 569:86, Flexner (1990) Vaccine 8:17; in U.S. Pat. Nos.
  • SV40 virus for example ATCC VR-305 and those described in Mulligan (1979) Nature 277:108 and Madzak (1992) J Gen Virol 73:1533
  • influenza virus for example ATCC VR-797 and recombinant influenza viruses made employing reverse genetics techniques as described in U.S. Pat. No.
  • measles virus for example ATCC VR-67 and VR-1247 and those described in EP-0440219; Aura virus, for example ATCC VR-368; Bebaru virus, for example ATCC VR-600 and ATCC VR-1240; Cabassou virus, for example ATCC VR-922; Chikungunya virus, for example ATCC VR-64 and ATCC VR-1241; Fort Morgan Virus, for example ATCC VR-924; Getah virus, for example ATCC VR-369 and ATCC VR-1243; Kyzylagach virus, for example ATCC VR-927; Mayaro virus, for example ATCC VR-66; Mucambo virus, for example ATCC VR-580 and ATCC VR-1244; Ndumu virus, for example ATCC VR-371; Pixuna virus, for example ATCC VR-372 and ATCC VR-1245; Tonate virus, for example ATCC VR-925; Triniti virus, for example ATCC VR-469; Una virus, for example ATCC VR-374; Whataroa
  • compositions of this invention into cells is not limited to the above mentioned viral vectors.
  • Other delivery methods and media may be employed such as, for example, nucleic acid expression vectors, polycationic condensed DNA linked or unlinked to killed adenovirus alone, for example see U.S. Ser. No. 08/366,787, filed Dec. 30, 1994 and Curiel (1992) Hum Gene Ther 3:147-154 ligand linked DNA, for example see Wu (1989) J Biol Chem 264:16985-16987, eucaryotic cell delivery vehicles cells, for example see U.S. Ser. No.08/240,030, filed May 9, 1994, and U.S. Ser. No.
  • Particle mediated gene transfer may be employed, for example see U.S. Ser. No. 60/023,867. Briefly, the sequence can be inserted into conventional vectors that contain conventional control sequences for high level expression, and then incubated with synthetic gene transfer molecules such as polymeric DNA-binding cations like polylysine, protamine, and albumin, linked to cell targeting ligands such as asialoorosomucoid, as described in Wu & Wu (1987) J. Biol. Chem. 262:4429-4432, insulin as described in Hucked (1990) Biochem Pharmacol 40:253-263, galactose as described in Plank (1992) Bioconjugate Chem 3:533-539, lactose or transferrin.
  • synthetic gene transfer molecules such as polymeric DNA-binding cations like polylysine, protamine, and albumin, linked to cell targeting ligands such as asialoorosomucoid, as described in Wu & Wu (1987) J. Biol
  • Naked DNA may also be employed.
  • Exemplary naked DNA introduction methods are described in WO90/11092 and U.S. Pat. No. 5,580,859. Uptake efficiency may be improved using biodegradable latex beads.
  • DNA coated latex beads are efficiently transported into cells after endocytosis initiation by the beads. The method may be improved further by treatment of the beads to increase hydrophobicity and thereby facilitate disruption of the endosome and release of the DNA into the cytoplasm.
  • Liposomes that can act as gene delivery vehicles are described in U.S. Pat. No. 5,422,120, WO95/13796, WO94/23697, WO91/14445 and EP-524,968.
  • the nucleic acid sequences encoding a polypeptide can be inserted into conventional vectors that contain conventional control sequences for high level expression, and then be incubated with synthetic gene transfer molecules such as polymeric DNA-binding cations like polylysine, protamine, and albumin, linked to cell targeting ligands such as asialoorosomucoid, insulin, galactose, lactose, or transferrin.
  • Non-viral delivery systems include the use of liposomes to encapsulate DNA comprising the gene under the control of a variety of tissue-specific or ubiquitously-active promoters.
  • Further non-viral delivery suitable for use includes mechanical delivery systems such as the approach described in Woffendin et al (1994) Proc. Natl. Acad. Sci. USA 91(24):11581-11585.
  • the coding sequence and the product of expression of such can be delivered through deposition of photopolymerized hydrogel materials.
  • Other conventional methods for gene delivery that can be used for delivery of the coding sequence include, for example, use of hand-held gene transfer particle gun, as described in U.S. Pat. No. 5,149,655; use of ionizing radiation for activating transferred gene, as described in U.S. Pat. No. 5,206,152 and WO92/11033
  • Exemplary liposome and polycationic gene delivery vehicles are those described in U.S. Pat. Nos. 5,422,120 and 4,762,915; in WO95/13796; WO94/23697; and WO91/14445; in EP-0524968; and in Stryer, Biochemistry, pages 236-240 (1975) W. H. Freeman, San Francisco; Szoka (1980) Biochem Biophys Acta 600:1; Bayer (1979) Biochem Biophys Acta 550:464; Rivnay (1987) Meth Enzymol 149:119; Wang (1987) Proc Natl Acad Sci 84:7851; Plant (1989) Anal Biochem 176:420.
  • a polynucleotide composition can comprises therapeutically effective amount of a gene therapy vehicle, as the term is defined above.
  • an effective dose will be from about 0.01 mg/ kg to 50 mg/kg or 0.05 mg/kg to about 10 mg/kg of the DNA constructs in the individual to which it is administered.
  • the polynucleotide compositions of the invention can be administered (1) directly to the subject; (2) delivered ex vivo, to cells derived from the subject; or (3) in vitro for expression of recombinant proteins.
  • the subjects to be treated can be mammals or birds. Also, human subjects can be treated.
  • Direct delivery of the compositions will generally be accomplished by injection, either subcutaneously, intraperitoneally, intravenously or intramuscularly or delivered to the interstitial space of a tissue.
  • the compositions can also be administered into a lesion.
  • Other modes of administration include oral and pulmonary administration, suppositories, and transdermal or transcutaneous applications (eg. see WO98/20734), needles, and gene guns or hyposprays.
  • Dosage treatment may be a single dose schedule or a multiple dose schedule.
  • cells useful in ex vivo applications include, for example, stem cells, particularly hematopoetic, lymph cells, macrophages, dendritic cells, or tumor cells.
  • nucleic acids for both ex vivo and in vitro applications can be accomplished by the following procedures, for example, dextran-mediated transfection, calcium phosphate precipitation, polybrene mediated transfection, protoplast fusion, electroporation, encapsulation of the polynucleotide(s) in liposomes, and direct microinjection of the DNA into nuclei, all well known in the art.
  • polypeptides which include, without limitation: asioloorosomucoid (ASOR); transferrin; asialoglycoproteins; antibodies; antibody fragments; ferritin; interleukins; interferons, granulocyte, macrophage colony stimulating factor (GM-CSF), granulocyte colony stimulating factor (G-CSF), macrophage colony stimulating factor (M-CSF), stem cell factor and erythropoietin.
  • Viral antigens such as envelope proteins, can also be used.
  • proteins from other invasive organisms such as the 17 amino acid peptide from the circumsporozoite protein of plasmodium falciparum known as RII.
  • hormones for example: hormones, steroids, androgens, estrogens, thyroid hormone, or vitamins, folic acid.
  • polyalkylene glycol can be included with the desired polynucleotides/polypeptides.
  • the polyalkylene glycol is polyethlylene glycol.
  • mono-, di-, or polysaccharides can be included.
  • the polysaccharide is dextran or DEAE-dextran.
  • the desired polynucleotide/polypeptide can also be encapsulated in lipids or packaged in liposomes prior to delivery to the subject or to cells derived therefrom.
  • Lipid encapsulation is generally accomplished using liposomes which are able to stably bind or entrap and retain nucleic acid.
  • the ratio of condensed polynucleotide to lipid preparation can vary but will generally be around 1:1 (mg DNA:micromoles lipid), or more of lipid.
  • Liposomal preparations for use in the present invention include cationic (positively charged), anionic (negatively charged) and neutral preparations.
  • Cationic liposomes have been shown to mediate intracellular delivery of plasmid DNA (Felgner (1987) Proc. Natl. Acad. Sci. USA 84:7413-7416); mRNA (Malone (1989) Proc. Natl. Acad. Sci. USA 86:6077-6081); and purified transcription factors (Debs (1990) J. Biol. Chem. 265:10189-10192), in functional form.
  • Cationic liposomes are readily available.
  • N[1-2,3-dioleyloxy)propyl]-N,N,N-triethyl-ammonium (DOTMA) liposomes are available under the trademark Lipofectin, from GIBCO BRL, Grand Island, N.Y. (See, also, Felgner supra).
  • Other commercially available liposomes include transfectace (DDAB/DOPE) and DOTAP/DOPE (Boerhinger).
  • Other cationic liposomes can be prepared from readily available materials using techniques well known in the art. See, eg. Szoka (1978) Proc. Natl. Acad. Sci. USA 75:4194-4198; WO90/11092 for a description of the synthesis of DOTAP (1,2-bis(oleoyloxy)-3-(trimethylammonio)propane) liposomes.
  • anionic and neutral liposomes are readily available, such as from Avanti Polar Lipids (Birmingham, Ala.), or can be easily prepared using readily available materials.
  • Such materials include phosphatidyl choline, cholesterol, phosphatidyl ethanolamine, dioleoylphosphatidyl choline (DOPC), dioleoylphosphatidyl glycerol (DOPG), dioleoylphoshatidyl ethanolamine (DOPE), among others.
  • DOPC dioleoylphosphatidyl choline
  • DOPG dioleoylphosphatidyl glycerol
  • DOPE dioleoylphoshatidyl ethanolamine
  • the liposomes can comprise multilammelar vesicles (MLVs), small unilamellar vesicles (SUVs), or large unilamellar vesicles (LUVs).
  • MLVs multilammelar vesicles
  • SUVs small unilamellar vesicles
  • LUVs large unilamellar vesicles
  • the various liposome-nucleic acid complexes are prepared using methods known in the art. See eg. Straubinger (1983) Meth. Immunol. 101:512-527; Szoka (1978) Proc. Natl. Acad. Sci. USA 75:4194-4198; Papahadjopoulos (1975) Biochim. Biophys. Acta 394:483; Wilson (1979) Cell 17:77); Deamer & Bangham (1976) Biochim. Biophys.
  • lipoproteins can be included with the polynucleotide/polypeptide to be delivered.
  • lipoproteins to be utilized include: chylomicrons, HDL, IDL, LDL, and VLDL. Mutants, fragments, or fusions of these proteins can also be used. Also, modifications of naturally occurring lipoproteins can be used, such as acetylated LDL. These lipoproteins can target the delivery of polynucleotides to cells expressing lipoprotein receptors. Preferably, if lipoproteins are including with the polynucleotide to be delivered, no other targeting ligand is included in the composition.
  • Naturally occurring lipoproteins comprise a lipid and a protein portion.
  • the protein portion are known as apoproteins.
  • apoproteins A, B, C, D, and E have been isolated and identified. At least two of these contain several proteins, designated by Roman numerals, AI, AII, AIV; CI, CII, CIII.
  • a lipoprotein can comprise more than one apoprotein.
  • naturally occurring chylomicrons comprises of A, B, C & E, over time these lipoproteins lose A and acquire C & E.
  • VLDL comprises A, B, C & E apoproteins
  • LDL comprises apoprotein B; and HDL comprises apoproteins A, C, & E.
  • Lipoproteins contain a variety of lipids including, triglycerides, cholesterol (free and esters), and phospholipids.
  • the composition of the lipids varies in naturally occurring lipoproteins.
  • chylomicrons comprise mainly triglycerides.
  • a more detailed description of the lipid content of naturally occurring lipoproteins can be found, for example, in Meth. Enzymol. 128 (1986).
  • the composition of the lipids are chosen to aid in conformation of the apoprotein for receptor binding activity.
  • the composition of lipids can also be chosen to facilitate hydrophobic interaction and association with the polynucleotide binding molecule.
  • Naturally occurring lipoproteins can be isolated from serum by ultracentrifugation, for instance. Such methods are described in Meth. Enzymol. (supra); Pitas (1980) J. Biochem. 255:5454-5460 and Mahey (1979) J Clin. Invest 64:743-750. Lipoproteins can also be produced by in vitro or recombinant methods by expression of the apoprotein genes in a desired host cell. See, for example, Atkinson (1986) Annu Rev Biophys Chem 15:403 and Radding (1958) Biochim Biophys Acta 30: 443. Lipoproteins can also be purchased from commercial suppliers, such as Biomedical Technologies, Inc., Stoughton, Mass., USA. Further description of lipoproteins can be found in WO98/06437.
  • Polycationic agents can be included, with or without lipoprotein, in a composition with the desired polynucleotide/polypeptide to be delivered.
  • Polycationic agents typically, exhibit a net positive charge at physiological relevant pH and are capable of neutralizing the electrical charge of nucleic acids to facilitate delivery to a desired location. These agents have both in vitro, ex vivo, and in vivo applications. Polycationic agents can be used to deliver nucleic acids to a living subject either intramuscularly, subcutaneously, etc.
  • polypeptides as polycationic agents: polylysine, polyarginine, polyornithine, and protamine.
  • Other examples include histones, protamines, human serum albumin, DNA binding proteins, non-histone chromosomal proteins, coat proteins from DNA viruses, such as (X174, transcriptional factors also contain domains that bind DNA and therefore may be useful as nucleic aid condensing agents.
  • transcriptional factors such as C/CEBP, c-jun, c-fos, AP-1, AP-2, AP-3, CPF, Prot-1, Sp-1, Oct-1, Oct-2, CREP, and TFIID contain basic domains that bind DNA sequences.
  • Organic polycationic agents include: spermine, spermidine, and purtrescine.
  • polycationic agent The dimensions and of the physical properties of a polycationic agent can be extrapolated from the list above, to construct other polypeptide polycationic agents or to produce synthetic polycationic agents.
  • Synthetic polycationic agents which are useful include, for example, DEAE-dextran, polybrene.
  • LipofectinTM, and LIPOFECTAMINETM are monomers that form polycationic complexes when combined with polynucleotides/polypeptides.
  • Streptococcus antigens of the invention can be used in immunoassays to detect antibody levels (or, conversely, anti- streptococcus antibodies can be used to detect antigen levels).
  • Immunoassays based on well defined, recombinant antigens can be developed to replace invasive diagnostics methods.
  • Antibodies to streptococcus proteins within biological samples, including for example, blood or serum samples, can be detected.
  • Design of the immunoassays is subject to a great deal of variation, and a variety of these are known in the art. Protocols for the immunoassay may be based, for example, upon competition, or direct reaction, or sandwich type assays. Protocols may also, for example, use solid supports, or may be by immunoprecipitation.
  • assays involve the use of labeled antibody or polypeptide; the labels may be, for example, fluorescent, chemiluminescent, radioactive, or dye molecules.
  • Assays which amplify the signals from the probe are also known; examples of which are assays which utilize biotin and avidin, and enzyme-labeled and mediated immunoassays, such as ELISA assays.
  • Kits suitable for immunodiagnosis and containing the appropriate labeled reagents are constructed by packaging the appropriate materials, including the compositions of the invention, in suitable containers, along with the remaining reagents and materials (for example, suitable buffers, salt solutions, etc.) required for the conduct of the assay, as well as suitable set of assay instructions.
  • Hybridization refers to the association of two nucleic acid sequences to one another by hydrogen bonding. Typically, one sequence will be fixed to a solid support and the other will be free in solution. Then, the two sequences will be placed in contact with one another under conditions that favor hydrogen bonding. Factors that affect this bonding include: the type and volume of solvent; reaction temperature; time of hybridization; agitation; agents to block the non-specific attachment of the liquid phase sequence to the solid support (Denhardt's reagent or BLOTTO); concentration of the sequences; use of compounds to increase the rate of association of sequences (dextran sulfate or polyethylene glycol); and the stringency of the washing conditions following hybridization. See Sambrook et al. [supra] Volume 2, chapter 9, pages 9.47 to 9.57.
  • “Stringency” refers to conditions in a hybridization reaction that favor association of very similar sequences over sequences that differ.
  • the combination of temperature and salt concentration should be chosen that is approximately 120 to 200° C. below the calculated Tm of the hybrid under study.
  • the temperature and salt conditions can often be determined empirically in preliminary experiments in which samples of genomic DNA immobilized on filters are hybridized to the sequence of interest and then washed under conditions of different stringencies. See Sambrook et al. at page 9.50.
  • Variables to consider when performing, for example, a Southern blot are (1) the complexity of the DNA being blotted and (2) the homology between the probe and the sequences being detected.
  • the total amount of the fragment(s) to be studied can vary a magnitude of 10, from 0.1 to 1 ⁇ g for a plasmid or phage digest to 10 ⁇ 9 to 10 ⁇ 8 g for a single copy gene in a highly complex eukaryotic genome.
  • substantially shorter blotting, hybridization, and exposure times a smaller amount of starting polynucleotides, and lower specific activity of probes can be used.
  • a single-copy yeast gene can be detected with an exposure time of only 1 hour starting with 1 ⁇ g of yeast DNA, blotting for two hours, and hybridizing for 4-8 hours with a probe of 10 8 cpm/ ⁇ g.
  • a conservative approach would start with 10 ⁇ g of DNA, blot overnight, and hybridize overnight in the presence of 10% dextran sulfate using a probe of greater than 10 8 cpm/ ⁇ g, resulting in an exposure time of ⁇ 24 hours.
  • Tm melting temperature
  • Ci is the salt concentration (monovalent ions) and n is the length of the hybrid in base pairs (slightly modified from Meinkoth & Wahl (1984) Anal. Biochem. 138: 267-284).
  • the temperature of the hybridization and washes and the salt concentration during the washes are the simplest to adjust. As the temperature of the hybridization increases (ie. stringency), it becomes less likely for hybridization to occur between strands that are nonhomologous, and as a result, background decreases. If the radiolabeled probe is not completely homologous with the immobilized fragment (as is frequently the case in gene family and interspecies hybridization experiments), the hybridization temperature must be reduced, and background will increase. The temperature of the washes affects the intensity of the hybridizing band and the degree of background in a similar manner. The stringency of the washes is also increased with decreasing salt concentrations.
  • Methods such as PCR, branched DNA probe assays, or blotting techniques utilizing nucleic acid probes according to the invention can determine the presence of cDNA or mRNA.
  • a probe is said to “hybridize” with a sequence of the invention if it can form a duplex or double stranded complex, which is stable enough to be detected.
  • the nucleic acid probes will hybridize to the streptococcus nucleotide sequences of the invention (including both sense and antisense strands). Though many different nucleotide sequences will encode the amino acid sequence, the native streptococcus sequence is preferred because it is the actual sequence present in cells.
  • mRNA represents a coding sequence and so a probe should be complementary to the coding sequence; single-stranded cDNA is complementary to mRNA, and so a cDNA probe should be complementary to the non-coding sequence.
  • the probe sequence need not be identical to the streptococcus sequence (or its complement)—some variation in the sequence and length can lead to increased assay sensitivity if the nucleic acid probe can form a duplex with target nucleotides, which can be detected.
  • the nucleic acid probe can include additional nucleotides to stabilize the formed duplex. Additional streptococcus sequence may also be helpful as a label to detect the formed duplex.
  • a non-complementary nucleotide sequence may be attached to the 5′ end of the probe, with the remainder of the probe sequence being complementary to a streptococcus sequence.
  • non-complementary bases or longer sequences can be interspersed into the probe, provided that the probe sequence has sufficient complementarity with the a streptococcus sequence in order to hybridize therewith and thereby form a duplex which can be detected.
  • the exact length and sequence of the probe will depend on the hybridization conditions (e.g. temperature, salt condition etc.).
  • the nucleic acid probe typically contains at least 10-20 nucleotides, preferably 15-25, and more preferably at least 30 nucleotides, although it may be shorter than this. Short primers generally require cooler temperatures to form sufficiently stable hybrid complexes with the template.
  • Probes may be produced by synthetic procedures, such as the triester method of Matteucci et al. [ J. Am. Chem. Soc. (1981) 103:3185], or according to Urdea et al. [ Proc. Natl. Acad. Sci. USA (1983) 80: 7461], or using commercially available automated oligonucleotide synthesizers.
  • the chemical nature of the probe can be selected according to preference. For certain applications, DNA or RNA are appropriate. For other applications, modifications may be incorporated eg backbone modifications, such as phosphorothioates or methylphosphonates, can be used to increase in vivo half-life, alter RNA affinity, increase nuclease resistance etc. [eg. see Agrawal & Iyer (1995) Curr Opin Biotechnol 6:12-19; Agrawal (1996) TIBTECH 14:376-387]; analogues such as peptide nucleic acids may also be used [eg. see Corey (1997) TIBTECH 15:224-229; Buchardt et al. (1993) TIBTECH 11:384-386].
  • backbone modifications such as phosphorothioates or methylphosphonates
  • PCR polymerase chain reaction
  • the assay is described in Mullis et al. [ Meth. Enzymol . (1987) 155:335-350] & U.S. Pat. Nos. 4,683,195 & 4,683,202.
  • Two “primer” nucleotides hybridize with the target nucleic acids and are used to prime the reaction.
  • the primers can comprise sequence that does not hybridize to the sequence of the amplification target (or its complement) to aid with duplex stability or, for example, to incorporate a convenient restriction site. Typically, such sequence will flank the desired streptococcus sequence.
  • thermostable polymerase creates copies of target nucleic acids from the primers using the original target nucleic acids as a template. After a threshold amount of target nucleic acids are generated by the polymerase, they can be detected by more traditional methods, such as Southern blots. When using the Southern blot method, the labelled probe will hybridize to the streptococcus sequence (or its complement).
  • mRNA or cDNA can be detected by traditional blotting techniques described in Sambrook et al [supra].
  • mRNA, or cDNA generated from mRNA using a polymerase enzyme can be purified and separated using gel electrophoresis. The nucleic acids on the gel are then blotted onto a solid support, such as nitrocellulose. The solid support is exposed to a labelled probe and then washed to remove any unhybridized probe. Next, the duplexes containing the labeled probe are detected. Typically, the probe is labelled with a radioactive moiety.
  • nucleotide sequences from S.agalactiae Most examples describe nucleotide sequences from S.agalactiae .
  • the specific strain which was sequenced was from serotype V, and is a clinical strain isolated in Italy which expresses the R antigen (ISS/Rome/Italy collection, strain.2603 V/R).
  • the corresponding sequences from S.pyogenes are also given.
  • GBS and GAS show homology in this way, there is conservation between species which suggests an essential function and also gives good cross-species reactivity.
  • nucleotide sequences from GAS for which no homolog in GBS has been identified. This lack of homology gives molecules which are useful for distinguishing GAS from GBS and for making GAS-specific products. The same is true for GBS sequences which lack GAS homologs e.g these are useful for making GBS-specific products.
  • the examples typically include details of homology to sequences in the public databases. Proteins that are similar in sequence are generally similar in both structure and function, and the homology often indicates a common evolutionary origin. Comparison with sequences of proteins of known function is widely used as a guide for the assignment of putative protein function to a new sequence and has proved particularly useful in whole-genome analyses.
  • the proteins can be expressed recombinantly and used to screen patient sera by immunoblot. A positive reaction between the protein and patient serum indicates that the patient has previously mounted an immune response to the protein in question i.e. the protein is an immunogen. This method can also be used to identify immunodominant proteins.
  • the mouse model used in the examples can also be used.
  • the recombinant protein can also be conveniently used to prepare antibodies e.g. in a mouse. These can be used for direct confirmation that a protein is located on the cell-surface. Labelled antibody (e.g. fluorescent labelling for FACS) can be incubated with intact bacteria and the presence of label on the bacterial surface confirms the location of the protein.
  • Labelled antibody e.g. fluorescent labelling for FACS
  • ORFs Open reading frames within nucleotide sequences were predicted using the GLIMMER program [Salzberg et al. (1998) Nucleic Acids Res 26:544-8]. Where necessary, start codons were modified and corrected manually on the basis of the presence of ribosome-binding sites and promoter regions on the upstream DNA sequence.
  • ORFs were then screened against the non-redundant protein databases using the programs BLASTp [Altschul et al. (1990) J. Mol. Biol. 215:403-410] and PRAZE, a modification of the Smith-Waterman algorithm [Smith & Waterman (1981) J Mol Biol 147:195-7; see Fleischmann et al (1995) Science 269:496-512].
  • Lipoprotein-specific signal peptides were located using three different approaches: (i) PSORT [see above]; (ii) the “prokaryotic membrane lipoprotein lipid attachment site” PROSITE motif [Hofmann et al. (1999) Nucleic Acids Res. 27:215-219; Bucher & Bairoch (1994) in Proceedings 2 nd International Conference on Intelligent Systems for Molecular Biology (ISMB-94), AAAI Press, pages 53-61]; and (iii) the FINDPATTERNS program available in the GCG Wisconsin Package, using the pattern (M, L, V)x ⁇ 9, 35 ⁇ LxxCx.
  • Transmembrane domains were located using two approaches: (i) PSORT [see above]; (ii) TopPred [von Heijne (1992) J. Mol. Biol. 225:487-494].
  • LPXTG motifs characteristic of cell-wall attached proteins in Gram-positive bacteria [Fischetti et al. (1990) Mol Microbiol 4:1603-5] were located with FINDPATTERNS using the pattern (L, I, V, M, Y, F)Px(T, A, S, G) (G, N, S, T, A, L).
  • RGD motifs characteristic of cell-adhesion molecules [D'Souza et al. (1991) Trends Biochem Sci 16:246-50] were located using FINDPATTERNS.
  • Enzymes belonging to the glycolytic pathway were also selected as antigens, because these have been found experimentally expressed on the surface of Streptococci [e.g. Pancholi & Fischetti (1992) J Exp Med 176:415-26; Pancholi & Fischetti (1998) J Biol Chem 273:14503-15].
  • GBS genes were cloned to facilitate expression in E.coli as two different types of fusion proteins:
  • Cloning was performed using the GatewayTM technology (Life Technologies), which is based on the site-specific recombination reactions that mediate integration and excision of phage lambda into and from the E.coli genome.
  • a single cloning experiment included the following steps:
  • GBS strain 2603 V/R (Istituto Superiore Sanità, Rome) was grown to exponential phase in 2 litres TH Broth (Difco) at 37° C., harvested by centrifugation, and dissolved in 40 ml TES (50 mM Tris pH 8, 5 mM EDTA pH 8, 20% sucrose). After addition of 2.5 ml lysozyme solution (25 mg/ml in TES) and 0.5 ml mutanolysin (Sigma M-9901, 25000U/ml in H 2 O), the suspension was incubated at 37° C. for 1 hour. 1 ml RNase (20 mg/ml) and 0.1 ml proteinase K (20 mg/ml) were added and incubation was continued for 30 min. at 37° C.
  • Cell lysis was obtained by adding 5 ml sarkosyl solution (10% N-laurylsarcosine in 250 mM EDTA pH 8.0), and incubating 1 hour at 37° C. with frequent inversion. After sequential extraction with phenol, phenol-chloroform and chloroform, DNA was precipitated with 0.3M sodium acetate pH 5.2 and 2 volumes of absolute ethanol. The DNA pellet was rinsed with 70% ethanol and dissolved in TE buffer (10 mM Tris-HCl, 1 mM EDTA, pH 8). DNA concentration was evaluated by OD 260 .
  • Synthetic oligonucleotide primers were designed on the basis of the coding sequence of each ORF. The aim was to express the protein's extracellular region. Accordingly, predicted signal peptides were omitted (by deducing the 5′ end amplification primer sequence immediately downstream from the predicted leader sequence) and C-terminal cell-wall anchoring regions were removed (e.g. LPXTG motifs and downstream amino acids). Where additional nucleotides have been deleted, this is indicated by the suffix ‘d’ (e.g. ‘GBS352d’). Conversely, a suffix ‘L’ refers to expression without these deletions. Deletions of C- or N-terminal residues were also sometimes made, as indicated by a ‘C’ or ‘N’ suffix.
  • amino acid sequences of the expressed GBS proteins are definitively defined by the sequences of the oligonucleotide primers.
  • Reverse primers 5′-GGGGACCACTTTGTACAAGAAAGCTGGGTT-ORF reverse complement-3′ (nucleotides 1-30 of SEQ ID NO: 11552).
  • the primers for GAS16 are thus: Fwd: GGGGACAAGTTTGTACAAAAAAGCAGGCXXXXX (SEQ ID NO:_) Rev: GGGGACCACTTTGTACAAGAAAGCTGGGTTXXX (SEQ ID NO:_)
  • the number of nucleotides which hybridized to the sequence to be amplified depended on the melting temperature of the primers, which was determined as described by Breslauer et al. [ PNAS USA (1986) 83:3746-50].
  • the average melting temperature of the selected oligos was 50-55° C. for the hybridizing region and 80-85° C. for the whole oligos.
  • the standard PCR protocol was as follows: 50 ng genomic DNA were used as template in the presence of 0.5 ⁇ M each primer, 200 ⁇ M each dNTP, 1.5 mM MgCl 2 , 1 ⁇ buffer minus Mg ++ (Gibco-BRL) and 2 units of Taq DNA polymerase (Platinum Taq, Gibco-BRL) in a final volume of 100 ⁇ l. Each sample underwent a double-step of amplification: 5 cycles performed using as the hybridizing temperature 50° C., followed by 25 cycles at 68° C.
  • Elongation time was 1 minute for ORFs shorter than 2000bp and 2:40 minutes for ORFs longer than 2000bp. Amplifications were performed using a Gene Amp PCR system 9600 (Perkin Elmer).
  • Single band PCR products were purified by PEG precipitation: 300 ⁇ l of TE buffer and 200 ⁇ l of 30% PEG 8000/30 mM MgCl 2 were added to 100 ⁇ l PCR reaction. After vortexing, the DNA was centrifuged for 20 min at 10000 g, washed with 1 vol. 70% ethanol and the pellet dissolved in 30 ⁇ l TE. PCR products smaller than 350 bp were purified using a PCR purification Kit (Qiagen) and eluted with 30 ⁇ l of the provided elution buffer.
  • a PCR purification Kit Qiagen
  • Cloning was performed following the GATEWAYTM technology's “one-tube protocol”, which consists of a two step reaction (BP and LR) for direct insertion of PCR products into expression vectors.
  • BP reaction (attB ⁇ attP sites): The reaction allowed insertion of the PCR product into a pDONR vector.
  • the pDONRTM 201 vector we used contains the killer toxin gene ccdB between attP1 and attP2 sites to minimize background colonies lacking the PCR insert, and a selectable marker gene for kanamycin resistance.
  • the reaction resulted in a so called pEntry vector, in which the GBS gene was located between attL1 and attL2 sites.
  • LR reaction (attL ⁇ attR sites): The reaction allowed the insertion of the GBS gene, now present in the pEntry vector, into E.coli expression vectors (pDestination vectors, containing attR sites). Two pDestination vectors were used (pDEST15 for N- terminal GST fusions— FIG. 86 ; and pDEST17-1 for N-terminal His-tagged fusions— FIG. 87 ). Both allow transcription of the ORF fusion coding mRNA under T7 RNA polymerase promoter [Studier et al (1990) Meth. Enzymol 185: 60ff].
  • BP reaction To 5 ⁇ l of BP reaction were added 0.25 ⁇ l of 0.75 M NaCl, 100 ng of destination vector and 1.5 ⁇ l of LR CLONASETM. The reaction was incubated at 25° C. for 2 hours and stopped with 1 ⁇ l of 1 mg/ml proteinase K solution at 37° C. for 15 min.
  • BL21-SITM cells 1 ⁇ l of the completed reaction was used to transform 50 ⁇ l electrocompetent BL21-SITM cells (0.1 cm, 200 ohms, 25 ⁇ F).
  • BL21-SI cells contain an integrated T7 RNA polymerase gene under the control of the salt-inducible prU promoter [Gowrishankar (1985) J. Bacteriol. 164:434ff].
  • electroporation cells were diluted in 1 ml SOC medium (20 g/l bacto-tryptone, 5 g/l yeast extract, 0.58 g/l NaCl, 0.186 g/l KCl, 20 mM glucose, 10 mM MgCl 2 ) and incubated at 37° C. for 1 hour.
  • 200 ⁇ l cells were plated onto LBON plates (Luria Broth medium without NaCl) containing 100 ⁇ g/ml ampicillin. Plates were then incubated for 16 hours at 37° C.
  • Entry clones In order to allow the future preparation of Gateway compatible pEntry plasmids containing genes which might turn out of interest after immunological assays, 2.5 ⁇ l of BP reaction were incubated for 15 min in the presence of 3 ⁇ l 0.15 mg/ml proteinase K solution and then kept at ⁇ 20° C. The reaction was in this way available to transform E.coli competent cells so as to produce Entry clones for future introduction of the genes in other Destination vectors.
  • Single colonies derived from the transformation of LR reactions were inoculated as small-scale cultures in 3 ml LBON 100 ⁇ g/ml ampicillin for overnight growth at 25° C. 50-200 ⁇ l of the culture was inoculated in 3 ml LBON/Amp to an initial OD600 of 0.1. The cultures were grown at 37° C. until OD600 0.4-0.6 and recombinant protein expression was induced by adding NaCl to a final concentration of 0.3 M. After 2 hour incubation the final OD was checked and the cultures were cooled on ice. 0.5 OD 600 of cells were harvested by centrifugation.
  • the cell pellet was suspended in 50 ⁇ l of protein Loading Sample Buffer (50 mM TRIS-HCI pH 6.8, 0.5% w/v SDS, 2.5% v/v glycerin, 0.05% w/v Bromophenol Blue, 100 mM DTT) and incubated at 100 ° C. for 5 min. 10 ⁇ l of sample was analyzed by SDS-PAGE and Coomassie Blue staining to verify the presence of induced protein band.
  • Sample Buffer 50 mM TRIS-HCI pH 6.8, 0.5% w/v SDS, 2.5% v/v glycerin, 0.05% w/v Bromophenol Blue, 100 mM DTT
  • Proteins were purified in 1 of 3 ways depending on the fusion partner and the protein's solubility:
  • the purified proteins were used to immunise groups of four CD-1 mice intraperitoneally. 20 ⁇ g of each purified protein was injected in Freund's adjuvant at days 1, 21 & 35. Immune responses were monitored by using samples taken on day 0 & 49. Sera were analysed as pools of sera from each group of mice.
  • bacterial cells 50 ⁇ l bacterial cells (OD 600 0.1) were washed once with PBS and resuspended in 20 ⁇ l blocking serum (Newborn Calf Serum, Sigma) and incubated for 20 minutes at room temperature. The cells were then incubated with 100 ⁇ l diluted sera (1:200) in dilution buffer (20% Newborn Calf Serum 0.1% BSA in PBS) for 1 hour at 4° C. Cells were centrifuged at 5000 rpm, the supernatant aspirated and cells washed by adding 200 ⁇ l washing buffer (0.1% BSA in PBS).
  • Samples were considered as positive if they had a ⁇ mean values >50 channel values.
  • GBS serotype III COHI strain and serotype V 2603 V/R strain cells were grown overnight in Todd Hewitt Broth. 1 ml of the culture was inoculated into 100 ml Todd Hewitt Broth. Bacterial growth was monitored every 30 minutes by following OD 600 . The bacteria were grown until the OD reached 0.7-0.8. The culture was centrifuged for 20 minutes at 5000 rpm. The supernatant was discarded and bacteria were washed once with PBS, resuspended in 2 ml 50 mM Tris-HCl, pH 6.8 adding 400 units of Mutanolysin (Sigma-Aldrich) and incubated 3 hrs at 37° C. After 3 cycles of freeze/thaw, cellular debris were removed by centrifugation at 14000 g for 15 minutes and the protein concentration of the supernatant was measured by the Bio-Rad Protein assay, using BSA as a standard.
  • Purified proteins 50 ng
  • total cell extracts 25 ⁇ g
  • SDS-PAGE SDS-PAGE and transferred to a nitrocellulose membrane. The transfer was performed for 1 hours at 100 V at 4° C., in transferring buffer (25 mM Tris base, 192 mM glycine, 20% methanol). The membrane was saturated by overnight incubation at 4° C. in saturation buffer (5 % skimmed milk, 0.1% Tween 20 in PBS). The membrane was incubated for 1 hour at room temperature with 1:1000 mouse sera diluted in saturation buffer.
  • the membrane was washed twice with washing buffer (3 % skimmed milk, 0.1% Tween 20 in PBS) and incubated for 1 hour with a 1:5000 dilution of horseradish peroxidase labelled anti-mouse Ig (Bio-Rad).
  • the membrane was washed twice with 0.1% Tween 20 in PBS and developed with the Opti-4CN Substrate Kit (Bio-Rad). The reaction was stopped by adding water.
  • lanes 1, 2 and 3 of blots in the drawings are: (1) the purified protein; (2) GBS-III extracts; and (3) GBS-V extracts. Molecular weight markers are also shown.
  • mice challenged with GBS serotype III The immune sera collected from the CD1 immunized mice were tested in a mouse neonatal sepsis model to verify their protective efficacy in mice challenged with GBS serotype III.
  • Newborn Balb/C littermates were randomly divided in two groups within 24 hrs from birth and injected subcutaneously with 25 ⁇ l of diluted sera (1:15) from immunized CD1 adult mice.
  • One group received preimmune sera, the other received immune sera.
  • All pups were challenged with a 75% lethal dose of the GBS serotype III COH1 strain.
  • the challenge dose obtained diluting a mid log phase culture was administered subcutaneously in 25 ⁇ l of saline.
  • the number of pups surviving GBS infection was assessed every 12 hours for 4 days.

Abstract

The invention provides proteins from group B streptococcus (Streptococcus agalactiae) and group A streptococcus (Streptococcus pyogenes), including amino acid sequences and the corresponding nucleotide sequences. Data are given to show that the proteins are useful antigens for vaccines, immunogenic compositions, and/or diagnostics. The proteins are also targets for antibiotics.

Description

  • This application is a continuation of Ser. No. 10/415,182 filed Apr. 28, 2003. Ser. No. 10/415,182 is a National Stage application of PCT application PCT/GB01/04789, which was filed Oct. 29, 2001 and published in English under PCT Article 21(2) on May 2, 2002. PCT/GB01/04789 claims the benefit of Ser. No. GB0026333.5 filed Oct. 27, 2000, Ser. No. GB0028727.6 filed Nov. 24, 2000, and Ser. No. GB0105640.7 filed Mar. 7, 2001. Each of these applications and all the other documents cited herein are incorporated by reference in their entireties.
  • This application incorporates by reference the contents of each of two duplicate CD-ROMS which contain an identical 21.0 MB file labeled “PP016620.0025 sequence listing.txt,” which is the sequence listing for this application. The CD-ROMs were created on Mar. 20, 2006.
  • TECHNICAL FIELD
  • This invention relates to nucleic acid and proteins from the bacteria Streptococcus agalactiae (GBS) and Streptococcus pyogenes (GAS).
  • BACKGROUND ART
  • Once thought to infect only cows, the Gram-positive bacterium Streptococcus agalactiae (or “group B streptococcus”, abbreviated to “GBS”) is now known to cause serious disease, bacteremia and meningitis, in immunocompromised individuals and in neonates. There are two types of neonatal infection. The first (early onset, usually within 5 days of birth) is manifested by bacteremia and pneumonia. It is contracted vertically as a baby passes through the birth canal. GBS colonises the vagina of about 25% of young women, and approximately 1% of infants born via a vaginal birth to colonised mothers will become infected. Mortality is between 50-70%. The second is a meningitis that occurs 10 to 60 days after birth. If pregnant women are vaccinated with type III capsule so that the infants are passively immunised, the incidence of the late onset meningitis is reduced but is not entirely eliminated.
  • The “B” in “GBS” refers to the Lancefield classification, which is based on the antigenicity of a carbohydrate which is soluble in dilute acid and called the C carbohydrate. Lancefield identified 13 types of C carbohydrate, designated A to O, that could be serologically differentiated. The organisms that most commonly infect humans are found in groups A, B, D, and G. Within group B, strains can be divided into 8 serotypes (Ia, Ib, Ia/c, II, III, IV, V, and VI) based on the structure of their polysaccharide capsule.
  • Group A streptococcus (“GAS”, S.pyogenes) is a frequent human pathogen, estimated to be present in between 5-15% of normal individuals without signs of disease. When host defences are compromised, or when the organism is able to exert its virulence, or when it is introduced to vulnerable tissues or hosts, however, an acute infection occurs. Diseases include puerperal fever, scarlet fever, erysipelas, pharyngitis, impetigo, necrotising fasciitis, myositis and streptococcal toxic shock syndrome.
  • S.pyogenes is typically treated using antibiotics. Although S.agalactiae is inhibited by antibiotics, however, it is not killed by penicillin as easily as GAS. Prophylactic vaccination is thus preferable.
  • Current GBS vaccines are based on polysaccharide antigens, although these suffer from poor immunogenicity. Anti-idiotypic approaches have also been used (e.g. WO99/54457). There remains a need, however, for effective adult vaccines against S.agalactiae infection. There also remains a need for vaccines against S.pyogenes infection.
  • It is an object of the invention to provide proteins which can be used in the development of such vaccines. The proteins may also be useful for diagnostic purposes, and as targets for antibiotics.
  • BRIEF DESCRIPTION OF DRAWINGS
  • FIG. 1A shows the pDEST15 vector. FIG. 1B shows the pDEST17-1 vector.
  • DETAILED DESCRIPTION
  • The invention provides proteins comprising the S.agalactiae amino acid sequences disclosed in the examples, and proteins comprising the S.pyogenes amino acid sequences disclosed in the examples. These amino acid sequences are the even SEQ ID NOS: between 1 and 10960.
  • It also provides proteins comprising amino acid sequences having sequence identity to the S.agalactiae amino acid sequences disclosed in the examples, and proteins comprising amino acid sequences having sequence identity to the S.pyogenes amino acid sequences disclosed in the examples. Depending on the particular sequence, the degree of sequence identity is preferably greater than 50% (e.g. 60%, 70%, 80%, 90%, 95%, 99% or more). These proteins include homologs, orthologs, allelic variants and functional mutants. Typically, 50% identity or more between two proteins is considered to be an indication of functional equivalence. Identity between proteins is preferably determined by the Smith-Waterman homology search algorithm as implemented in the MPSRCH program (Oxford Molecular), using an affine gap search with parameters gap open penalty=12 and gap extension penalty=1.
  • A preferred protein of the invention is GAS16 (SEQ ID NO:7276).
  • The invention further provides proteins comprising fragments of the S.agalactiae amino acid sequences disclosed in the examples, and proteins comprising fragments of the S.pyogenes amino acid sequences disclosed in the examples. The fragments should comprise at least n consecutive amino acids from the sequences and, depending on the particular sequence, n is 7 or more (e.g. 8, 10, 12, 14, 16, 18, 20, 30, 40, 50, 60, 70, 80, 90, 100 or more). Preferably the fragments comprise one or more epitopes from the sequence. Other preferred fragments are (a) the N-terminal signal peptides of the proteins disclosed in the examples, (b) the proteins disclosed in the examples, but without their N-terminal signal peptides, (c) fragments common to the related GAS and GBS proteins disclosed in the examples, and (d) the proteins disclosed in the examples, but without their N-terminal amino acid residue.
  • The proteins of the invention can, of course, be prepared by various means (e.g. recombinant expression, purification from GAS or GBS, chemical synthesis etc.) and in various forms (e.g. native, fusions, glycosylated, non-glycosylated etc.). They are preferably prepared in substantially pure form (i.e. substantially free from other streptococcal or host cell proteins) or substantially isolated form. Proteins of the invention are preferably streptococcal proteins.
  • According to a further aspect, the invention provides antibodies which bind to these proteins. These may be polyclonal or monoclonal and may be produced by any suitable means (e.g. by recombinant expression). To increase compatibility with the human immune system, the antibodies may be chimeric or humanised (e.g. Breedveld (2000) Lancet 355(9205):735-740; Gorman & Clark (1990) Semin. Immunol. 2:457-466), or fully human antibodies may be used. The antibodies may include a detectable label (e.g. for diagnostic assays).
  • According to a further aspect, the invention provides nucleic acid comprising the S.agalactiae nucleotide sequences disclosed in the examples, and nucleic acid comprising the S.pyogenes nucleotide sequences disclosed in the examples. These nucleic acid sequences are the odd SEQ ID NOS: between 1 and 10966.
  • In addition, the invention provides nucleic acid comprising nucleotide sequences having sequence identity to the S.agalactiae nucleotide sequences disclosed in the examples, and nucleic acid comprising nucleotide sequences having sequence identity to the S.pyogenes nucleotide sequences disclosed in the examples. Identity between sequences is preferably determined by the Smith-Waterman homology search algorithm as described above.
  • Furthermore, the invention provides nucleic acid which can hybridise to the S.agalactiae nucleic acid disclosed in the examples, and nucleic acid which can hybridise to the S.pyogenes nucleic acid disclosed in the examples preferably under ‘high stringency’ conditions (e.g. 65° C. in 0.1×SSC, 0.5% SDS solution).
  • Nucleic acid comprising fragments of these sequences are also provided. These should comprise at least n consecutive nucleotides from the S.agalactiae or S.pyogenes sequences and, depending on the particular sequence, n is 10 or more (e.g. 12, 14, 15, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200 or more). The fragments may comprise sequences which are common to the related GAS and GBS sequences disclosed in the examples.
  • According to a further aspect, the invention provides nucleic acid encoding the proteins and protein fragments of the invention.
  • The invention also provides: nucleic acid comprising nucleotide sequence SEQ ID NO:7275; nucleic acid comprising nucleotide sequences having sequence identity to SEQ ID NO:7275; nucleic acid which can hybridise to SEQ ID NO:7275 (preferably under ‘high stringency’ conditions); nucleic acid comprising a fragment of at least n consecutive nucleotides from SEQ ID NO:7275, wherein n is 10 or more e.g. 12, 14, 15, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900, 1000, 1500, 2000, 3000, 4000, 5000, 10000, 100000, 1000000 or more.
  • Nucleic acids of the invention can be used in hybridisation reactions (e.g. Northern or Southern blots, or in nucleic acid microarrays or ‘gene chips’) and amplification reactions (e.g. PCR, SDA, SSSR, LCR, TMA, NASBA etc.) and other nucleic acid techniques.
  • It should also be appreciated that the invention provides nucleic acid comprising sequences complementary to those described above (e.g. for antisense or probing, or for use as primers).
  • Nucleic acid according to the invention can, of course, be prepared in many ways (e.g. by chemical synthesis, from genomic or cDNA libraries, from the organism itself etc.) and can take various forms (e.g. single stranded, double stranded, vectors, primers, probes, labelled etc.). The nucleic acid is preferably in substantially isolated form.
  • Nucleic acid according to the invention may be labelled e.g. with a radioactive or fluorescent label. This is particularly useful where the nucleic acid is to be used in nucleic acid detection techniques e.g. where the nucleic acid is a primer or as a probe for use in techniques such as PCR, LCR, TMA, NASBA etc.
  • In addition, the term “nucleic acid” includes DNA and RNA, and also their analogues, such as those containing modified backbones, and also peptide nucleic acids (PNA) etc.
  • According to a further aspect, the invention provides vectors comprising nucleotide sequences of the invention (e.g. cloning or expression vectors) and host cells transformed with such vectors.
  • According to a further aspect, the invention provides compositions comprising protein, antibody, and/or nucleic acid according to the invention. These compositions may be suitable as immunogenic compositions, for instance, or as diagnostic reagents, or as vaccines.
  • The invention also provides nucleic acid, protein, or antibody according to the invention for use as medicaments (e.g. as immunogenic compositions or as vaccines) or as diagnostic reagents. It also provides the use of nucleic acid, protein, or antibody according to the invention in the manufacture of: (i) a medicament for treating or preventing disease and/or infection caused by streptococcus; (ii) a diagnostic reagent for detecting the presence of streptococcus or of antibodies raised against streptococcus; and/or (iii) a reagent which can raise antibodies against streptococcus. Said streptococcus may be any species, group or strain, but is preferably S.agalactiae, especially serotype III or V, or S.pyogenes. Said disease may be bacteremia, meningitis, puerperal fever, scarlet fever, erysipelas, pharyngitis, impetigo, necrotising fasciitis, myositis or toxic shock syndrome.
  • The invention also provides a method of treating a patient, comprising administering to the patient a therapeutically effective amount of nucleic acid, protein, and/or antibody of the invention. The patient may either be at risk from the disease themselves or may be a pregnant woman (‘maternal immunisation’ e.g. Glezen & Alpers (1999) Clin. Infect. Dis. 28:219-224).
  • Administration of protein antigens is a preferred method of treatment for inducing immunity.
  • Administration of antibodies of the invention is another preferred method of treatment. This method of passive immunisation is particularly useful for newborn children or for pregnant women. This method will typically use monoclonal antibodies, which will be humanised or fully human.
  • The invention also provides a kit comprising primers (e.g. PCR primers) for amplifying a template sequence contained within a Streptococcus (e.g. S.pyogenes or S.agalactiae) nucleic acid sequence, the kit comprising a first primer and a second primer, wherein the first primer is substantially complementary to said template sequence and the second primer is substantially complementary to a complement of said template sequence, wherein the parts of said primers which have substantial complementarity define the termini of the template sequence to be amplified. The first primer and/or the second primer may include a detectable label (e.g. a fluorescent label).
  • The invention also provides a kit comprising first and second single-stranded oligonucleotides which allow amplification of a Streptococcus template nucleic acid sequence contained in a single- or double-stranded nucleic acid (or mixture thereof), wherein: (a) the first oligonucleotide comprises a primer sequence which is substantially complementary to said template nucleic acid sequence; (b) the second oligonucleotide comprises a primer sequence which is substantially complementary to the complement of said template nucleic acid sequence; (c) the first oligonucleotide and/or the second oligonucleotide comprise(s) sequence which is not complementary to said template nucleic acid; and (d) said primer sequences define the termini of the template sequence to be amplified. The non-complementary sequence(s) of feature (c) are preferably upstream of (i.e. 5′ to) the primer sequences. One or both of these (c) sequences may comprise a restriction site (e.g. EP-B-0509612) or a promoter sequence (e.g. EP-B-0505012). The first oligonucleotide and/or the second oligonucleotide may include a detectable label (e.g. a fluorescent label).
  • The template sequence may be any part of a genome sequence (e.g. SEQ ID NO:7275). For example, it could be a rRNA gene (e.g. Turenne et al. (2000) J. Clin. Microbiol. 38:513-520; SEQ ID NOS: 12018-12024 herein) or a protein-coding gene. The template sequence is preferably specific to GBS.
  • The invention also provides a computer-readable medium (e.g. a floppy disk, a hard disk, a CD-ROM, a DVD etc.) and/or a computer database containing one or more of the sequences in the sequence listing. The medium preferably contains one or both of SEQ ID NOS: 7276 and 7275.
  • The invention also provides a hybrid protein represented by the formula NH2-A-[-X-L-]n-B-COOH, wherein X is a protein of the invention, L is an optional linker amino acid sequence, A is an optional N-terminal amino acid sequence, B is an optional C-terminal amino acid sequence, and n is an integer greater than 1. The value of n is between 2 and x, and the value of x is typically 3, 4, 5, 6, 7, 8, 9 or 10. Preferably n is 2, 3 or 4; it is more preferably 2 or 3; most preferably, n=2. For each n instances, -X- may be the same or different. For each n instances of [-X-L-], linker amino acid sequence -L- may be present or absent. For instance, when n=2 the hybrid may be NH2-X1-L1-X2-L2 -COOH, NH2-X1-X2-COOH, NH2-X1-L1-X2-COOH, NH2-X1-X2-L2-COOH, etc. Linker amino acid sequence(s) -L- will typically be short (e.g. 20 or fewer amino acids i.e. 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1). Examples include short peptide sequences which facilitate cloning, poly-glycine linkers (i.e. Glyn where n=2, 3, 4, 5, 6, 7, 8, 9, 10 or more), and histidine tags (i.e. Hisn where n=3, 4, 5, 6, 7, 8, 9, 10 or more). Other suitable linker amino acid sequences will be apparent to those skilled in the art. -A- and -B- are optional sequences which will typically be short (e.g. 40 or fewer amino acids i.e. 39, 38, 37, 36, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1). Examples include leader sequences to direct protein trafficking, or short peptide sequences which facilitate cloning or purification (e.g. histidine tags i.e. Hisn where n=3, 4, 5, 6, 7, 8, 9, 10 or more). Other suitable N-terminal and C-terminal amino acid sequences will be apparent to those skilled in the art. In some embodiments, each X will be a GBS sequence; in others, mixtures of GAS and GBS will be used.
  • According to further aspects, the invention provides various processes.
  • A process for producing proteins of the invention is provided, comprising the step of culturing a host cell of to the invention under conditions which induce protein expression.
  • A process for producing protein or nucleic acid of the invention is provided, wherein the protein or nucleic acid is synthesised in part or in whole using chemical means.
  • A process for detecting polynucleotides of the invention is provided, comprising the steps of: (a) contacting a nucleic probe according to the invention with a biological sample under hybridising conditions to form duplexes; and (b) detecting said duplexes.
  • A process for detecting Streptococcus in a biological sample (e.g. blood) is also provided, comprising the step of contacting nucleic acid according to the invention with the biological sample under hybridising conditions. The process may involve nucleic acid amplification (e.g. PCR, SDA, SSSR, LCR, TMA, NASBA etc.) or hybridisation (e.g. microarrays, blots, hybridisation with a probe in solution etc.). PCR detection of Streptococcus in clinical samples, in particular S.pyogenes, has been reported [see e.g. Louie et al. (2000) CMAJ 163:301-309; Louie et al. (1998) J. Clin. Microbiol. 36:1769-1771]. Clinical assays based on nucleic acid are described in general in Tang et al. (1997) Clin. Chem. 43:2021-2038.
  • A process for detecting proteins of the invention is provided, comprising the steps of: (a) contacting an antibody of the invention with a biological sample under conditions suitable for the formation of an antibody-antigen complexes; and (b) detecting said complexes.
  • A process for identifying an amino acid sequence is provided, comprising the step of searching for putative open reading frames or protein-coding regions within a genome sequence of S.agalactiae. This will typically involve in silico searching the sequence for an initiation codon and for an in-frame termination codon in the downstream sequence. The region between these initiation and termination codons is a putative protein-coding sequence. Typically, all six possible reading frames will be searched. Suitable software for such analysis includes ORFFINDER (NCBI), GENEMARK [Borodovsky & McIninch (1993) Computers Chem. 17:122-133), GLIMMER [Salzberg et al. (1998) Nucleic Acids Res. 26:544-548; Salzberg et al. (1999) Genomics 59:24-31; Delcher et al. (1999) Nucleic Acids Res. 27:4636-4641], or other software which uses Markov models [e.g. Shmatkov et al. (1999) Bioinformatics 15:874-876]. The invention also provides a protein comprising the identified amino acid sequence. These proteins can then expressed using conventional techniques.
  • The invention also provides a process for determining whether a test compound binds to a protein of the invention. If a test compound binds to a protein of the invention and this binding inhibits the life cycle of the GBS bacterium, then the test compound can be used as an antibiotic or as a lead compound for the design of antibiotics. The process will typically comprise the steps of contacting a test compound with a protein of the invention, and determining whether the test compound binds to said protein. Preferred proteins of the invention for use in these processes are enzymes (e.g. tRNA synthetases), membrane transporters and ribosomal proteins. Suitable test compounds include proteins, polypeptides, carbohydrates, lipids, nucleic acids (e.g. DNA, RNA, and modified forms thereof), as well as small organic compounds (e.g. MW between 200 and 2000 Da). The test compounds may be provided individually, but will typically be part of a library (e.g. a combinatorial library). Methods for detecting a binding interaction include NMR, filter-binding assays, gel-retardation assays, displacement assays, surface plasmon resonance, reverse two-hybrid etc. A compound which binds to a protein of the invention can be tested for antibiotic activity by contacting the compound with GBS bacteria and then monitoring for inhibition of growth. The invention also provides a compound identified using these methods.
  • The invention also provides a composition comprising a protein or the invention and one or more of the following antigens:
      • a protein antigen from Helicobacter pylori such as VacA, CagA, NAP, HopX, HopY [e.g. WO98/04702] and/or urease.
      • a protein antigen from N.meningitidis serogroup B, such as those in WO99/24578, WO99/36544, WO99/57280, WO00/22430, Tettelin et al. (2000) Science 287:1809-1815, Pizza et al. (2000) Science 287:1816-1820 and WO96/29412, with protein ‘287’ and derivatives being particularly preferred.
      • an outer-membrane vesicle (OMV) preparation from N.meningitidis serogroup B, such as those disclosed in WO01/52885; Bjune et al. (1991) Lancet 338(8775):1093-1096; Fukasawa et al. (1999) Vaccine 17:2951-2958; Rosenqvist et al. (1998) Dev. Biol. Stand. 92:323-333 etc.
      • a saccharide antigen from N.meningitidis serogroup A, C, W135 and/or Y, such as the oligosaccharide disclosed in Costantino et al. (1992) Vaccine 10:691-698from serogroup C [see also Costantino et al. (1999) Vaccine 17:1251-1263].
      • a saccharide antigen from Streptococcus pneumoniae [e.g. Watson (2000) Pediatr Infect Dis J 19:331-332; Rubin (2000) Pediatr Clin North Am 47:269-285, v; Jedrzejas (2001) Microbiol Mol Biol Rev 65:187-207].
      • an antigen from hepatitis A virus, such as inactivated virus [e.g. Bell (2000) Pediatr Infect Dis J 19:1187-1188; Iwarson (1995) APMIS 103:321-326].
      • an antigen from hepatitis B virus, such as the surface and/or core antigens [e.g. Gerlich et al. (1990) Vaccine 8 Suppl:S63-68 & 79-80].
      • an antigen from hepatitis C virus [e.g. Hsu et al. (1999) Clin Liver Dis 3:901-915].
      • an antigen from Bordetella pertussis, such as pertussis holotoxin (PT) and filamentous haemagglutinin (FHA) from B.pertussis, optionally also in combination with pertactin and/or agglutinogens 2 and 3 [e.g. Gustafsson et al. (1996) N. Engl. J. Med. 334:349-355; Rappuoli et al. (1991) TIBTECH9:232-238].
      • a diphtheria antigen, such as a diphtheria toxoid [e.g. chapter 3 of Vaccines (1988) eds. Plotkin & Mortimer. ISBN 0-7216-1946-0] e.g. the CRM197 mutant [e.g. Del Guidice et al. (1998) Molecular Aspects of Medicine 19:1-70].
      • a tetanus antigen, such as a tetanus toxoid [e.g. chapter 4 of Plotkin & Mortimer].
      • a saccharide antigen from Haemophilus influenzae B.
      • an antigen from N.gonorrhoeae [e.g. WO99/24578, WO99/36544, WO99/57280].
      • an antigen from Chlamydia pneumoniae [e.g. PCT/IB01/01445; Kalman et al. (1999) Nature Genetics 21:385-389; Read et al. (2000) Nucleic Acids Res 28:1397-406; Shirai et al. (2000) J. Infect. Dis. 181(Suppl 3):S524-S527; WO99/27105; WO00/27994; WO00/37494].
      • an antigen from Chlamydia trachomatis [e.g. WO99/28475].
      • an antigen from Porphyromonas gingivalis [e.g. Ross et al. (2001) Vaccine 19:4135-4142].
      • polio antigen(s) [e.g. Sutter et al. (2000) Pediatr Clin North Am 47:287-308; Zimmerman & Spann (1999) Am Fam Physician 59:113-118, 125-126] such as IPV or OPV.
      • rabies antigen(s) [e.g. Dreesen (1997) Vaccine 15 Suppl:S2-6] such as lyophilised inactivated virus [e.g. MMWR Morb Mortal Wkly Rep 1998 Jan 16;47(1):12, 19; RabAvert™].
      • measles, mumps and/or rubella antigens [e.g. chapters 9, 10 & 11 of Plotkin & Mortimer].
      • influenza antigen(s) [e.g. chapter 19 of Plotkin & Mortimer], such as the haemagglutinin and/or neuraminidase surface proteins.
      • an antigen from Moraxella catarrhalis [e.g. McMichael (2000) Vaccine 19 Suppl 1:S101-107].
      • an antigen from Staphylococcus aureus [e.g. Kuroda et al. (2001) Lancet 357(9264):1225-1240; see also pages 1218-1219].
  • Where a saccharide or carbohydrate antigen is included, it is preferably conjugated to a carrier protein in order to enhance immunogenicity [e.g. Ramsay et al. (2001) Lancet 357(9251):195-196; Lindberg (1999) Vaccine 17 Suppl 2:S28-36; Conjugate Vaccines (eds. Cruse et al.) ISBN 3805549326, particularly vol. 10:48-114 etc.]. Preferred carrier proteins are bacterial toxins or toxoids, such as diphtheria or tetanus toxoids. The CRM197 diphtheria toxoid is particularly preferred. Other suitable carrier proteins include the N.meningitidis outer membrane protein [e.g. EP-0372501], synthetic peptides [e.g. EP-0378881, EP-0427347], heat shock proteins [e.g. WO93/17712], pertussis proteins [e.g. WO98/58668; EP-0471177], protein D from H.influenzae [e.g. WO00/56360], toxin A or B from C. difficile [e.g. WO00/61761], etc. Any suitable conjugation reaction can be used, with any suitable linker where necessary.
  • Toxic protein antigens may be detoxified where necessary (e.g. detoxification of pertussis toxin by chemical and/or genetic means).
  • Where a diphtheria antigen is included in the composition it is preferred also to include tetanus antigen and pertussis antigens. Similarly, where a tetanus antigen is included it is preferred also to include diphtheria and pertussis antigens. Similarly, where a pertussis antigen is included it is preferred also to include diphtheria and tetanus antigens.
  • Antigens are preferably adsorbed to an aluminium salt.
  • Antigens in the composition will typically be present at a concentration of at least 1 μg/ml each. In general, the concentration of any given antigen will be sufficient to elicit an immune response against that antigen.
  • The invention also provides compositions comprising two or more proteins of the present invention. The two or more proteins may comprise GBS sequences or may comprise GAS and GBS sequences.
  • A summary of standard techniques and procedures which may be employed to perform the invention (e.g. to utilise the disclosed sequences for vaccination or diagnostic purposes) follows. This summary is not a limitation on the invention but, rather, gives examples that may be used, but are not required.
  • General
  • The practice of the present invention will employ, unless otherwise indicated, conventional techniques of molecular biology, microbiology, recombinant DNA, and immunology, which are within the skill of the art. Such techniques are explained fully in the literature eg. Sambrook Molecular Cloning; A Laboratory Manual, Second Edition (1989); DNA Cloning, Volumes I and II (D.N Glover ed. 1985); Oligonucleotide Synthesis (M. J. Gait ed, 1984); Nucleic Acid Hybridization (B.D. Hames & S. J. Higgins eds. 1984); Transcription and Translation (B. D. Hames & S. J. Higgins eds. 1984); Animal Cell Culture (R. I. Freshney ed. 1986); Immobilized Cells and Enzymes (IRL Press, 1986); B. Perbal, A Practical Guide to Molecular Cloning (1984); the Methods in Enzymology series (Academic Press, Inc.), especially volumes 154 & 155; Gene Transfer Vectors for Mammalian Cells (J. H. Miller and M. P. Calos eds. 1987, Cold Spring Harbor Laboratory); Mayer and Walker, eds. (1987), Immunochemical Methods in Cell and Molecular Biology (Academic Press, London); Scopes, (1987) Protein Purification: Principles and Practice, Second Edition (Springer-Verlag, N.Y.), and Handbook of Experimental Immunology, Volumes I-IV (D. M. Weir and C. C. Blackwell eds 1986).
  • Standard abbreviations for nucleotides and amino acids are used in this specification.
  • Definitions
  • A composition containing X is “substantially free of” Y when at least 85% by weight of the total X+Y in the composition is X. Preferably, X comprises at least about 90% by weight of the total of X+Y in the composition, more preferably at least about 95% or even 99% by weight.
  • The term “comprising” means “including” as well as “consisting” e.g. a composition “comprising” X may consist exclusively of X or may include something additional e.g X+Y.
  • The term “heterologous” refers to two biological components that are not found together in nature. The components may be host cells, genes, or regulatory regions, such as promoters. Although the heterologous components are not found together in nature, they can finction together, as when a promoter heterologous to a gene is operably linked to the gene. Another example is where a streptococcus sequence is heterologous to a mouse host cell. A further examples would be two epitopes from the same or different proteins which have been assembled in a single protein in an arrangement not found in nature.
  • An “origin of replication” is a polynucleotide sequence that initiates and regulates replication of polynucleotides, such as an expression vector. The origin of replication behaves as an autonomous unit of polynucleotide replication within a cell, capable of replication under its own control. An origin of replication may be needed for a vector to replicate in a particular host cell. With certain origins of replication, an expression vector can be reproduced at a high copy number in the presence of the appropriate proteins within the cell. Examples of origins are the autonomously replicating sequences, which are effective in yeast; and the viral T-antigen, effective in COS-7 cells.
  • A “mutant” sequence is defined as DNA, RNA or amino acid sequence differing from but having sequence identity with the native or disclosed sequence. Depending on the particular sequence, the degree of sequence identity between the native or disclosed sequence and the mutant sequence is preferably greater than 50% (eg. 60%, 70%, 80%, 90%, 95%, 99% or more, calculated using the Smith-Waterman algorithm as described above). As used herein, an “allelic variant” of a nucleic acid molecule, or region, for which nucleic acid sequence is provided herein is a nucleic acid molecule, or region, that occurs essentially at the same locus in the genome of another or second isolate, and that, due to natural variation caused by, for example, mutation or recombination, has a similar but not identical nucleic acid sequence. A coding region allelic variant typically encodes a protein having similar activity to that of the protein encoded by the gene to which it is being compared. An allelic variant can also comprise an alteration in the 5′ or 3′ untranslated regions of the gene, such as in regulatory control regions (eg. see U.S Pat. 5,753,235).
  • Exyression systems
  • The streptococcus nucleotide sequences can be expressed in a variety of different expression systems; for example those used with mammalian cells, baculoviruses, plants, bacteria, and yeast.
  • i. Mammalian Systems
  • Mammalian expression systems are known in the art. A mammalian promoter is any DNA sequence capable of binding mammalian RNA polymerase and initiating the downstream (3′) transcription of a coding sequence (eg. structural gene) into MRNA. A promoter will have a transcription initiating region, which is usually placed proximal to the 5′ end of the coding sequence, and a TATA box, usually located 25-30 base pairs (bp) upstream of the transcription initiation site. The TATA box is thought to direct RNA polymerase II to begin RNA synthesis at the correct site. A mammalian promoter will also contain an upstream promoter element, usually located within 100 to 200 bp upstream of the TATA box. An upstream promoter element determines the rate at which transcription is initiated and can act in either orientation [Sambrook et al. (1989) “Expression of Cloned Genes in Mammalian Cells.” In Molecular Cloning: A Laboratory Manual, 2nd ed.].
  • Mammalian viral genes are often highly expressed and have a broad host range; therefore sequences encoding mammalian viral genes provide particularly useful promoter sequences. Examples include the SV40 early promoter, mouse mammary tumor virus LTR promoter, adenovirus major late promoter (Ad MLP), and herpes simplex virus promoter. In addition, sequences derived from non-viral genes, such as the murine metallotheionin gene, also provide useful promoter sequences. Expression may be either constitutive or regulated (inducible), depending on the promoter can be induced with glucocorticoid in hormone-responsive cells.
  • The presence of an enhancer element (enhancer), combined with the promoter elements described above, will usually increase expression levels. An enhancer is a regulatory DNA sequence that can stimulate transcription up to 1000-fold when linked to homologous or heterologous promoters, with synthesis beginning at the normal RNA start site. Enhancers are also active when they are placed upstream or downstream from the transcription initiation site, in either normal or flipped orientation, or at a distance of more than 1000 nucleotides from the promoter [Maniatis et al. (1987) Science 236:1237; Alberts et al. (1989) Molecular Biology of the Cell, 2nd ed.]. Enhancer elements derived from viruses may be particularly useful, because they usually have a broader host range. Examples include the SV40 early gene enhancer [Dijkema et al (1985) EMBO J. 4:761] and the enhancer/promoters derived from the long terminal repeat (LTR) of the Rous Sarcoma Virus [Gorman et al. (1982b) Proc. Natl. Acad. Sci. 79:6777] and from human cytomegalovirus [Boshart et al. (1985) Cell 41:521]. Additionally, some enhancers are regulatable and become active only in the presence of an inducer, such as a hormone or metal ion [Sassone-Corsi and Borelli (1986) Trends Genet. 2:215; Maniatis et al. (1987) Science 236:1237].
  • A DNA molecule may be expressed intracellularly in mammalian cells. A promoter sequence may be directly linked with the DNA molecule, in which case the first amino acid at the N-terminus of the recombinant protein will always be a methionine, which is encoded by the ATG start codon. If desired, the N-terminus may be cleaved from the protein by in vitro incubation with cyanogen bromide.
  • Alternatively, foreign proteins can also be secreted from the cell into the growth media by creating chimeric DNA molecules that encode a fusion protein comprised of a leader sequence fragment that provides for secretion of the foreign protein in mammalian cells. Preferably, there are processing sites encoded between the leader fragment and the foreign gene that can be cleaved either in vivo or in vitro. The leader sequence fragment usually encodes a signal peptide comprised of hydrophobic amino acids which direct the secretion of the protein from the cell. The adenovirus tripartite leader is an example of a leader sequence that provides for secretion of a foreign protein in mammalian cells.
  • Usually, transcription termination and polyadenylation sequences recognized by mammalian cells are regulatory regions located 3′ to the translation stop codon and thus, together with the promoter elements, flank the coding sequence. The 3′ terminus of the mature mRNA is formed by site-specific post-transcriptional cleavage and polyadenylation [Bimstiel et al. (1985) Cell 41:349; Proudfoot and Whitelaw (1988) “Termination and 3′ end processing of eukaryotic RNA. In Transcription and splicing (ed. B. D. Hames and D. M. Glover); Proudfoot (1989) Trends Biochem. Sci. 14:105]. These sequences direct the transcription of an mRNA which can be translated into the polypeptide encoded by the DNA. Examples of transcription terminater/polyadenylation signals include those derived from SV40 [Sambrook et al (1989) “Expression of cloned genes in cultured mammalian cells.” In Molecular Cloning: A Laboratory Manual].
  • Usually, the above described components, comprising a promoter, polyadenylation signal, and transcription termination sequence are put together into expression constructs. Enhancers, introns with functional splice donor and acceptor sites, and leader sequences may also be included in an expression construct, if desired. Expression constructs are often maintained in a replicon, such as an extrachromosomal element (eg. plasmids) capable of stable maintenance in a host, such as mammalian cells or bacteria. Mammalian replication systems include those derived from animal viruses, which require trans-acting factors to replicate. For example, plasmids containing the replication systems of papovaviruses, such as SV40 [Gluzman (1981) Cell 23:175] or polyomavirus, replicate to extremely high copy number in the presence of the appropriate viral T antigen. Additional examples of mammalian replicons include those derived from bovine papillomavirus and Epstein-Barr virus. Additionally, the replicon may have two replication systems, thus allowing it to be maintained, for example, in mammalian cells for expression and in a prokaryotic host for cloning and amplification. Examples of such mammalian-bacteria shuttle vectors include pMT2 [Kaufman et al. (1989) Mol. Cell. Biol. 9:946] and pHEBO [Shimizu et al. (1986) Mol. Cell. Biol. 6:1074].
  • The transformation procedure used depends upon the host to be transformed. Methods for introduction of heterologous polynucleotides into mammalian cells are known in the art and include dextran-mediated transfection, calcium phosphate precipitation, polybrene mediated transfection, protoplast fusion, electroporation, encapsulation of the polynucleotide(s) in liposomes, and direct microinjection of the DNA into nuclei.
  • Mammalian cell lines available as hosts for expression are known in the art and include many immortalized cell lines available from the American Type Culture Collection (ATCC), including but not limited to, Chinese hamster ovary (CHO) cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells (eg. Hep G2), and a number of other cell lines.
  • ii. Baculovirus Systems
  • The polynucleotide encoding the protein can also be inserted into a suitable insect expression vector, and is operably linked to the control elements within that vector. Vector construction employs techniques which are known in the art. Generally, the components of the expression system include a transfer vector, usually a bacterial plasmid, which contains both a fragment of the baculovirus genome, and a convenient restriction site for insertion of the heterologous gene or genes to be expressed; a wild type baculovirus with a sequence homologous to the baculovirus-specific fragment in the transfer vector (this allows for the homologous recombination of the heterologous gene in to the baculovirus genome); and appropriate insect host cells and growth media.
  • After inserting the DNA sequence encoding the protein into the transfer vector, the vector and the wild type viral genome are transfected into an insect host cell where the vector and viral genome are allowed to recombine. The packaged recombinant virus is expressed and recombinant plaques are identified and purified. Materials and methods for baculovirus/insect cell expression systems are commercially available in kit form from, inter alia, Invitrogen, San Diego Calif. (“MaxBac” kit). These techniques are generally known to those skilled in the art and fully described in Summers and Smith, Texas Agricultural Experiment Station Bulletin No. 1555 (1987) (hereinafter “Summers and Smith”).
  • Prior to inserting the DNA sequence encoding the protein into the baculovirus genome, the above described components, comprising a promoter, leader (if desired), coding sequence, and transcription termination sequence, are usually assembled into an intermediate transplacement construct (transfer vector). This may contain a single gene and operably linked regulatory elements; multiple genes, each with its owned set of operably linked regulatory elements; or multiple genes, regulated by the same set of regulatory elements. Intermediate transplacement constructs are often maintained in a replicon, such as an extra-chromosomal element (e.g. plasmids) capable of stable maintenance in a host, such as a bacterium. The replicon will have a replication system, thus allowing it to be maintained in a suitable host for cloning and amplification.
  • Currently, the most commonly used transfer vector for introducing foreign genes into AcNPV is pAc373. Many other vectors, known to those of skill in the art, have also been designed. These include, for example, pVL985 (which alters the polyhedrin start codon from ATG to ATT, and which introduces a BamHI cloning site 32 basepairs downstream from the ATT; see Luckow and Summers, Virology (1989) 17:31.
  • The plasmid usually also contains the polyhedrin polyadenylation signal (Miller et al. (1988) Ann. Rev. Microbiol., 42:177) and a prokaryotic ampicillin-resistance (amp) gene and origin of replication for selection and propagation in E. coli.
  • Baculovirus transfer vectors usually contain a baculovirus promoter. A baculovirus promoter is any DNA sequence capable of binding a baculovirus RNA polymerase and initiating the downstream (5′ to 3′) transcription of a coding sequence (eg. structural gene) into mRNA. A promoter will have a transcription initiation region which is usually placed proximal to the 5′ end of the coding sequence. This transcription initiation region usually includes an RNA polymerase binding site and a transcription initiation site. A baculovirus transfer vector may also have a second domain called an enhancer, which, if present, is usually distal to the structural gene. Expression may be either regulated or constitutive.
  • Structural genes, abundantly transcribed at late times in a viral infection cycle, provide particularly useful promoter sequences. Examples include sequences derived from the gene encoding the viral polyhedron protein, Friesen et al., (1986) “The Regulation of Baculovirus Gene Expression,” in: The Molecular Biology of Baculoviruses (ed. Walter Doerfler); EPO Publ. Nos. 127 839 and 155 476; and the gene encoding the p10 protein, Vlak et al., (1988), J. Gen. Virol. 69:765.
  • DNA encoding suitable signal sequences can be derived from genes for secreted insect or baculovirus proteins, such as the baculovirus polyhedrin gene (Carbonell et al. (1988) Gene, 73:409). Alternatively, since the signals for mammalian cell posttranslational modifications (such as signal peptide cleavage, proteolytic cleavage, and phosphorylation) appear to be recognized by insect cells, and the signals required for secretion and nuclear accumulation also appear to be conserved between the invertebrate cells and vertebrate cells, leaders of non-insect origin, such as those derived from genes encoding human α-interferon, Maeda et al., (1985), Nature 315:592; human gastrin-releasing peptide, Lebacq-Verheyden et al., (1988), Molec. Cell. Biol. 8:3129; human IL-2, Smith et al., (1985) Proc. Nat'l Acad. Sci. USA, 82:8404; mouse IL-3, (Miyajima et al., (1987) Gene 58:273; and human glucocerebrosidase, Martin et al. (1988) DNA, 7:99, can also be used to provide for secretion in insects.
  • A recombinant polypeptide or polyprotein may be expressed intracellularly or, if it is expressed with the proper regulatory sequences, it can be secreted. Good intracellular expression of nonfused foreign proteins usually requires heterologous genes that ideally have a short leader sequence containing suitable translation initiation signals preceding an ATG start signal. If desired, methionine at the N-terminus may be cleaved from the mature protein by in vitro incubation with cyanogen bromide.
  • Alternatively, recombinant polyproteins or proteins which are not naturally secreted can be secreted from the insect cell by creating chimeric DNA molecules that encode a fusion protein comprised of a leader sequence fragment that provides for secretion of the foreign protein in insects. The leader sequence fragment usually encodes a signal peptide comprised of hydrophobic amino acids which direct the translocation of the protein into the endoplasmic reticulum.
  • After insertion of the DNA sequence and/or the gene encoding the expression product precursor of the protein, an insect cell host is co-transformed with the heterologous DNA of the transfer vector and the genomic DNA of wild type baculovirus—usually by co-transfection. The promoter and transcription termination sequence of the construct will usually comprise a 2-5 kb section of the baculovirus genome. Methods for introducing heterologous DNA into the desired site in the baculovirus virus are known in the art. (See Summers and Smith supra; Ju et al. (1987); Smith et al., Mol. Cell. Biol. (1983) 3:2156; and Luckow and Summers (1989)). For example, the insertion can be into a gene such as the polyhedrin gene, by homologous double crossover recombination; insertion can also be into a restriction enzyme site engineered into the desired baculovirus gene. Miller et al., (1989), Bioessays 4:91. The DNA sequence, when cloned in place of the polyhedrin gene in the expression vector, is flanked both 5′ and 3′ by polyhedrin-specific sequences and is positioned downstream of the polyhedrin promoter.
  • The newly formed baculovirus expression vector is subsequently packaged into an infectious recombinant baculovirus. Homologous recombination occurs at low frequency (between about 1% and about 5%); thus, the majority of the virus produced after cotransfection is still wild-type virus. Therefore, a method is necessary to identify recombinant viruses. An advantage of the expression system is a visual screen allowing recombinant viruses to be distinguished. The polyhedrin protein, which is produced by the native virus, is produced at very high levels in the nuclei of infected cells at late times after viral infection. Accumulated polyhedrin protein forms occlusion bodies that also contain embedded particles. These occlusion bodies, up to 15 μm in size, are highly refractile, giving them a bright shiny appearance that is readily visualized under the light microscope. Cells infected with recombinant viruses lack occlusion bodies. To distinguish recombinant virus from wild-type virus, the transfection supernatant is plaqued onto a monolayer of insect cells by techniques known to those skilled in the art. Namely, the plaques are screened under the light microscope for the presence (indicative of wild-type virus) or absence (indicative of recombinant virus) of occlusion bodies. “Current Protocols in Microbiology” Vol. 2 (Ausubel et al. eds) at 16.8 (Supp. 10, 1990); Summers and Smith, supra; Miller et al. (1989).
  • Recombinant baculovirus expression vectors have been developed for infection into several insect cells. For example, recombinant baculoviruses have been developed for, inter alia: Aedes aegypti , Autographa californica, Bombyx mori, Drosophila melanogaster, Spodoptera frugiperda, and Trichoplusia ni (WO 89/046699; Carbonell et al., (1985) J. Virol. 56:153; Wright (1986) Nature 321:718; Smith et al., (1983) Mol. Cell. Biol. 3:2156; and see generally, Fraser, et al. (1989) In Vitro Cell. Dev. Biol. 25:225).
  • Cells and cell culture media are commercially available for both direct and fusion expression of heterologous polypeptides in a baculovirus/expression system; cell culture technology is generally known to those skilled in the art. See, eg. Summers and Smith supra.
  • The modified insect cells may then be grown in an appropriate nutrient medium, which allows for stable maintenance of the plasmid(s) present in the modified insect host. Where the expression product gene is under inducible control, the host may be grown to high density, and expression induced. Alternatively, where expression is constitutive, the product will be continuously expressed into the medium and the nutrient medium must be continuously circulated, while removing the product of interest and augmenting depleted nutrients. The product may be purified by such techniques as chromatography, eg. HPLC, affinity chromatography, ion exchange chromatography, etc.; electrophoresis; density gradient centrifugation; solvent extraction, etc. As appropriate, the product may be further purified, as required, so as to remove substantially any insect proteins which are also present in the medium, so as to provide a product which is at least substantially free of host debris, eg. proteins, lipids and polysaccharides.
  • In order to obtain protein expression, recombinant host cells derived from the transformants are incubated under conditions which allow expression of the recombinant protein encoding sequence. These conditions will vary, dependent upon the host cell selected. However, the conditions are readily ascertainable to those of ordinary skill in the art, based upon what is known in the art.
  • iii. Plant Systems
  • There are many plant cell culture and whole plant genetic expression systems known in the art. Exemplary plant cellular genetic expression systems include those described in patents, such as: U.S. Pat. Nos. 5,693,506; 5,659,122; and 5,608,143. Additional examples of genetic expression in plant cell culture has been described by Zenk, Phytochemistry 30:3861-3863 (1991). Descriptions of plant protein signal peptides may be found in addition to the references described above in Vaulcombe et al., Mol. Gen. Genet. 209:33-40 (1987); Chandler et al., Plant Molecular Biology 3:407-418 (1984); Rogers, J. Biol. Chem. 260:3731-3738 (1985); Rothstein et al., Gene 55:353-356 (1987); Whittier et al., Nucleic Acids Research 15:2515-2535 (1987); Wirsel et al., Molecular Microbiology 3:3-14 (1989); Yu et al., Gene 122:247-253 (1992). A description of the regulation of plant gene expression by the phytohormone, gibberellic acid and secreted enzymes induced by gibberellic acid can be found in R. L. Jones and J. MacMillin, Gibberellins: in: Advanced Plant Physiology,. Malcolm B. Wilkins, ed., 1984 Pitman Publishing Limited, London, pp. 21-52. References that describe other metabolically-regulated genes: Sheen, Plant Cell, 2:1027-1038(1990); Maas et al., EMBO J. 9:3447-3452 (1990); Benkel and Hickey, Proc. Natl. Acad. Sci. 84:1337-1339 (1987).
  • Typically, using techniques known in the art, a desired polynucleotide sequence is inserted into an expression cassette comprising genetic regulatory elements designed for operation in plants. The expression cassette is inserted into a desired expression vector with companion sequences upstream and downstream from the expression cassette suitable for expression in a plant host. The companion sequences will be of plasmid or viral origin and provide necessary characteristics to the vector to permit the vectors to move DNA from an original cloning host, such as bacteria, to the desired plant host. The basic bacterial/plant vector construct will preferably provide a broad host range prokaryote replication origin; a prokaryote selectable marker; and, for Agrobacterium transformations, T DNA sequences for Agrobacterium-mediated transfer to plant chromosomes. Where the heterologous gene is not readily amenable to detection, the construct will preferably also have a selectable marker gene suitable for determining if a plant cell has been transformed. A general review of suitable markers, for example for the members of the grass family, is found in Wilmink and Dons, 1993, Plant Mol. Biol. Reptr, 11(2):165-185.
  • Sequences suitable for permitting integration of the heterologous sequence into the plant genome are also recommended. These might include transposon sequences and the like for homologous recombination as well as Ti sequences which permit random insertion of a heterologous expression cassette into a plant genome. Suitable prokaryote selectable markers include resistance toward antibiotics such as ampicillin or tetracycline. Other DNA sequences encoding additional functions may also be present in the vector, as is known in the art.
  • The nucleic acid molecules of the subject invention may be included into an expression cassette for expression of the protein(s) of interest. Usually, there will be only one expression cassette, although two or more are feasible. The recombinant expression cassette will contain in addition to the heterologous protein encoding sequence the following elements, a promoter region, plant 5′ untranslated sequences, initiation codon depending upon whether or not the structural gene comes equipped with one, and a transcription and translation termination sequence. Unique restriction enzyme sites at the 5′ and 3′ ends of the cassette allow for easy insertion into a pre-existing vector.
  • A heterologous coding sequence may be for any protein relating to the present invention. The sequence encoding the protein of interest will encode a signal peptide which allows processing and translocation of the protein, as appropriate, and will usually lack any sequence which might result in the binding of the desired protein of the invention to a membrane. Since, for the most part, the transcriptional initiation region will be for a gene which is expressed and translocated during germination, by employing the signal peptide which provides for translocation, one may also provide for translocation of the protein of interest. In this way, the protein(s) of interest will be translocated from the cells in which they are expressed and may be efficiently harvested. Typically secretion in seeds are across the aleurone or scutellar epithelium layer into the endosperm of the seed. While it is not required that the protein be secreted from the cells in which the protein is produced, this facilitates the isolation and purification of the recombinant protein.
  • Since the ultimate expression of the desired gene product will be in a eucaryotic cell it is desirable to determine whether any portion of the cloned gene contains sequences which will be processed out as introns by the host's splicosome machinery. If so, site-directed mutagenesis of the “intron” region may be conducted to prevent losing a portion of the genetic message as a false intron code, Reed and Maniatis, Cell 41:95-105, 1985.
  • The vector can be microinjected directly into plant cells by use of micropipettes to mechanically transfer the recombinant DNA. Crossway, Mol. Gen. Genet, 202:179-185, 1985. The genetic material may also be transferred into the plant cell by using polyethylene glycol, Krens, et al., Nature, 296, 72-74, 1982. Another method of introduction of nucleic acid segments is high velocity ballistic penetration by small particles with the nucleic acid either within the matrix of small beads or particles, or on the surface, Klein, et al., Nature, 327, 70-73, 1987 and Knudsen and Muller, 1991, Planta, 185:330-336 teaching particle bombardment of barley endosperm to create transgenic barley. Yet another method of introduction would be fusion of protoplasts with other entities, either minicells, cells, lysosomes or other fusible lipid-surfaced bodies, Fraley, et al., Proc. Natl. Acad. Sci. USA, 79, 1859-1863, 1982.
  • The vector may also be introduced into the plant cells by electroporation. (Fromm et al., Proc. Natl Acad. Sci. USA 82:5824, 1985). In this technique, plant protoplasts are electroporated in the presence of plasmids containing the gene construct. Electrical impulses of high field strength reversibly permeabilize biomembranes allowing the introduction of the plasmids. Electroporated plant protoplasts reform the cell wall, divide, and form plant callus.
  • All plants from which protoplasts can be isolated and cultured to give whole regenerated plants can be transformed by the present invention so that whole plants are recovered which contain the transferred gene. It is known that practically all plants can be regenerated from cultured cells or tissues, including but not limited to all major species of sugarcane, sugar beet, cotton, fruit and other trees, legumes and vegetables. Some suitable plants include, for example, species from the genera Fragaria, Lotus, Medicago, Onobrychis, Trifolium, Trigonella, Vigna, Citrus, Linum, Geranium, Manihot, Daucus, Arabidopsis, Brassica, Raphanus, Sinapis, Atropa, Capsicum, Datura, Hyoscyamus, Lycopersion, Nicotiana, Solanum, Petunia, Digitalis, Majorana, Cichorium, Helianthus, Lactuca, Bromus, Asparagus, Antirrhinum, Hererocallis, Nemesia, Pelargonium, Panicum, Pennisetum, Ranunculus, Senecio, Salpiglossis, Cucumis, Browaalia, Glycine, Lolium, Zea, Triticum, Sorghum, and Datura.
  • Means for regeneration vary from species to species of plants, but generally a suspension of transformed protoplasts containing copies of the heterologous gene is first provided. Callus tissue is formed and shoots may be induced from callus and subsequently rooted. Alternatively, embryo formation can be induced from the protoplast suspension. These embryos germinate as natural embryos to form plants. The culture media will generally contain various amino acids and hormones, such as auxin and cytokinins. It is also advantageous to add glutamic acid and proline to the medium, especially for such species as corn and alfalfa. Shoots and roots normally develop simultaneously. Efficient regeneration will depend on the medium, on the genotype, and on the history of the culture. If these three variables are controlled, then regeneration is fully reproducible and repeatable.
  • In some plant cell culture systems, the desired protein of the invention may be excreted or alternatively, the protein may be extracted from the whole plant. Where the desired protein of the invention is secreted into the medium, it may be collected. Alternatively, the embryos and embryoless-half seeds or other plant tissue may be mechanically disrupted to release any secreted protein between cells and tissues. The mixture may be suspended in a buffer solution to retrieve soluble proteins. Conventional protein isolation and purification methods will be then used to purify the recombinant protein. Parameters of time, temperature pH, oxygen, and volumes will be adjusted through routine methods to optimize expression and recovery of heterologous protein.
  • iv. Bacterial Systems
  • Bacterial expression techniques are known in the art. A bacterial promoter is any DNA sequence capable of binding bacterial RNA polymerase and initiating the downstream (3′ ) transcription of a coding sequence (eg. structural gene) into MRNA. A promoter will have a transcription initiation region which is usually placed proximal to the 5′ end of the coding sequence. This transcription initiation region usually includes an RNA polymerase binding site and a transcription initiation site. A bacterial promoter may also have a second domain called an operator, that may overlap an adjacent RNA polymerase binding site at which RNA synthesis begins. The operator permits negative regulated (inducible) transcription, as a gene repressor protein may bind the operator and thereby inhibit transcription of a specific gene. Constitutive expression may occur in the absence of negative regulatory elements, such as the operator. In addition, positive regulation may be achieved by a gene activator protein binding sequence, which, if present is usually proximal (5′ ) to the RNA polymerase binding sequence. An example of a gene activator protein is the catabolite activator protein (CAP), which helps initiate transcription of the lac operon in Escherichia coli (E.coli) [Raibaud et al. (1984) Annu. Rev. Genet. 18:173]. Regulated expression may therefore be either positive or negative, thereby either enhancing or reducing transcription.
  • Sequences encoding metabolic pathway enzymes provide particularly useful promoter sequences. Examples include promoter sequences derived from sugar metabolizing enzymes, such as galactose, lactose (lac) [Chang et al. (1977) Nature 198:1056], and maltose. Additional examples include promoter sequences derived from biosynthetic enzymes such as tryptophan (trp) [Goeddel et al. (1980) Nuc. Acids Res. 8:4057; Yelverton et al. (1981) Nucl. Acids Res. 9:731; U.S. Pat. No. 4,738,921; EP-A-0036776 and EP-A-0121775]. The g-laotamase (bla) promoter system [Weissmann (1981) “The cloning of interferon and other mistakes.” In Interferon 3 (ed. I. Gresser)], bacteriophage lambda PL [Shimatake et al. (1981) Nature 292:128] and T5 [U.S. Pat. No. 4,689,406] promoter systems also provide useful promoter sequences.
  • In addition, synthetic promoters which do not occur in nature also finction as bacterial promoters. For example, transcription activation sequences of one bacterial or bacteriophage promoter may be joined with the operon sequences of another bacterial or bacteriophage promoter, creating a synthetic hybrid promoter [U.S. Pat. No. 4,551,433]. For example, the tac promoter is a hybrid trp-lac promoter comprised of both trp promoter and lac operon sequences that is regulated by the lac repressor [Amann et al. (1983) Gene 25:167; de Boer et al. (1983) Proc. Natl. Acad. Sci. 80:21]. Furthermore, a bacterial promoter can include naturally occurring promoters of non-bacterial origin that have the ability to bind bacterial RNA polymerase and initiate transcription. A naturally occurring promoter of non-bacterial origin can also be coupled with a compatible RNA polymerase to produce high levels of expression of some genes in prokaryotes. The bacteriophage T7 RNA polymerase/promoter system is an example of a coupled promoter system [Studier et al. (1986) J. Mol. Biol. 189:113; Tabor et al. (1985) Proc Natl. Acad. Sci. 82:1074]. In addition, a hybrid promoter can also be comprised of a bacteriophage promoter and an E.coli operator region (EPO-A-0 267 851).
  • In addition to a finctioning promoter sequence, an efficient ribosome binding site is also useful for the expression of foreign genes in prokaryotes. In E.coli, the ribosome binding site is called the Shine-Dalgarno (SD) sequence and includes an initiation codon (ATG) and a sequence 3-9 nucleotides in length located 3-11 nucleotides upstream of the initiation codon [Shine et al. (1975) Nature 254:34]. The SD sequence is thought to promote binding of mRNA to the ribosome by the pairing of bases between the SD sequence and the 3′ and of E.coli 16S rRNA [Steitz et al. (1979) “Genetic signals and nucleotide sequences in messenger RNA.” In Biological Regulation and Development: Gene Expression (ed. R.F. Goldberger)]. To express eukaryotic genes and prokaryotic genes with weak ribosome-binding site [Sambrook et al. (1989) “Expression of cloned genes in Escherichia coli.” In Molecular Cloning: A Laboratory Manual].
  • A DNA molecule may be expressed intracellularly. A promoter sequence may be directly linked with the DNA molecule, in which case the first amino acid at the N-terminus will always be a methionine, which is encoded by the ATG start codon. If desired, methionine at the N-terminus may be cleaved from the protein by in vitro incubation with cyanogen bromide or by either in vivo on in vitro incubation with a bacterial methionine N-terminal peptidase (EP-A-0 219 237).
  • Fusion proteins provide an alternative to direct expression. Usually, a DNA sequence encoding the N-terminal portion of an endogenous bacterial protein, or other stable protein, is fused to the 5′ end of heterologous coding sequences. Upon expression, this construct will provide a fusion of the two amino acid sequences. For example, the bacteriophage lambda cell gene can be linked at the 5′ terminus of a foreign gene and expressed in bacteria. The resulting fusion protein preferably retains a site for a processing enzyme (factor Xa) to cleave the bacteriophage protein from the foreign gene [Nagai et al. (1984) Nature 309:810]. Fusion proteins can also be made with sequences from the lacZ [Jia et al. (1987) Gene 60:197], trpE [Allen et al. (1987) J. Biotechnol. 5:93; Makoff et al. (1989) J. Gen. Microbiol. 135:11], and Chey [EP-A-0 324 647] genes. The DNA sequence at the junction of the two amino acid sequences may or may not encode a cleavable site. Another example is a ubiquitin fusion protein. Such a fusion protein is made with the ubiquitin region that preferably retains a site for a processing enzyme (eg. ubiquitin specific processing-protease) to cleave the ubiquitin from the foreign protein. Through this method, native foreign protein can be isolated [Miller et al. (1989) Bio/Technology 7:698].
  • Alternatively, foreign proteins can also be secreted from the cell by creating chimeric DNA molecules that encode a fusion protein comprised of a signal peptide sequence fragment that provides for secretion of the foreign protein in bacteria [U.S. Pat. No. 4,336,336]. The signal sequence fragment usually encodes a signal peptide comprised of hydrophobic amino acids which direct the secretion of the protein from the cell. The protein is either secreted into the growth media (gram-positive bacteria) or into the periplasmic space, located between the inner and outer membrane of the cell (gram-negative bacteria). Preferably there are processing sites, which can be cleaved either in vivo or in vitro encoded between the signal peptide fragment and the foreign gene.
  • DNA encoding suitable signal sequences can be derived from genes for secreted bacterial proteins, such as the E.coli outer membrane protein gene (ompA) [Masui et al. (1983), in: Experimental Manipulation of Gene Expression; Ghrayeb et al. (1984) EMBO J. 3:2437] and the E.coli alkaline phosphatase signal sequence (phoA) [Oka et al. (1985) Proc. Natl. Acad. Sci. 82:7212]. As an additional example, the signal sequence of the alpha-amylase gene from various Bacillus strains can be used to secrete heterologous proteins from B. subtilis [Palva et al. (1982) Proc. Nat. Acad. Sci. USA 79:5582; EP-A-0 244 042].
  • Usually, transcription termination sequences recognized by bacteria are regulatory regions located 3′ to the translation stop codon, and thus together with the promoter flank the coding sequence. These sequences direct the transcription of an mRNA which can be translated into the polypeptide encoded by the DNA. Transcription termination sequences frequently include DNA sequences of about 50 nucleotides capable of forming stem loop structures that aid in terminating transcription. Examples include transcription termination sequences derived from genes with strong promoters, such as the trp gene in E. coli as well as other biosynthetic genes.
  • Usually, the above described components, comprising a promoter, signal sequence (if desired), coding sequence of interest, and transcription termination sequence, are put together into expression constructs. Expression constructs are often maintained in a replicon, such as an extrachromosomal element (eg. plasmids) capable of stable maintenance in a host, such as bacteria. The replicon will have a replication system, thus allowing it to be maintained in a prokaryotic host either for expression or for cloning and amplification. In addition, a replicon may be either a high or low copy number plasmid. A high copy number plasmid will generally have a copy number ranging from about 5 to about 200, and usually about 10 to about 150. A host containing a high copy number plasmid will preferably contain at least about 10, and more preferably at least about 20 plasmids. Either a high or low copy number vector may be selected, depending upon the effect of the vector and the foreign protein on the host.
  • Alternatively, the expression constructs can be integrated into the bacterial genome with an integrating vector. Integrating vectors usually contain at least one sequence homologous to the bacterial chromosome that allows the vector to integrate. Integrations appear to result from recombinations between homologous DNA in the vector and the bacterial chromosome. For example, integrating vectors constructed with DNA from various Bacillus strains integrate into the Bacillus chromosome (EP-A-0 127 328). Integrating vectors may also be comprised of bacteriophage or transposon sequences.
  • Usually, extrachromosomal and integrating expression constructs may contain selectable markers to allow for the selection of bacterial strains that have been transformed. Selectable markers can be expressed in the bacterial host and may include genes which render bacteria resistant to drugs such as ampicillin, chloramphenicol, erythromycin, kanamycin (neomycin), and tetracycline [Davies et al. (1978) Annu. Rev. Microbiol. 32:469]. Selectable markers may also include biosynthetic genes, such as those in the histidine, tryptophan, and leucine biosynthetic pathways.
  • Alternatively, some of the above described components can be put together in transformation vectors. Transformation vectors are usually comprised of a selectable market that is either maintained in a replicon or developed into an integrating vector, as described above.
  • Expression and transformation vectors, either extra-chromosomal replicons or integrating vectors, have been developed for transformation into many bacteria. For example, expression vectors have been developed for, inter alia, the following bacteria: Bacillus subtilis [Palva et al. (1982) Proc. Natl. Acad. Sci. USA 79:5582; EP-A-0 036 259 and EP-A-0 063 953; WO 84/04541], Escherichia coli [Shimatake et al. (1981) Nature 292:128; Amann et al. (1985) Gene 40:183; Studier et al. (1986) J. Mol. Biol. 189:113; EP-A-0 036 776, EP-A-0 136 829 and EP-A-0 136 907], Streptococcus cremoris [Powell et al. (1988) Appl. Environ. Microbiol. 54:655]; Streptococcus lividans [Powell et al. (1988) Appl. Environ. Microbiol. 54:655], Streptomyces lividans [U.S. Pat. No. 4,745,056].
  • Methods of introducing exogenous DNA into bacterial hosts are well-known in the art, and usually include either the transformation of bacteria treated with CaCl2 or other agents, such as divalent cations and DMSO. DNA can also be introduced into bacterial cells by electroporation. Transformation procedures usually vary with the bacterial species to be transformed. See eg. [Masson et al. (1989) FEMS Microbiol. Lett. 60:273; Palva et al. (1982) Proc. Natl. Acad. Sci. USA 79:5582; EP-A-0 036 259 and EP-A-0 063 953; WO 84/04541, Bacillus], [Miller et al. (1988) Proc. Natl. Acad. Sci. 85:856; Wang et al. (1990) J. Bacteriol. 172:949, Campylobacter], [Cohen et al. (1973) Proc. Natl. Acad. Sci. 69:2110; Dower et al. (1988) Nucleic Acids Res. 16:6127; Kushner (1978) “An improved method for transformation of Escherichia coli with ColE1-derived plasmids. In Genetic Engineering: Proceedings of the International Symposium on Genetic Engineering (eds. H. W. Boyer and S. Nicosia); Mandel et al. (1970) J. Mol. Biol. 53:159; Taketo (1988) Biochim. Biophys. Acta 949:318; Escherichia], [Chassy et al. (1987) FEMS Microbiol. Lett. 44:173 Lactobacillus]; [Fiedler et al. (1988) Anal. Biochem 170:38, Pseudomonas]; [Augustin et al. (1990) FEMS Microbiol. Lett. 66:203, Staphylococcus], [Barany et al. (1980) J. Bacteriol. 144:698; Harlander (1987) “Transformation of Streptococcus lactis by electroporation, in: Streptococcal Genetics (ed. J. Ferretti and R. Curtiss III); Perry et al. (1981) Infect. Immun. 32:1295; Powell et al. (1988) Appl. Environ. Microbiol. 54:655; Somkuti et al. (1987) Proc. 4th Evr. Cong. Biotechnology 1:412, Streptococcus].
  • v. Yeast Expression
  • Yeast expression systems are also known to one of ordinary skill in the art. A yeast promoter is any DNA sequence capable of binding yeast RNA polymerase and initiating the downstream (3′ ) transcription of a coding sequence (eg. structural gene) into mRNA. A promoter will have a transcription initiation region which is usually placed proximal to the 5′ end of the coding sequence. This transcription initiation region usually includes an RNA polymerase binding site (the “TATA Box”) and a transcription initiation site. A yeast promoter may also have a second domain called an upstream activator sequence (UAS), which, if present, is usually distal to the structural gene. The UAS permits regulated (inducible) expression. Constitutive expression occurs in the absence of a UAS. Regulated expression may be either positive or negative, thereby either enhancing or reducing transcription.
  • Yeast is a fermenting organism with an active metabolic pathway, therefore sequences encoding enzymes in the metabolic pathway provide particularly useful promoter sequences. Examples include alcohol dehydrogenase (ADH) (EP-A-0 284 044), enolase, glucokinase, glucose-6-phosphate isomerase, glyceraldehyde-3-phosphate-dehydrogenase (GAP or GAPDH), hexokinase, phosphofructokinase, 3-phosphoglycerate mutase, and pyruvate kinase (PyK) (EPO-A-0 329 203). The yeast PHO5 gene, encoding acid phosphatase, also provides useful promoter sequences [Myanohara et al. (1983) Proc. Natl. Acad. Sci. USA 80:1].
  • In addition, synthetic promoters which do not occur in nature also finction as yeast promoters. For example, UAS sequences of one yeast promoter may be joined with the transcription activation region of another yeast promoter, creating a synthetic hybrid promoter. Examples of such hybrid promoters include the ADH regulatory sequence linked to the GAP transcription activation region (U.S. Pat. Nos. 4,876,197 and 4,880,734). Other examples of hybrid promoters include promoters which consist of the regulatory sequences of either the ADH2, GAL4, GAL10, OR PHO5 genes, combined with the transcriptional activation region of a glycolytic enzyme gene such as GAP or PyK (EP-A-0 164 556). Furthermore, a yeast promoter can include naturally occurring promoters of non-yeast origin that have the ability to bind yeast RNA polymerase and initiate transcription. Examples of such promoters include, inter alia, [Cohen et al. (1980) Proc. Natl. Acad. Sci. USA 77:1078; Henikoff et al. (1981) Nature 283:835; Hollenberg et al. (1981) Curr. Topics Microbiol. Immunol. 96:119; Hollenberg et al. (1979) “The Expression of Bacterial Antibiotic Resistance Genes in the Yeast Saccharomyces cerevisiae,” in: Plasmids of Medical, Environmental and Commercial Importance (eds. K. N. Timmis and A. Puhler); Mercerau-Puigalon et al. (1980) Gene 11:163; Panthier et al. (1980) Curr. Genet. 2:109;].
  • A DNA molecule may be expressed intracellularly in yeast. A promoter sequence may be directly linked with the DNA molecule, in which case the first amino acid at the N-terminus of the recombinant protein will always be a methionine, which is encoded by the ATG start codon. If desired, methionine at the N-terminus may be cleaved from the protein by in vitro incubation with cyanogen bromide.
  • Fusion proteins provide an alternative for yeast expression systems, as well as in mammalian, baculovirus, and bacterial expression systems. Usually, a DNA sequence encoding the N-terninal portion of an endogenous yeast protein, or other stable protein, is fused to the 5′ end of heterologous coding sequences. Upon expression, this construct will provide a fusion of the two amino acid sequences. For example, the yeast or human superoxide dismutase (SOD) gene, can be linked at the 5′ terminus of a foreign gene and expressed in yeast. The DNA sequence at the junction of the two amino acid sequences may or may not encode a cleavable site. See eg. EP-A-0 196 056. Another example is a ubiquitin fusion protein. Such a fusion protein is made with the ubiquitin region that preferably retains a site for a processing enzyme (eg. ubiquitin-specific processing protease) to cleave the ubiquitin from the foreign protein. Through this method, therefore, native foreign protein can be isolated (eg. WO88/024066).
  • Alternatively, foreign proteins can also be secreted from the cell into the growth media by creating chimeric DNA molecules that encode a fusion protein comprised of a leader sequence fragment that provide for secretion in yeast of the foreign protein. Preferably, there are processing sites encoded between the leader fragment and the foreign gene that can be cleaved either in vivo or in vitro. The leader sequence fragment usually encodes a signal peptide comprised of hydrophobic amino acids which direct the secretion of the protein from the cell.
  • DNA encoding suitable signal sequences can be derived from genes for secreted yeast proteins, such as the yeast invertase gene (EP-A-0 012 873; JPO. 62,096,086) and the A-factor gene (U.S. Pat. No. 4,588,684). Alternatively, leaders of non-yeast origin, such as an interferon leader, exist that also provide for secretion in yeast (EP-A-0 060 057).
  • A preferred class of secretion leaders are those that employ a fragment of the yeast alpha-factor gene, which contains both a “pre” signal sequence, and a “pro” region. The types of alpha-factor fragments that can be employed include the full-length pre-pro alpha factor leader (about 83 amino acid residues) as well as truncated alpha-factor leaders (usually about 25 to about 50 amino acid residues) (U.S. Pat. Nos. 4,546,083 and 4,870,008; EP-A-0 324 274). Additional leaders employing an alpha-factor leader fragment that provides for secretion include hybrid alpha-factor leaders made with a presequence of a first yeast, but a pro-region from a second yeast alphafactor. (eg. see WO 89/02463.)
  • Usually, transcription termination sequences recognized by yeast are regulatory regions located 3′ to the translation stop codon, and thus together with the promoter flank the coding sequence. These sequences direct the transcription of an mRNA which can be translated into the polypeptide encoded by the DNA. Examples of transcription terminator sequence and other yeast-recognized termination sequences, such as those coding for glycolytic enzymes.
  • Usually, the above described components, comprising a promoter, leader (if desired), coding sequence of interest, and transcription termination sequence, are put together into expression constructs. Expression constructs are often maintained in a replicon, such as an extrachromosomal element (eg. plasmids) capable of stable maintenance in a host, such as yeast or bacteria. The replicon may have two replication systems, thus allowing it to be maintained, for example, in yeast for expression and in a prokaryotic host for cloning and amplification. Examples of such yeast-bacteria shuttle vectors include YEp24 [Botstein et al. (1979) Gene 8:17-24], pCl/1 [Brake et al. (1984) Proc. Natl. Acad. Sci USA 81:4642-4646], and YRp17 [Stinchcomb et al. (1982) J. Mol. Biol. 158:157]. In addition, a replicon may be either a high or low copy number plasmid. A high copy number plasmid will generally have a copy number ranging from about 5 to about 200, and usually about 10 to about 150. A host containing a high copy number plasmid will preferably have at least about 10, and more preferably at least about 20. Enter a high or low copy number vector may be selected, depending upon the effect of the vector and the foreign protein on the host. See eg. Brake et al., supra.
  • Alternatively, the expression constructs can be integrated into the yeast genome with an integrating vector. Integrating vectors usually contain at least one sequence homologous to a yeast chromosome that allows the vector to integrate, and preferably contain two homologous sequences flanking the expression construct. Integrations appear to result from recombinations between homologous DNA in the vector and the yeast chromosome [Orr-Weaver et al. (1983) Methods in Enzymol. 101:228-245]. An integrating vector may be directed to a specific locus in yeast by selecting the appropriate homologous sequence for inclusion in the vector. See Orr-Weaver et al., supra. One or more expression construct may integrate, possibly affecting levels of recombinant protein produced [Rine et al. (1983) Proc. Natl. Acad. Sci. USA 80:6750]. The chromosomal sequences included in the vector can occur either as a single segment in the vector, which results in the integration of the entire vector, or two segments homologous to adjacent segments in the chromosome and flanking the expression construct in the vector, which can result in the stable integration of only the expression construct.
  • Usually, extrachromosomal and integrating expression constructs may contain selectable markers to allow for the selection of yeast strains that have been transformed. Selectable markers may include biosynthetic genes that can be expressed in the yeast host, such as ADE2, HIS4, LEU2, TRP1, and ALG7, and the G418 resistance gene, which confer resistance in yeast cells to tunicamycin and G418, respectively. In addition, a suitable selectable marker may also provide yeast with the ability to grow in the presence of toxic compounds, such as metal. For example, the presence of CUP1 allows yeast to grow in the presence of copper ions [Butt et al. (1987) Microbiol, Rev. 51:351].
  • Alternatively, some of the above described components can be put together into transformation vectors. Transformation vectors are usually comprised of a selectable marker that is either maintained in a replicon or developed into an integrating vector, as described above.
  • Expression and transformation vectors, either extrachromosomal replicons or integrating vectors, have been developed for transformation into many yeasts. For example, expression vectors have been developed for, inter alia, the following yeasts: Candida albicans [Kurtz, et al. (1986) Mol. Cell. Biol. 6:142], Candida maltosa [Kunze, et al. (1985) J. Basic Microbiol. 25:141]. Hansenula polymorpha [Gleeson, et al. (1986) J. Gen. Microbiol. 132:3459; Roggenkamp et al. (1986) Mol. Gen. Genet. 202:302], Kluyveromyces fragilis [Das, et al. (1984) J. Bacteriol. 158:1165], Kluyveromyces lactis [De Louvencourt et al. (1983) J. Bacteriol. 154:737; Van den Berg et al. (1990) Bio/Technology 8:135], Pichia guillerimondii [Kunze et al. (1985) J. Basic Microbiol. 25:141], Pichia pastoris [Cregg, et al. (1985) Mol. Cell. Biol. 5:3376; U.S. Pat. Nos. 4,837,148 and 4,929,555], Saccharomyces cerevisiae [Hinnen et al. (1978) Proc. Natl. Acad. Sci. USA 75:1929; Ito et al. (1983) J. Bacteriol. 153:163], Schizosaccharomyces pombe [Beach and Nurse (1981) Nature 300:706], and Yarrowia lipolytica [Davidow, et al. (1985) Curr. Genet. 10:380471 Gaillardin, et al. (1985) Curr. Genet. 10:49].
  • Methods of introducing exogenous DNA into yeast hosts are well-known in the art, and usually include either the transformation of spheroplasts or of intact yeast cells treated with alkali cations. Transformation procedures usually vary with the yeast species to be transformed. See eg. [Kurtz et al. (1986) Mol. Cell. Biol. 6:142; Kunze et al. (1985) J. Basic Microbiol. 25:141; Candida]; [Gleeson et al. (1986) J. Gen. Microbiol. 132:3459; Roggenkamp et al. (1986) Mol. Gen. Genet. 202:302; Hansenula]; [Das et al. (1984) J. Bacteriol. 158:1165; De Louvencourt et al. (1983) J. Bacteriol. 154:1165; Van den Berg et al. (1990) Bio/Technology 8:135; Kluyveromyces]; [Cregg et al. (1985) Mol. Cell. Biol. 5:3376; Kunze et al. (1985) J. Basic Microbiol. 25:141; U.S. Pat. Nos. 4,837,148 and 4,929,555; Pichia]; [Hinnen et al. (1978) Proc. Natl. Acad. Sci. USA 75;1929; Ito et al. (1983) J. Bacteriol 153:163 Saccharomyces]; [Beach and Nurse (1981) Nature 300:706; Schizosaccharomyces]; [Davidow et al. (1985) Curr. Genet. 10:39; Gaillardin et al. (1985) Curr. Genet. 10:49; Yarrowia].
  • Antibodies
  • As used herein, the term “antibody” refers to a polypeptide or group of polypeptides composed of at least one antibody combining site. An “antibody combining site” is the three-dimensional binding space with an internal surface shape and charge distribution complementary to the features of an epitope of an antigen, which allows a binding of the antibody with the antigen. “Antibody” includes, for example, vertebrate antibodies, hybrid antibodies, chimeric antibodies, humanised antibodies, altered antibodies, univalent antibodies, Fab proteins, and single domain antibodies.
  • Antibodies against the proteins of the invention are useful for affinity chromatography, immunoassays, and distinguishing/identifying streptococcus proteins.
  • Antibodies to the proteins of the invention, both polyclonal and monoclonal, may be prepared by conventional methods. In general, the protein is first used to immunize a suitable animal, preferably a mouse, rat, rabbit or goat. Rabbits and goats are preferred for the preparation of polyclonal sera due to the volume of serum obtainable, and the availability of labeled anti-rabbit and anti-goat antibodies. Immunization is generally performed by mixing or emulsifying the protein in saline, preferably in an adjuvant such as Freund's complete adjuvant, and injecting the mixture or emulsion parenterally (generally subcutaneously or intramuscularly). A dose of 50-200 μg/injection is typically sufficient. Immunization is generally boosted 2-6 weeks later with one or more injections of the protein in saline, preferably using Freund's incomplete adjuvant. One may alternatively generate antibodies by in vitro immunization using methods known in the art, which for the purposes of this invention is considered equivalent to in vivo immunization. Polyclonal antisera is obtained by bleeding the immunized animal into a glass or plastic container, incubating the blood at 25° C. for one hour, followed by incubating at 4° C. for 2-18 hours. The serum is recovered by centrifugation (eg. 1,000g for 10 minutes). About 20-50 ml per bleed may be obtained from rabbits.
  • Monoclonal antibodies are prepared using the standard method of Kohler & Milstein [Nature (1975) 256:495-96], or a modification thereof. Typically, a mouse or rat is immunized as described above. However, rather than bleeding the animal to extract serum, the spleen (and optionally several large lymph nodes) is removed and dissociated into single cells. If desired, the spleen cells may be screened (after removal of nonspecifically adherent cells) by applying a cell suspension to a plate or well coated with the protein antigen. B-cells expressing membrane-bound immunoglobulin specific for the antigen bind to the plate, and are not rinsed away with the rest of the suspension. Resulting B-cells, or all dissociated spleen cells, are then induced to fuse with myeloma cells to form hybridomas, and are cultured in a selective medium (eg hypoxanthine, aminopterin, thymidine medium, “HAT”). The resulting hybridomas are plated by limiting dilution, and are assayed for production of antibodies which bind specifically to the immunizing antigen (and which do not bind to unrelated antigens). The selected MAb-secreting hybridomas are then cultured either in vitro (eg. in tissue culture bottles or hollow fiber reactors), or in vivo (as ascites in mice).
  • If desired, the antibodies (whether polyclonal or monoclonal) may be labeled using conventional techniques. Suitable labels include fluorophores, chromophores, radioactive atoms (particularly 32P and 25I), electron-dense reagents, enzymes, and ligands having specific binding partners. Enzymes are typically detected by their activity. For example, horseradish peroxidase is usually detected by its ability to convert 3,3′,5,5′-tetramethylbenzidine (TMB) to a blue pigment, quantifiable with a spectrophotometer. “Specific binding partner” refers to a protein capable of binding a ligand molecule with high specificity, as for example in the case of an antigen and a monoclonal antibody specific therefor. Other specific binding partners include biotin and avidin or streptavidin, IgG and protein A, and the numerous receptor-ligand couples known in the art. It should be understood that the above description is not meant to categorize the various labels into distinct classes, as the same label may serve in several different modes. For example, 125I may serve as a radioactive label or as an electron-dense reagent. HRP may serve as enzyme or as antigen for a MAb. Further, one may combine various labels for desired effect. For example, MAbs and avidin also require labels in the practice of this invention: thus, one might label a MAb with biotin, and detect its presence with avidin labeled with 125I, or with an anti-biotin MAb labeled with HRP. Other permutations and possibilities will be readily apparent to those of ordinary skill in the art, and are considered as equivalents within the scope of the instant invention.
  • Pharmaceutical Compositions
  • Pharmaceutical compositions can comprise either polypeptides, antibodies, or nucleic acid of the invention. The pharmaceutical compositions will comprise a therapeutically effective amount of either polypeptides, antibodies, or polynucleotides of the claimed invention.
  • The term “therapeutically effective amount” as used herein refers to an amount of a therapeutic agent to treat, ameliorate, or prevent a desired disease or condition, or to exhibit a detectable therapeutic or preventative effect. The effect can be detected by, for example, chemical markers or antigen levels. Therapeutic effects also include reduction in physical symptoms, such as decreased body temperature. The precise effective amount for a subject will depend upon the subject's size and health, the nature and extent of the condition, and the therapeutics or combination of therapeutics selected for administration. Thus, it is not useful to specify an exact effective amount in advance. However, the effective amount for a given situation can be determined by routine experimentation and is within the judgement of the clinician.
  • For purposes of the present invention, an effective dose will be from about 0.01 mg/ kg to 50 mg/kg or 0.05 mg/kg to about 10 mg/kg of the molecule of the invention in the individual to which it is administered.
  • A pharmaceutical composition can also contain a pharmaceutically acceptable carrier. The term “pharmaceutically acceptable carrier” refers to a carrier for administration of a therapeutic agent, such as antibodies or a polypeptide, genes, and other therapeutic agents. The term refers to any pharmaceutical carrier that does not itself induce the production of antibodies harmful to the individual receiving the composition, and which may be administered without undue toxicity. Suitable carriers may be large, slowly metabolized macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, and inactive virus particles. Such carriers are well known to those of ordinary skill in the art.
  • Pharmaceutically acceptable salts can be used therein, for example, mineral acid salts such as hydrochlorides, hydrobromides, phosphates, sulfates, and the like; and the salts of organic acids such as acetates, propionates, malonates, benzoates, and the like. A thorough discussion of pharmaceutically acceptable excipients is available in Remington's Pharmaceutical Sciences (Mack Pub. Co., N.J. 1991).
  • Pharmaceutically acceptable carriers in therapeutic compositions may contain liquids such as water, saline, glycerol and ethanol. Additionally, auxiliary substances, such as wetting or emulsifying agents, pH buffering substances, and the like, may be present in such vehicles. Typically, the therapeutic compositions are prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection may also be prepared. Liposomes are included within the definition of a pharmaceutically acceptable carrier.
  • Delivery Methods
  • Once formulated, the compositions of the invention can be administered directly to the subject. The subjects to be treated can be animals; in particular, human subjects can be treated.
  • Direct delivery of the compositions will generally be accomplished by injection, either subcutaneously, intraperitoneally, intravenously or intramuscularly or delivered to the interstitial space of a tissue. The compositions can also be administered into a lesion. Other modes of administration include oral and pulmonary administration, suppositories, and transdermal or transcutaneous applications (eg. see WO98/20734), needles, and gene guns or hyposprays. Dosage treatment may be a single dose schedule or a multiple dose schedule.
  • Vaccines
  • Vaccines according to the invention may either be prophylactic (ie. to prevent infection) or therapeutic (ie. to treat disease after infection).
  • Such vaccines comprise immunising antigen(s), immunogen(s), polypeptide(s), protein(s) or nucleic acid, usually in combination with “pharmaceutically acceptable carriers,” which include any carrier that does not itself induce the production of antibodies harmful to the individual receiving the composition. Suitable carriers are typically large, slowly metabolized macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, lipid aggregates (such as oil droplets or liposomes), and inactive virus particles. Such carriers are well known to those of ordinary skill in the art. Additionally, these carriers may function as immunostimulating agents (“adjuvants”). Furthermore, the antigen or immunogen may be conjugated to a bacterial toxoid, such as a toxoid from diphtheria, tetanus, cholera, H. pylori, etc. pathogens.
  • Preferred adjuvants to enhance effectiveness of the composition include, but are not limited to: (1) oil-in-water emulsion formulations (with or without other specific immunostimulating agents such as muramyl peptides (see below) or bacterial cell wall components), such as for example (a) MF59™ (WO90/14837; Chapter 10 in Vaccine Design—the subunit and adjuvant approach (1995) ed. Powell & Newman), containing 5% Squalene, 0.5% Tween 80, and 0.5% Span 85 (optionally containing MTP-PE) formulated into submicron particles using a microfluidizer, (b) SAF, containing 10% Squalane, 0.4% Tween 80, 5% pluronic-blocked polymer L121, and thr-MDP either microfluidized into a submicron emulsion or vortexed to generate a larger particle size emulsion, and (c) RIBI™ adjuvant system (RAS), (Ribi Immunochem, Hamilton, Mont.) containing 2% Squalene, 0.2% Tween 80, and one or more bacterial cell wall components from the group consisting of monophosphorylipid A (MPL), trehalose dimycolate (TDM), and cell wall skeleton (CWS), preferably MPL+CWS (DETOX™); (2) saponin adjuvants, such as QS21 or STIMULON™ (Cambridge Bioscience, Worcester, Mass.) may be used or particles generated therefrom such as ISCOMs (immunostimulating complexes), which ISCOMS may be devoid of additional detergent e.g. WO00/07621; (3) Complete Freund's Adjuvant (CFA) and Incomplete Freund's Adjuvant (IFA); (4) cytokines, such as interleukins (e.g. IL-1, IL-2, IL-4, IL-5, IL-6, IL-7, IL-12 (WO99/44636), etc.), interferons (e.g. gamma interferon), macrophage colony stimulating factor (M-CSF), tumor necrosis factor (TNF), etc.; (5) monophosphoryl lipid A (MPL) or 3-O-deacylated MPL (3dMPL) e.g. GB-2220221, EP-A-0689454; (6) combinations of 3dMPL with, for example, QS21 and/or oil-in-water emulsions e.g. EP-A-0835318, EP-A-0735898, EP-A-0761231; (7) oligonucleotides comprising CpG motifs [Krieg Vaccine 2000, 19, 618-622; Krieg Curr Opin Mol Ther 2001 3:15-24; Roman et al., Nat. Med., 1997, 3, 849-854; Weiner et al., PNAS USA, 1997, 94, 10833-10837; Davis et al., J. Immunol., 1998, 160, 870-876; Chu et al., J. Exp. Med., 1997, 186, 1623-1631; Lipford et al., Eur. J. Immunol., 1997, 27, 2340-2344; Moldoveanu et al., Vaccine, 1988, 16, 1216-1224, Krieg et al., Nature, 1995, 374, 546-549; Klinman et al., PNAS USA, 1996, 93, 2879-2883; Ballas et al., J. Immunol., 1996, 157, 1840-1845; Cowdery et al., J. Immunol., 1996, 156, 4570-4575; Halpern et al., Cell. Immunol., 1996, 167, 72-78; Yamamoto et al., Jpn. J. Cancer Res., 1988, 79, 866-873; Stacey et al., J. Immunol., 1996, 157, 2116-2122; Messina et al., J. Immunol., 1991, 147, 1759-1764; Yi et al., J. Immunol., 1996, 157, 4918-4925; Yi et al., J. Immunol., 1996, 157, 5394-5402; Yi et al., J. Immunol., 1998, 160, 4755-4761; and Yi et al., J. Immunol., 1998, 160, 5898-5906; International patent applications WO96/02555, WO98/16247, WO98/18810, WO98/40100, WO98/55495, WO98/37919 and WO98/52581] i.e. containing at least one CG dinucleotide, with 5-methylcytosine optionally being used in place of cytosine; (8) a polyoxyethylene ether or a polyoxyethylene ester e.g. WO99/52549; (9) a polyoxyethylene sorbitan ester surfactant in combination with an octoxynol (e.g. WO01/21207) or a polyoxyethylene alkyl ether or ester surfactant in combination with at least one additional non-ionic surfactant such as an octoxynol (e.g. WO01/21152); (10) an immunostimulatory oligonucleotide (e.g. a CpG oligonucleotide) and a saponin e.g. WO00/62800; (11) an immunostimulant and a particle of metal salt e.g. WO00/23105; (12) a saponin and an oil-in-water emulsion e.g. WO99/11241; (13) a saponin (e.g. QS21)+3dMPL+IL-12 (optionally+a sterol) e.g. WO98/57659; (14) aluminium salts, preferably hydroxide or phosphate, but any other suitable salt may also be used (e.g. hydroxyphosphate, oxyhydroxide, orthophosphate, sulphate etc. [e.g. see chapters 8 & 9 of Powell & Newman]). Mixtures of different aluminium salts may also be used. The salt may take any suitable form (e.g. gel, crystalline, amorphous etc.); (15) other substances that act as immunostimulating agents to enhance the efficacy of the composition. Aluminium salts and/or MF59™ are preferred.
  • As mentioned above, muramyl peptides include, but are not limited to, N-acetyl-muramyl-L-threonyl-D-isoglutamine (thr-MDP), N-acetyl-normuramyl-L-alanyl-D-isoglutamine (nor-MDP), N-acetylmuramyl-L-alanyl-D-isoglutaminyl-L-alanine-2-(1′-2′-dipalmitoyl-sn-glycero-3-hydroxyphos-phoryloxy) -ethylamine (MTP-PE), etc.
  • The immunogenic compositions (eg. the immunising antigen/immunogen/polypeptide/protein/nucleic acid, pharmaceutically acceptable carrier, and adjuvant) typically will contain diluents, such as water, saline, glycerol, ethanol, etc. Additionally, auxiliary substances, such as wetting or emulsifying agents, pH buffering substances, and the like, may be present in such vehicles.
  • Typically, the immunogenic compositions are prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection may also be prepared. The preparation also may be emulsified or encapsulated in liposomes for enhanced adjuvant effect, as discussed above under pharmaceutically acceptable carriers.
  • Immunogenic compositions used as vaccines comprise an immunologically effective amount of the antigenic or immunogenic polypeptides, as well as any other of the above-mentioned components, as needed. By “immunologically effective amount”, it is meant that the administration of that amount to an individual, either in a single dose or as part of a series, is effective for treatment or prevention. This amount varies depending upon the health and physical condition of the individual to be treated, the taxonomic group of individual to be treated (eg. nonhuman primate, primate, etc.), the capacity of the individual's immune system to synthesize antibodies, the degree of protection desired, the formulation of the vaccine, the treating doctor's assessment of the medical situation, and other relevant factors. It is expected that the amount will fall in a relatively broad range that can be determined through routine trials.
  • The immunogenic compositions are conventionally administered parenterally, eg. by injection, either subcutaneously, intramuscularly, or transdermally/transcutaneously (eg. WO98/20734). Additional formulations suitable for other modes of administration include oral and pulmonary formulations, suppositories, and transdermal applications. Dosage treatment may be a single dose schedule or a multiple dose schedule. The vaccine may be administered in conjunction with other immunoregulatory agents.
  • As an alternative to protein-based vaccines, DNA vaccination may be used [eg. Robinson & Torres (1997) Seminars in Immunol 9:271-283; Donnelly et al. (1997) Annu Rev Immunol 15:617-648; later herein].
  • Gene Delivery Vehicles
  • Gene therapy vehicles for delivery of constructs including a coding sequence of a therapeutic of the invention, to be delivered to the mammal for expression in the mammal, can be administered either locally or systemically. These constructs can utilize viral or non-viral vector approaches in in vivo or ex vivo modality. Expression of such coding sequence can be induced using endogenous mammalian or heterologous promoters. Expression of the coding sequence in vivo can be either constitutive or regulated.
  • The invention includes gene delivery vehicles capable of expressing the contemplated nucleic acid sequences. The gene delivery vehicle is preferably a viral vector and, more preferably, a retroviral, adenoviral, adeno-associated viral (AAV), herpes viral, or alphavirus vector. The viral vector can also be an astrovirus, coronavirus, orthomyxovirus, papovavirus, paramyxovirus, parvovirus, picornavirus, poxvirus, or togavirus viral vector. See generally, Jolly (1994) Cancer Gene Therapy 1:51-64; Kimura (1994) Human Gene Therapy 5:845-852; Connelly (1995) Human Gene Therapy 6:185-193; and Kaplitt (1994) Nature Genetics 6:148-153.
  • Retroviral vectors are well known in the art and we contemplate that any retroviral gene therapy vector is employable in the invention, including B, C and D type retroviruses, xenotropic retroviruses (for example, NZB-X1, NZB-X2 and NZB9-1 (see O'Neill (1985) J. Virol. 53:160) polytropic retroviruses eg. MCF and MCF-MLV (see Kelly (1983) J. Virol. 45:291), spumaviruses and lentiviruses. See RNA Tumor Viruses, Second Edition, Cold Spring Harbor Laboratory, 1985.
  • Portions of the retroviral gene therapy vector may be derived from different retroviruses. For example, retrovector LTRs may be derived from a Murine Sarcoma Virus, a tRNA binding site from a Rous Sarcoma Virus, a packaging signal from a Murine Leukemia Virus, and an origin of second strand synthesis from an Avian Leukosis Virus.
  • These recombinant retroviral vectors may be used to generate transduction competent retroviral vector particles by introducing them into appropriate packaging cell lines (see U.S. Pat. No. 5,591,624). Retrovirus vectors can be constructed for site-specific integration into host cell DNA by incorporation of a chimeric integrase enzyme into the retroviral particle (see WO96/37626). It is preferable that the recombinant viral vector is a replication defective recombinant virus.
  • Packaging cell lines suitable for use with the above-described retrovirus vectors are well known in the art, are readily prepared (see WO95/30763 and WO92/05266), and can be used to create producer cell lines (also termed vector cell lines or “VCLs”) for the production of recombinant vector particles. Preferably, the packaging cell lines are made from human parent cells (eg. HT1080 cells) or mink parent cell lines, which eliminates inactivation in human serum.
  • Preferred retroviruses for the construction of retroviral gene therapy vectors include Avian Leukosis Virus, Bovine Leukemia, Virus, Murine Leukemia Virus, Mink-Cell Focus-Inducing Virus, Murine Sarcoma Virus, Reticuloendotheliosis Virus and Rous Sarcoma Virus. Particularly preferred Murine Leukemia Viruses include 4070A and 1504A (Hartley and Rowe (1976) J Virol 19:19-25), Abelson (ATCC No. VR-999), Friend (ATCC No. VR-245), Graffi, Gross (ATCC Nol VR-590), Kirsten, Harvey Sarcoma Virus and Rauscher (ATCC No. VR-998) and Moloney Murine Leukemia Virus (ATCC No. VR-190). Such retroviruses may be obtained from depositories or collections such as the American Type Culture Collection (“ATCC”) in Rockville, Md. or isolated from known sources using commonly available techniques.
  • Exemplary known retroviral gene therapy vectors employable in this invention include those described in patent applications GB2200651, EP0415731, EP0345242, EP0334301, WO89/02468; WO89/05349, WO89/09271, WO90/02806, WO90/07936, WO94/03622, WO93/25698, WO93/25234, WO93/1 1230, WO93/10218, WO91/02805, WO91/02825, WO95/07994, U.S. Pat. Nos. 5,219,740, 4,405,712, 4,861,719, 4,980,289, 4,777,127, 5,591,624. See also Vile (1993) Cancer Res 53:3860-3864; Vile (1993) Cancer Res 53:962-967; Ram (1993) Cancer Res 53 (1993) 83-88; Takamiya (1992) J Neurosci Res 33:493-503; Baba (1993) J Neurosurg 79:729-735; Mann (1983) Cell 33:153; Cane (1984) Proc Natl Acad Sci 81:6349; and Miller (1990) Human Gene Therapy 1.
  • Human adenoviral gene therapy vectors are also known in the art and employable in this invention. See, for example, Berkner (1988) Biotechniques 6:616 and Rosenfeld (1991) Science 252:431, and WO93/07283, WO93/06223, and WO93/07282. Exemplary known adenoviral gene therapy vectors employable in this invention include those described in the above referenced documents and in WO94/12649, WO93/03769, WO93/19191, WO94/28938, WO95/11984, WO95/00655, WO95/27071, WO95/29993, WO95/34671, WO96/05320, WO94/08026, WO94/11506, WO93/06223, WO94/24299, WO95/14102, WO95/24297, WO95/02697, WO94/28152, WO94/24299, WO95/09241, WO95/25807, WO95/05835, WO94/18922 and WO95/09654. Alternatively, administration of DNA linked to killed adenovirus as described in Curiel (1992) Hum. Gene Ther. 3:147-154 may be employed. The gene delivery vehicles of the invention also include adenovirus associated virus (AAV) vectors. Leading and preferred examples of such vectors for use in this invention are the AAV-2 based vectors disclosed in Srivastava, WO93/09239. Most preferred AAV vectors comprise the two AAV inverted terminal repeats in which the native D-sequences are modified by substitution of nucleotides, such that at least 5 native nucleotides and up to 18 native nucleotides, preferably at least 10 native nucleotides up to 18 native nucleotides, most preferably 10 native nucleotides are retained and the remaining nucleotides of the D-sequence are deleted or replaced with non-native nucleotides. The native D-sequences of the AAV inverted terminal repeats are sequences of 20 consecutive nucleotides in each AAV inverted terminal repeat (ie. there is one sequence at each end) which are not involved in HP formation. The non-native replacement nucleotide may be any nucleotide other than the nucleotide found in the native D-sequence in the same position. Other employable exemplary AAV vectors are pWP-19, pWN-1, both of which are disclosed in Nahreini (1993) Gene 124:257-262. Another example of such an AAV vector is psub201 (see Samulski (1987) J. Virol. 61:3096). Another exemplary AAV vector is the Double-D ITR vector. Construction of the Double-D ITR vector is disclosed in U.S. Pat. No. 5,478,745. Still other vectors are those disclosed in Carter U.S. Pat. No. 4,797,368 and Muzyczka U.S. Pat. No. 5,139,941, Chartejee U.S. Pat. No. 5,474,935, and Kotin WO94/288157. Yet a further example of an AAV vector employable in this invention is SSV9AFABTKneo, which contains the AFP enhancer and albumin promoter and directs expression predominantly in the liver. Its structure and construction are disclosed in Su (1996) Human Gene Therapy 7:463-470. Additional AAV gene therapy vectors are described in U.S. Pat. Nos. 5,354,678, 5,173,414, 5,139,941, and 5,252,479.
  • The gene therapy vectors of the invention also include herpes vectors. Leading and preferred examples are herpes simplex virus vectors containing a sequence encoding a thymidine kinase polypeptide such as those disclosed in U.S. Pat. No. 5,288,641 and EP0176170 (Roizman). Additional exemplary herpes simplex virus vectors include HFEM/ICP6-LacZ disclosed in WO95/04139 (Wistar Institute), pHSVlac described in Geller (1988) Science 241:1667-1669 and in WO90/09441 and WO92/07945, HSV Us3::pgC-lacZ described in Fink (1992) Human Gene Therapy 3:11-19 and HSV 7134, 2 RH 105 and GAL4 described in EP 0453242 (Breakefield), and those deposited with the ATCC with accession numbers VR-977 and VR-260.
  • Also contemplated are alpha virus gene therapy vectors that can be employed in this invention. Preferred alpha virus vectors are Sindbis viruses vectors. Togaviruses, Semliki Forest virus (ATCC VR-67; ATCC VR-1247), Middleberg virus (ATCC VR-370), Ross River virus (ATCC VR-373; ATCC VR-1246), Venezuelan equine encephalitis virus (ATCC VR923; ATCC VR-1250; ATCC VR-1249; ATCC VR-532), and those described in U.S. Pat. Nos. 5,091,309, 5,217,879, and WO92/10578. More particularly, those alpha virus vectors described in U.S. Ser. No. 08/405,627, filed Mar. 15, 1995, WO94/21792, WO92/10578, WO95/07994, U.S. Pat. Nos. 5,091,309 and 5,217,879 are employable. Such alpha viruses may be obtained from depositories or collections such as the ATCC in Rockville, Md. or isolated from known sources using commonly available techniques. Preferably, alphavirus vectors with reduced cytotoxicity are used (see U.S. Ser. No. 08/679640).
  • DNA vector systems such as eukaryotic layered expression systems are also useful for expressing the nucleic acids of the invention. See WO95/07994 for a detailed description of eukaryotic layered expression systems. Preferably, the eukaryotic layered expression systems of the invention are derived from alphavirus vectors and most preferably from Sindbis viral vectors.
  • Other viral vectors suitable for use in the present invention include those derived from poliovirus, for example ATCC VR-58 and those described in Evans, Nature 339 (1989) 385 and Sabin (1973) J. Biol. Standardization 1:115; rhinovirus, for example ATCC VR- 1110 and those described in Arnold (1990) J Cell Biochem L401; pox viruses such as canary pox virus or vaccinia virus, for example ATCC VR-111 and ATCC VR-2010 and those described in Fisher-Hoch (1989) Proc Natl Acad Sci 86:317; Flexner (1989) Ann NY Acad Sci 569:86, Flexner (1990) Vaccine 8:17; in U.S. Pat. Nos. 4,603,112 and 4,769,330 and WO89/01973; SV40 virus, for example ATCC VR-305 and those described in Mulligan (1979) Nature 277:108 and Madzak (1992) J Gen Virol 73:1533; influenza virus, for example ATCC VR-797 and recombinant influenza viruses made employing reverse genetics techniques as described in U.S. Pat. No. 5,166,057 and in Enami (1990) Proc Natl Acad Sci 87:3802-3805; Enami & Palese (1991) J Virol 65:2711-2713 and Luytjes (1989) Cell 59:110, (see also McMichael (1983) NEJ Med 309:13, and Yap (1978) Nature 273:238 and Nature (1979) 277:108); human immunodeficiency virus as described in EP-0386882 and in Buchschacher (1992) J. Virol. 66:2731; measles virus, for example ATCC VR-67 and VR-1247 and those described in EP-0440219; Aura virus, for example ATCC VR-368; Bebaru virus, for example ATCC VR-600 and ATCC VR-1240; Cabassou virus, for example ATCC VR-922; Chikungunya virus, for example ATCC VR-64 and ATCC VR-1241; Fort Morgan Virus, for example ATCC VR-924; Getah virus, for example ATCC VR-369 and ATCC VR-1243; Kyzylagach virus, for example ATCC VR-927; Mayaro virus, for example ATCC VR-66; Mucambo virus, for example ATCC VR-580 and ATCC VR-1244; Ndumu virus, for example ATCC VR-371; Pixuna virus, for example ATCC VR-372 and ATCC VR-1245; Tonate virus, for example ATCC VR-925; Triniti virus, for example ATCC VR-469; Una virus, for example ATCC VR-374; Whataroa virus, for example ATCC VR-926; Y-62-33 virus, for example ATCC VR-375; O'Nyong virus, Eastern encephalitis virus, for example ATCC VR-65 and ATCC VR-1242; Western encephalitis virus, for example ATCC VR-70, ATCC VR-1251, ATCC VR-622 and ATCC VR-1252; and coronavirus, for example ATCC VR-740 and those described in Hamre (1966) Proc Soc Exp Biol Med 121:190.
  • Delivery of the compositions of this invention into cells is not limited to the above mentioned viral vectors. Other delivery methods and media may be employed such as, for example, nucleic acid expression vectors, polycationic condensed DNA linked or unlinked to killed adenovirus alone, for example see U.S. Ser. No. 08/366,787, filed Dec. 30, 1994 and Curiel (1992) Hum Gene Ther 3:147-154 ligand linked DNA, for example see Wu (1989) J Biol Chem 264:16985-16987, eucaryotic cell delivery vehicles cells, for example see U.S. Ser. No.08/240,030, filed May 9, 1994, and U.S. Ser. No. 08/404,796, deposition of photopolymerized hydrogel materials, hand-held gene transfer particle gun, as described in U.S. Pat. No. 5,149,655, ionizing radiation as described in U.S. Pat. No. 5,206,152 and in WO92/11033, nucleic charge neutralization or fusion with cell membranes. Additional approaches are described in Philip (1994) Mol Cell Biol 14:2411-2418 and in Woffendin (1994) Proc Natl Acad Sci 91:1581-1585.
  • Particle mediated gene transfer may be employed, for example see U.S. Ser. No. 60/023,867. Briefly, the sequence can be inserted into conventional vectors that contain conventional control sequences for high level expression, and then incubated with synthetic gene transfer molecules such as polymeric DNA-binding cations like polylysine, protamine, and albumin, linked to cell targeting ligands such as asialoorosomucoid, as described in Wu & Wu (1987) J. Biol. Chem. 262:4429-4432, insulin as described in Hucked (1990) Biochem Pharmacol 40:253-263, galactose as described in Plank (1992) Bioconjugate Chem 3:533-539, lactose or transferrin.
  • Naked DNA may also be employed. Exemplary naked DNA introduction methods are described in WO90/11092 and U.S. Pat. No. 5,580,859. Uptake efficiency may be improved using biodegradable latex beads. DNA coated latex beads are efficiently transported into cells after endocytosis initiation by the beads. The method may be improved further by treatment of the beads to increase hydrophobicity and thereby facilitate disruption of the endosome and release of the DNA into the cytoplasm.
  • Liposomes that can act as gene delivery vehicles are described in U.S. Pat. No. 5,422,120, WO95/13796, WO94/23697, WO91/14445 and EP-524,968. As described in U.S. Ser. No. 60/023,867, on non-viral delivery, the nucleic acid sequences encoding a polypeptide can be inserted into conventional vectors that contain conventional control sequences for high level expression, and then be incubated with synthetic gene transfer molecules such as polymeric DNA-binding cations like polylysine, protamine, and albumin, linked to cell targeting ligands such as asialoorosomucoid, insulin, galactose, lactose, or transferrin. Other delivery systems include the use of liposomes to encapsulate DNA comprising the gene under the control of a variety of tissue-specific or ubiquitously-active promoters. Further non-viral delivery suitable for use includes mechanical delivery systems such as the approach described in Woffendin et al (1994) Proc. Natl. Acad. Sci. USA 91(24):11581-11585. Moreover, the coding sequence and the product of expression of such can be delivered through deposition of photopolymerized hydrogel materials. Other conventional methods for gene delivery that can be used for delivery of the coding sequence include, for example, use of hand-held gene transfer particle gun, as described in U.S. Pat. No. 5,149,655; use of ionizing radiation for activating transferred gene, as described in U.S. Pat. No. 5,206,152 and WO92/11033
  • Exemplary liposome and polycationic gene delivery vehicles are those described in U.S. Pat. Nos. 5,422,120 and 4,762,915; in WO95/13796; WO94/23697; and WO91/14445; in EP-0524968; and in Stryer, Biochemistry, pages 236-240 (1975) W. H. Freeman, San Francisco; Szoka (1980) Biochem Biophys Acta 600:1; Bayer (1979) Biochem Biophys Acta 550:464; Rivnay (1987) Meth Enzymol 149:119; Wang (1987) Proc Natl Acad Sci 84:7851; Plant (1989) Anal Biochem 176:420.
  • A polynucleotide composition can comprises therapeutically effective amount of a gene therapy vehicle, as the term is defined above. For purposes of the present invention, an effective dose will be from about 0.01 mg/ kg to 50 mg/kg or 0.05 mg/kg to about 10 mg/kg of the DNA constructs in the individual to which it is administered.
  • Deliverv Methods
  • Once formulated, the polynucleotide compositions of the invention can be administered (1) directly to the subject; (2) delivered ex vivo, to cells derived from the subject; or (3) in vitro for expression of recombinant proteins. The subjects to be treated can be mammals or birds. Also, human subjects can be treated.
  • Direct delivery of the compositions will generally be accomplished by injection, either subcutaneously, intraperitoneally, intravenously or intramuscularly or delivered to the interstitial space of a tissue. The compositions can also be administered into a lesion. Other modes of administration include oral and pulmonary administration, suppositories, and transdermal or transcutaneous applications (eg. see WO98/20734), needles, and gene guns or hyposprays. Dosage treatment may be a single dose schedule or a multiple dose schedule.
  • Methods for the ex vivo delivery and reimplantation of transformed cells into a subject are known in the art and described in eg. WO93/14778. Examples of cells useful in ex vivo applications include, for example, stem cells, particularly hematopoetic, lymph cells, macrophages, dendritic cells, or tumor cells.
  • Generally, delivery of nucleic acids for both ex vivo and in vitro applications can be accomplished by the following procedures, for example, dextran-mediated transfection, calcium phosphate precipitation, polybrene mediated transfection, protoplast fusion, electroporation, encapsulation of the polynucleotide(s) in liposomes, and direct microinjection of the DNA into nuclei, all well known in the art.
  • Polynucleotide and Polypeptide Pharmaceutical Compositions
  • In addition to the pharmaceutically acceptable carriers and salts described above, the following additional agents can be used with polynucleotide and/or polypeptide compositions.
  • A. Polypeptides
  • One example are polypeptides which include, without limitation: asioloorosomucoid (ASOR); transferrin; asialoglycoproteins; antibodies; antibody fragments; ferritin; interleukins; interferons, granulocyte, macrophage colony stimulating factor (GM-CSF), granulocyte colony stimulating factor (G-CSF), macrophage colony stimulating factor (M-CSF), stem cell factor and erythropoietin. Viral antigens, such as envelope proteins, can also be used. Also, proteins from other invasive organisms, such as the 17 amino acid peptide from the circumsporozoite protein of plasmodium falciparum known as RII.
  • B. Hormones, Vitamins, etc.
  • Other groups that can be included are, for example: hormones, steroids, androgens, estrogens, thyroid hormone, or vitamins, folic acid.
  • C. Polyalkylenes, Polysaccharides, etc.
  • Also, polyalkylene glycol can be included with the desired polynucleotides/polypeptides. In a preferred embodiment, the polyalkylene glycol is polyethlylene glycol. In addition, mono-, di-, or polysaccharides can be included. In a preferred embodiment of this aspect, the polysaccharide is dextran or DEAE-dextran. Also, chitosan and poly(lactide-co-glycolide)
  • D. Lipids, and Liposomes
  • The desired polynucleotide/polypeptide can also be encapsulated in lipids or packaged in liposomes prior to delivery to the subject or to cells derived therefrom.
  • Lipid encapsulation is generally accomplished using liposomes which are able to stably bind or entrap and retain nucleic acid. The ratio of condensed polynucleotide to lipid preparation can vary but will generally be around 1:1 (mg DNA:micromoles lipid), or more of lipid. For a review of the use of liposomes as carriers for delivery of nucleic acids, see, Hug and Sleight (1991) Biochim. Biophys. Acta. 1097:1-17; Straubinger (1983) Meth. Enzymol. 101:512-527.
  • Liposomal preparations for use in the present invention include cationic (positively charged), anionic (negatively charged) and neutral preparations. Cationic liposomes have been shown to mediate intracellular delivery of plasmid DNA (Felgner (1987) Proc. Natl. Acad. Sci. USA 84:7413-7416); mRNA (Malone (1989) Proc. Natl. Acad. Sci. USA 86:6077-6081); and purified transcription factors (Debs (1990) J. Biol. Chem. 265:10189-10192), in functional form.
  • Cationic liposomes are readily available. For example, N[1-2,3-dioleyloxy)propyl]-N,N,N-triethyl-ammonium (DOTMA) liposomes are available under the trademark Lipofectin, from GIBCO BRL, Grand Island, N.Y. (See, also, Felgner supra). Other commercially available liposomes include transfectace (DDAB/DOPE) and DOTAP/DOPE (Boerhinger). Other cationic liposomes can be prepared from readily available materials using techniques well known in the art. See, eg. Szoka (1978) Proc. Natl. Acad. Sci. USA 75:4194-4198; WO90/11092 for a description of the synthesis of DOTAP (1,2-bis(oleoyloxy)-3-(trimethylammonio)propane) liposomes.
  • Similarly, anionic and neutral liposomes are readily available, such as from Avanti Polar Lipids (Birmingham, Ala.), or can be easily prepared using readily available materials. Such materials include phosphatidyl choline, cholesterol, phosphatidyl ethanolamine, dioleoylphosphatidyl choline (DOPC), dioleoylphosphatidyl glycerol (DOPG), dioleoylphoshatidyl ethanolamine (DOPE), among others. These materials can also be mixed with the DOTMA and DOTAP starting materials in appropriate ratios. Methods for making liposomes using these materials are well known in the art.
  • The liposomes can comprise multilammelar vesicles (MLVs), small unilamellar vesicles (SUVs), or large unilamellar vesicles (LUVs). The various liposome-nucleic acid complexes are prepared using methods known in the art. See eg. Straubinger (1983) Meth. Immunol. 101:512-527; Szoka (1978) Proc. Natl. Acad. Sci. USA 75:4194-4198; Papahadjopoulos (1975) Biochim. Biophys. Acta 394:483; Wilson (1979) Cell 17:77); Deamer & Bangham (1976) Biochim. Biophys. Acta 443:629; Ostro (1977) Biochem. Biophys. Res. Commun. 76:836; Fraley (1979) Proc. Natl. Acad. Sci. USA 76:3348); Enoch & Strittmatter (1979) Proc. Natl. Acad. Sci. USA 76:145; Fraley (1980) J. Biol. Chem. (1980) 255:10431; Szoka & Papahadjopoulos (1978) Proc. Natl. Acad. Sci. USA 75:145; and Schaefer-Ridder (1982) Science 215:166.
  • E. Lipoproteins
  • In addition, lipoproteins can be included with the polynucleotide/polypeptide to be delivered. Examples of lipoproteins to be utilized include: chylomicrons, HDL, IDL, LDL, and VLDL. Mutants, fragments, or fusions of these proteins can also be used. Also, modifications of naturally occurring lipoproteins can be used, such as acetylated LDL. These lipoproteins can target the delivery of polynucleotides to cells expressing lipoprotein receptors. Preferably, if lipoproteins are including with the polynucleotide to be delivered, no other targeting ligand is included in the composition.
  • Naturally occurring lipoproteins comprise a lipid and a protein portion. The protein portion are known as apoproteins. At the present, apoproteins A, B, C, D, and E have been isolated and identified. At least two of these contain several proteins, designated by Roman numerals, AI, AII, AIV; CI, CII, CIII.
  • A lipoprotein can comprise more than one apoprotein. For example, naturally occurring chylomicrons comprises of A, B, C & E, over time these lipoproteins lose A and acquire C & E. VLDL comprises A, B, C & E apoproteins, LDL comprises apoprotein B; and HDL comprises apoproteins A, C, & E.
  • The amino acid of these apoproteins are known and are described in, for example, Breslow (1985) Annu Rev. Biochem 54:699; Law (1986) Adv. Exp Med. Biol. 151:162; Chen (1986) J Biol Chem 261:12918; Kane (1980) Proc Natl Acad Sci USA 77:2465; and Utermann (1984) Hum Genet 65:232.
  • Lipoproteins contain a variety of lipids including, triglycerides, cholesterol (free and esters), and phospholipids. The composition of the lipids varies in naturally occurring lipoproteins. For example, chylomicrons comprise mainly triglycerides. A more detailed description of the lipid content of naturally occurring lipoproteins can be found, for example, in Meth. Enzymol. 128 (1986). The composition of the lipids are chosen to aid in conformation of the apoprotein for receptor binding activity. The composition of lipids can also be chosen to facilitate hydrophobic interaction and association with the polynucleotide binding molecule.
  • Naturally occurring lipoproteins can be isolated from serum by ultracentrifugation, for instance. Such methods are described in Meth. Enzymol. (supra); Pitas (1980) J. Biochem. 255:5454-5460 and Mahey (1979) J Clin. Invest 64:743-750. Lipoproteins can also be produced by in vitro or recombinant methods by expression of the apoprotein genes in a desired host cell. See, for example, Atkinson (1986) Annu Rev Biophys Chem 15:403 and Radding (1958) Biochim Biophys Acta 30: 443. Lipoproteins can also be purchased from commercial suppliers, such as Biomedical Technologies, Inc., Stoughton, Mass., USA. Further description of lipoproteins can be found in WO98/06437.
  • F. Polycationic Agents
  • Polycationic agents can be included, with or without lipoprotein, in a composition with the desired polynucleotide/polypeptide to be delivered.
  • Polycationic agents, typically, exhibit a net positive charge at physiological relevant pH and are capable of neutralizing the electrical charge of nucleic acids to facilitate delivery to a desired location. These agents have both in vitro, ex vivo, and in vivo applications. Polycationic agents can be used to deliver nucleic acids to a living subject either intramuscularly, subcutaneously, etc.
  • The following are examples of useful polypeptides as polycationic agents: polylysine, polyarginine, polyornithine, and protamine. Other examples include histones, protamines, human serum albumin, DNA binding proteins, non-histone chromosomal proteins, coat proteins from DNA viruses, such as (X174, transcriptional factors also contain domains that bind DNA and therefore may be useful as nucleic aid condensing agents. Briefly, transcriptional factors such as C/CEBP, c-jun, c-fos, AP-1, AP-2, AP-3, CPF, Prot-1, Sp-1, Oct-1, Oct-2, CREP, and TFIID contain basic domains that bind DNA sequences.
  • Organic polycationic agents include: spermine, spermidine, and purtrescine.
  • The dimensions and of the physical properties of a polycationic agent can be extrapolated from the list above, to construct other polypeptide polycationic agents or to produce synthetic polycationic agents.
  • Synthetic polycationic agents which are useful include, for example, DEAE-dextran, polybrene. Lipofectin™, and LIPOFECTAMINE™ are monomers that form polycationic complexes when combined with polynucleotides/polypeptides.
  • Immunodiagnostic Assays
  • Streptococcus antigens of the invention can be used in immunoassays to detect antibody levels (or, conversely, anti-streptococcus antibodies can be used to detect antigen levels). Immunoassays based on well defined, recombinant antigens can be developed to replace invasive diagnostics methods. Antibodies to streptococcus proteins within biological samples, including for example, blood or serum samples, can be detected. Design of the immunoassays is subject to a great deal of variation, and a variety of these are known in the art. Protocols for the immunoassay may be based, for example, upon competition, or direct reaction, or sandwich type assays. Protocols may also, for example, use solid supports, or may be by immunoprecipitation. Most assays involve the use of labeled antibody or polypeptide; the labels may be, for example, fluorescent, chemiluminescent, radioactive, or dye molecules. Assays which amplify the signals from the probe are also known; examples of which are assays which utilize biotin and avidin, and enzyme-labeled and mediated immunoassays, such as ELISA assays.
  • Kits suitable for immunodiagnosis and containing the appropriate labeled reagents are constructed by packaging the appropriate materials, including the compositions of the invention, in suitable containers, along with the remaining reagents and materials (for example, suitable buffers, salt solutions, etc.) required for the conduct of the assay, as well as suitable set of assay instructions.
  • Nucleic Acid Hybridisation
  • “Hybridization” refers to the association of two nucleic acid sequences to one another by hydrogen bonding. Typically, one sequence will be fixed to a solid support and the other will be free in solution. Then, the two sequences will be placed in contact with one another under conditions that favor hydrogen bonding. Factors that affect this bonding include: the type and volume of solvent; reaction temperature; time of hybridization; agitation; agents to block the non-specific attachment of the liquid phase sequence to the solid support (Denhardt's reagent or BLOTTO); concentration of the sequences; use of compounds to increase the rate of association of sequences (dextran sulfate or polyethylene glycol); and the stringency of the washing conditions following hybridization. See Sambrook et al. [supra] Volume 2, chapter 9, pages 9.47 to 9.57.
  • “Stringency” refers to conditions in a hybridization reaction that favor association of very similar sequences over sequences that differ. For example, the combination of temperature and salt concentration should be chosen that is approximately 120 to 200° C. below the calculated Tm of the hybrid under study. The temperature and salt conditions can often be determined empirically in preliminary experiments in which samples of genomic DNA immobilized on filters are hybridized to the sequence of interest and then washed under conditions of different stringencies. See Sambrook et al. at page 9.50.
  • Variables to consider when performing, for example, a Southern blot are (1) the complexity of the DNA being blotted and (2) the homology between the probe and the sequences being detected. The total amount of the fragment(s) to be studied can vary a magnitude of 10, from 0.1 to 1 μg for a plasmid or phage digest to 10−9 to 10−8 g for a single copy gene in a highly complex eukaryotic genome. For lower complexity polynucleotides, substantially shorter blotting, hybridization, and exposure times, a smaller amount of starting polynucleotides, and lower specific activity of probes can be used. For example, a single-copy yeast gene can be detected with an exposure time of only 1 hour starting with 1 μg of yeast DNA, blotting for two hours, and hybridizing for 4-8 hours with a probe of 108 cpm/μg. For a single-copy mammalian gene a conservative approach would start with 10 μg of DNA, blot overnight, and hybridize overnight in the presence of 10% dextran sulfate using a probe of greater than 108 cpm/μg, resulting in an exposure time of ˜24 hours.
  • Several factors can affect the melting temperature (Tm) of a DNA-DNA hybrid between the probe and the fragment of interest, and consequently, the appropriate conditions for hybridization and washing. In many cases the probe is not 100% homologous to the fragment. Other commonly encountered variables include the length and total G+C content of the hybridizing sequences and the ionic strength and formamide content of the hybridization buffer. The effects of all of these factors can be approximated by a single equation:
    Tm=81+16.6(log10 Ci)+0.4[%(G+C)]−0.6(%formamide)−600/n−1.5(%mismatch).
  • where Ci is the salt concentration (monovalent ions) and n is the length of the hybrid in base pairs (slightly modified from Meinkoth & Wahl (1984) Anal. Biochem. 138: 267-284).
  • In designing a hybridization experiment, some factors affecting nucleic acid hybridization can be conveniently altered. The temperature of the hybridization and washes and the salt concentration during the washes are the simplest to adjust. As the temperature of the hybridization increases (ie. stringency), it becomes less likely for hybridization to occur between strands that are nonhomologous, and as a result, background decreases. If the radiolabeled probe is not completely homologous with the immobilized fragment (as is frequently the case in gene family and interspecies hybridization experiments), the hybridization temperature must be reduced, and background will increase. The temperature of the washes affects the intensity of the hybridizing band and the degree of background in a similar manner. The stringency of the washes is also increased with decreasing salt concentrations.
  • In general, convenient hybridization temperatures in the presence of 50% formamide are 42° C. for a probe with is 95% to 100% homologous to the target fragment, 37° C. for 90% to 95% homology, and 32° C. for 85% to 90% homology. For lower homologies, formamide content should be lowered and temperature adjusted accordingly, using the equation above. If the homology between the probe and the target fragment are not known, the simplest approach is to start with both hybridization and wash conditions which are nonstringent. If non-specific bands or high background are observed after autoradiography, the filter can be washed at high stringency and reexposed. If the time required for exposure makes this approach impractical, several hybridization and/or washing stringencies should be tested in parallel.
  • Nucleic Acid Probe Assays
  • Methods such as PCR, branched DNA probe assays, or blotting techniques utilizing nucleic acid probes according to the invention can determine the presence of cDNA or mRNA. A probe is said to “hybridize” with a sequence of the invention if it can form a duplex or double stranded complex, which is stable enough to be detected.
  • The nucleic acid probes will hybridize to the streptococcus nucleotide sequences of the invention (including both sense and antisense strands). Though many different nucleotide sequences will encode the amino acid sequence, the native streptococcus sequence is preferred because it is the actual sequence present in cells. mRNA represents a coding sequence and so a probe should be complementary to the coding sequence; single-stranded cDNA is complementary to mRNA, and so a cDNA probe should be complementary to the non-coding sequence.
  • The probe sequence need not be identical to the streptococcus sequence (or its complement)—some variation in the sequence and length can lead to increased assay sensitivity if the nucleic acid probe can form a duplex with target nucleotides, which can be detected. Also, the nucleic acid probe can include additional nucleotides to stabilize the formed duplex. Additional streptococcus sequence may also be helpful as a label to detect the formed duplex. For example, a non-complementary nucleotide sequence may be attached to the 5′ end of the probe, with the remainder of the probe sequence being complementary to a streptococcus sequence. Alternatively, non-complementary bases or longer sequences can be interspersed into the probe, provided that the probe sequence has sufficient complementarity with the a streptococcus sequence in order to hybridize therewith and thereby form a duplex which can be detected.
  • The exact length and sequence of the probe will depend on the hybridization conditions (e.g. temperature, salt condition etc.). For example, for diagnostic applications, depending on the complexity of the analyte sequence, the nucleic acid probe typically contains at least 10-20 nucleotides, preferably 15-25, and more preferably at least 30 nucleotides, although it may be shorter than this. Short primers generally require cooler temperatures to form sufficiently stable hybrid complexes with the template.
  • Probes may be produced by synthetic procedures, such as the triester method of Matteucci et al. [J. Am. Chem. Soc. (1981) 103:3185], or according to Urdea et al. [Proc. Natl. Acad. Sci. USA (1983) 80: 7461], or using commercially available automated oligonucleotide synthesizers.
  • The chemical nature of the probe can be selected according to preference. For certain applications, DNA or RNA are appropriate. For other applications, modifications may be incorporated eg backbone modifications, such as phosphorothioates or methylphosphonates, can be used to increase in vivo half-life, alter RNA affinity, increase nuclease resistance etc. [eg. see Agrawal & Iyer (1995) Curr Opin Biotechnol 6:12-19; Agrawal (1996) TIBTECH 14:376-387]; analogues such as peptide nucleic acids may also be used [eg. see Corey (1997) TIBTECH 15:224-229; Buchardt et al. (1993) TIBTECH 11:384-386].
  • Alternatively, the polymerase chain reaction (PCR) is another well-known means for detecting small amounts of target nucleic acid. The assay is described in Mullis et al. [Meth. Enzymol. (1987) 155:335-350] & U.S. Pat. Nos. 4,683,195 & 4,683,202. Two “primer” nucleotides hybridize with the target nucleic acids and are used to prime the reaction. The primers can comprise sequence that does not hybridize to the sequence of the amplification target (or its complement) to aid with duplex stability or, for example, to incorporate a convenient restriction site. Typically, such sequence will flank the desired streptococcus sequence.
  • A thermostable polymerase creates copies of target nucleic acids from the primers using the original target nucleic acids as a template. After a threshold amount of target nucleic acids are generated by the polymerase, they can be detected by more traditional methods, such as Southern blots. When using the Southern blot method, the labelled probe will hybridize to the streptococcus sequence (or its complement).
  • Also, mRNA or cDNA can be detected by traditional blotting techniques described in Sambrook et al [supra]. mRNA, or cDNA generated from mRNA using a polymerase enzyme, can be purified and separated using gel electrophoresis. The nucleic acids on the gel are then blotted onto a solid support, such as nitrocellulose. The solid support is exposed to a labelled probe and then washed to remove any unhybridized probe. Next, the duplexes containing the labeled probe are detected. Typically, the probe is labelled with a radioactive moiety.
  • EXAMPLES
  • The following examples describe nucleic acid sequences which have been identified in Streptococcus, along with their inferred translation products. The examples are generally in the following format:
      • a nucleotide sequence which has been identified in Streptococcus
      • the inferred translation product of this sequence
      • a computer analysis (e.g. PSORT output) of the translation product, indicating antigenicity
  • Most examples describe nucleotide sequences from S.agalactiae. The specific strain which was sequenced was from serotype V, and is a clinical strain isolated in Italy which expresses the R antigen (ISS/Rome/Italy collection, strain.2603 V/R). For several of these examples, the corresponding sequences from S.pyogenes are also given. Where GBS and GAS show homology in this way, there is conservation between species which suggests an essential function and also gives good cross-species reactivity.
  • In contrast, several examples describe nucleotide sequences from GAS for which no homolog in GBS has been identified. This lack of homology gives molecules which are useful for distinguishing GAS from GBS and for making GAS-specific products. The same is true for GBS sequences which lack GAS homologs e.g these are useful for making GBS-specific products.
  • The examples typically include details of homology to sequences in the public databases. Proteins that are similar in sequence are generally similar in both structure and function, and the homology often indicates a common evolutionary origin. Comparison with sequences of proteins of known function is widely used as a guide for the assignment of putative protein function to a new sequence and has proved particularly useful in whole-genome analyses.
  • Various tests can be used to assess the in vivo immunogenicity of the proteins identified in the examples. For example, the proteins can be expressed recombinantly and used to screen patient sera by immunoblot. A positive reaction between the protein and patient serum indicates that the patient has previously mounted an immune response to the protein in question i.e. the protein is an immunogen. This method can also be used to identify immunodominant proteins. The mouse model used in the examples can also be used.
  • The recombinant protein can also be conveniently used to prepare antibodies e.g. in a mouse. These can be used for direct confirmation that a protein is located on the cell-surface. Labelled antibody (e.g. fluorescent labelling for FACS) can be incubated with intact bacteria and the presence of label on the bacterial surface confirms the location of the protein.
  • For many GBS proteins, the following data are given:
      • SDS-PAGE analysis of total recombinant E.coli cell extracts for GBS protein expression
      • SDS-PAGE analysis after the protein purification
      • Western-blot analysis of GBS total cell extract using antisera raised against recombinant proteins
      • FACS and ELISA analysis against GBS using antisera raise against recombinant proteins
      • Results of the in vivo passive protection assay
  • Details of experimental techniques used are presented below:
  • Sequence Analysis
  • Open reading frames (ORFs) within nucleotide sequences were predicted using the GLIMMER program [Salzberg et al. (1998) Nucleic Acids Res 26:544-8]. Where necessary, start codons were modified and corrected manually on the basis of the presence of ribosome-binding sites and promoter regions on the upstream DNA sequence.
  • ORFs were then screened against the non-redundant protein databases using the programs BLASTp [Altschul et al. (1990) J. Mol. Biol. 215:403-410] and PRAZE, a modification of the Smith-Waterman algorithm [Smith & Waterman (1981) J Mol Biol 147:195-7; see Fleischmann et al (1995) Science 269:496-512].
  • Leader peptides within the ORFs were located using three different approaches: (i) PSORT [Nakai (1991) Bull. Inst. Chem. Res., Kyoto Univ. 69:269-291; Horton & Nakai (1996) Intellig. Syst. Mol. Biol. 4:109-115; Horton & Nakai (1997) Intellig. Syst. Mol. Biol. 5:147-152]; (ii) SignalP [Nielsen & Krogh (1998) in Proceedings of the Sixth International Conference on Intelligent Systems for Molecular Biology (ISMB 6), AAAI Press, Menlo Park, Calif., pp. 122-130; Nielsen et al. (1999) Protein Engineering 12:3-9; Nielsen et al. (1997). Int. J. Neural Sys. 8:581-599]; and (iii) visual inspection of the ORF sequences. Where a signal sequences is given a “possible site” value, the value represents the C-terminus residue of the signal peptide e.g. a “possible site” of 26 means that the signal sequence consists of amino acids 1-26.
  • Lipoprotein-specific signal peptides were located using three different approaches: (i) PSORT [see above]; (ii) the “prokaryotic membrane lipoprotein lipid attachment site” PROSITE motif [Hofmann et al. (1999) Nucleic Acids Res. 27:215-219; Bucher & Bairoch (1994) in Proceedings 2nd International Conference on Intelligent Systems for Molecular Biology (ISMB-94), AAAI Press, pages 53-61]; and (iii) the FINDPATTERNS program available in the GCG Wisconsin Package, using the pattern (M, L, V)x{9, 35}LxxCx.
  • Transmembrane domains were located using two approaches: (i) PSORT [see above]; (ii) TopPred [von Heijne (1992) J. Mol. Biol. 225:487-494].
  • LPXTG motifs, characteristic of cell-wall attached proteins in Gram-positive bacteria [Fischetti et al. (1990) Mol Microbiol 4:1603-5] were located with FINDPATTERNS using the pattern (L, I, V, M, Y, F)Px(T, A, S, G) (G, N, S, T, A, L).
  • RGD motifs, characteristic of cell-adhesion molecules [D'Souza et al. (1991) Trends Biochem Sci 16:246-50] were located using FINDPATTERNS.
  • Enzymes belonging to the glycolytic pathway were also selected as antigens, because these have been found experimentally expressed on the surface of Streptococci [e.g. Pancholi & Fischetti (1992) J Exp Med 176:415-26; Pancholi & Fischetti (1998) J Biol Chem 273:14503-15].
  • Cloning, Expression and Purification of Proteins
  • GBS genes were cloned to facilitate expression in E.coli as two different types of fusion proteins:
      • a) proteins having a hexa-histidine tag at the amino-terminus (His-gbs)
      • b) proteins having a GST fusion partner at the amino-terninus (Gst-gbs)
  • Cloning was performed using the Gateway™ technology (Life Technologies), which is based on the site-specific recombination reactions that mediate integration and excision of phage lambda into and from the E.coli genome. A single cloning experiment included the following steps:
      • 1—Amplification of GBS chromosomal DNA to obtain a PCR product coding for a single ORF flanked by attB recombination sites.
      • 2—Insertion of the PCR product into a pDONR vector (containing attP sites) through a BP reaction (attB×attP sites). This reaction gives a so called ‘pEntry’ vector, which now contains attL sites flanking the insert.
      • 3—Insertion of the GBS gene into E.coli expression vectors (pDestination vectors, containing attR sites) through a LR reaction between pEntry and pDestination plasmids (attL×attR sites).
  • A) Chromosomal DNA Preparation
  • For chromosomal DNA preparation, GBS strain 2603 V/R (Istituto Superiore Sanità, Rome) was grown to exponential phase in 2 litres TH Broth (Difco) at 37° C., harvested by centrifugation, and dissolved in 40 ml TES (50 mM Tris pH 8, 5 mM EDTA pH 8, 20% sucrose). After addition of 2.5 ml lysozyme solution (25 mg/ml in TES) and 0.5 ml mutanolysin (Sigma M-9901, 25000U/ml in H2O), the suspension was incubated at 37° C. for 1 hour. 1 ml RNase (20 mg/ml) and 0.1 ml proteinase K (20 mg/ml) were added and incubation was continued for 30 min. at 37° C.
  • Cell lysis was obtained by adding 5 ml sarkosyl solution (10% N-laurylsarcosine in 250 mM EDTA pH 8.0), and incubating 1 hour at 37° C. with frequent inversion. After sequential extraction with phenol, phenol-chloroform and chloroform, DNA was precipitated with 0.3M sodium acetate pH 5.2 and 2 volumes of absolute ethanol. The DNA pellet was rinsed with 70% ethanol and dissolved in TE buffer (10 mM Tris-HCl, 1 mM EDTA, pH 8). DNA concentration was evaluated by OD260.
  • B) Oligonucleotide Design
  • Synthetic oligonucleotide primers were designed on the basis of the coding sequence of each ORF. The aim was to express the protein's extracellular region. Accordingly, predicted signal peptides were omitted (by deducing the 5′ end amplification primer sequence immediately downstream from the predicted leader sequence) and C-terminal cell-wall anchoring regions were removed (e.g. LPXTG motifs and downstream amino acids). Where additional nucleotides have been deleted, this is indicated by the suffix ‘d’ (e.g. ‘GBS352d’). Conversely, a suffix ‘L’ refers to expression without these deletions. Deletions of C- or N-terminal residues were also sometimes made, as indicated by a ‘C’ or ‘N’ suffix.
  • The amino acid sequences of the expressed GBS proteins (including ‘d’ and ‘L’ forms etc.) are definitively defined by the sequences of the oligonucleotide primers.
  • 5′ tails of forward primers and 3′ tails of reverse primers included attB1 and attB2 sites respectively:
  • Forward primers: 5′-GGGGACAAGTTTGTACAAAAAAGCAGGCTCT-ORF in frame-3′ (nucleotides 1-31 of SEQ ID NO: 11027; the TCT sequence preceding the ORF was omitted when the ORF's first coding triplet began with T).
  • Reverse primers: 5′-GGGGACCACTTTGTACAAGAAAGCTGGGTT-ORF reverse complement-3′ (nucleotides 1-30 of SEQ ID NO: 11552).
  • The primers for GAS16 are thus:
    Fwd:
    GGGGACAAGTTTGTACAAAAAAGCAGGCXXXXX (SEQ ID NO:_)
    Rev:
    GGGGACCACTTTGTACAAGAAAGCTGGGTTXXX (SEQ ID NO:_)
  • The number of nucleotides which hybridized to the sequence to be amplified depended on the melting temperature of the primers, which was determined as described by Breslauer et al. [PNAS USA (1986) 83:3746-50]. The average melting temperature of the selected oligos was 50-55° C. for the hybridizing region and 80-85° C. for the whole oligos.
  • C) Amplification
  • The standard PCR protocol was as follows: 50 ng genomic DNA were used as template in the presence of 0.5 μM each primer, 200 μM each dNTP, 1.5 mM MgCl2, 1× buffer minus Mg++ (Gibco-BRL) and 2 units of Taq DNA polymerase (Platinum Taq, Gibco-BRL) in a final volume of 100 μl. Each sample underwent a double-step of amplification: 5 cycles performed using as the hybridizing temperature 50° C., followed by 25 cycles at 68° C.
  • The standard cycles were as follows:
      • Denaturation: 94° C., 2 min
      • 5 cycles: Denaturation: 94° C., 30 seconds
      • Hybridization: 50° C., 50 seconds
      • Elongation: 72° C., 1 min. or 2 min. and 40 sec.
      • 25 cycles: Denaturation: 94° C., 30 seconds
      • Hybridization: 68° C., 50 seconds
      • Elongation: 72° C., 1 min. or 2 min. and 40 sec.
  • Elongation time was 1 minute for ORFs shorter than 2000bp and 2:40 minutes for ORFs longer than 2000bp. Amplifications were performed using a Gene Amp PCR system 9600 (Perkin Elmer).
  • To check amplification results, 2 μl of each PCR product were loaded onto 1-1.5 agarose gel and the size of amplified fragments was compared with DNA molecular weight standards (DNA marker IX Roche, 1 kb DNA ladder Biolabs).
  • Single band PCR products were purified by PEG precipitation: 300 μl of TE buffer and 200 μl of 30% PEG 8000/30 mM MgCl2 were added to 100 μl PCR reaction. After vortexing, the DNA was centrifuged for 20 min at 10000 g, washed with 1 vol. 70% ethanol and the pellet dissolved in 30 μl TE. PCR products smaller than 350 bp were purified using a PCR purification Kit (Qiagen) and eluted with 30 μl of the provided elution buffer.
  • In order to evaluate the yield, 2μl of the purified DNA were subjected to agarose gel electrophoresis and compared to titrated molecular weight standards.
  • D) Cloning of PCR Products into Expression Vectors
  • Cloning was performed following the GATEWAY™ technology's “one-tube protocol”, which consists of a two step reaction (BP and LR) for direct insertion of PCR products into expression vectors.
  • BP reaction (attB×attP sites): The reaction allowed insertion of the PCR product into a pDONR vector. The pDONR™ 201 vector we used contains the killer toxin gene ccdB between attP1 and attP2 sites to minimize background colonies lacking the PCR insert, and a selectable marker gene for kanamycin resistance. The reaction resulted in a so called pEntry vector, in which the GBS gene was located between attL1 and attL2 sites.
  • 60 fmol of PCR product and 100 ng of pDONR™ 201 vector were incubated with 2.5 μl of BP CLONASE™ in a final volume of 12.5 μl for 4 hours at 25° C.
  • LR reaction (attL×attR sites): The reaction allowed the insertion of the GBS gene, now present in the pEntry vector, into E.coli expression vectors (pDestination vectors, containing attR sites). Two pDestination vectors were used (pDEST15 for N- terminal GST fusions—FIG. 86; and pDEST17-1 for N-terminal His-tagged fusions—FIG. 87). Both allow transcription of the ORF fusion coding mRNA under T7 RNA polymerase promoter [Studier et al (1990) Meth. Enzymol 185: 60ff].
  • To 5 μl of BP reaction were added 0.25 μl of 0.75 M NaCl, 100 ng of destination vector and 1.5 μl of LR CLONASE™. The reaction was incubated at 25° C. for 2 hours and stopped with 1 μl of 1 mg/ml proteinase K solution at 37° C. for 15 min.
  • 1 μl of the completed reaction was used to transform 50 μl electrocompetent BL21-SI™ cells (0.1 cm, 200 ohms, 25 μF). BL21-SI cells contain an integrated T7 RNA polymerase gene under the control of the salt-inducible prU promoter [Gowrishankar (1985) J. Bacteriol. 164:434ff]. After electroporation cells were diluted in 1 ml SOC medium (20 g/l bacto-tryptone, 5 g/l yeast extract, 0.58 g/l NaCl, 0.186 g/l KCl, 20 mM glucose, 10 mM MgCl2) and incubated at 37° C. for 1 hour. 200 μl cells were plated onto LBON plates (Luria Broth medium without NaCl) containing 100 μg/ml ampicillin. Plates were then incubated for 16 hours at 37° C.
  • Entry clones: In order to allow the future preparation of Gateway compatible pEntry plasmids containing genes which might turn out of interest after immunological assays, 2.5 μl of BP reaction were incubated for 15 min in the presence of 3 μl 0.15 mg/ml proteinase K solution and then kept at −20° C. The reaction was in this way available to transform E.coli competent cells so as to produce Entry clones for future introduction of the genes in other Destination vectors.
  • E) Protein Expression
  • Single colonies derived from the transformation of LR reactions were inoculated as small-scale cultures in 3 ml LBON 100 μg/ml ampicillin for overnight growth at 25° C. 50-200 μl of the culture was inoculated in 3 ml LBON/Amp to an initial OD600 of 0.1. The cultures were grown at 37° C. until OD600 0.4-0.6 and recombinant protein expression was induced by adding NaCl to a final concentration of 0.3 M. After 2 hour incubation the final OD was checked and the cultures were cooled on ice. 0.5 OD600 of cells were harvested by centrifugation. The cell pellet was suspended in 50 μl of protein Loading Sample Buffer (50 mM TRIS-HCI pH 6.8, 0.5% w/v SDS, 2.5% v/v glycerin, 0.05% w/v Bromophenol Blue, 100 mM DTT) and incubated at 100 ° C. for 5 min. 10 μl of sample was analyzed by SDS-PAGE and Coomassie Blue staining to verify the presence of induced protein band.
  • F) Purification of the Recombinant Proteins
  • Single colonies were inoculated in 25 ml LBON 100 μg/ml ampicillin and grown at 25° C. overnight. The overnight culture was inoculated in 500 ml LBON/amp and grown under shaking at 25 ° C. until OD600 values of 0.4-0.6. Protein expression was then induced by adding NaCl to a final concentration of 0.3 M. After 3 hours incubation at 25 ° C the final OD600 was checked and the cultures were cooled on ice. After centrifugation at 6000 rpm (JA10 rotor, Beckman) for 20 min., the cell pellet was processed for purification or frozen at −20 ° C.
  • Proteins were purified in 1 of 3 ways depending on the fusion partner and the protein's solubility:
  • Purification of Soluble His-tagged Proteins from E. coli
      • 1. Transfer pellets from −20° C. to ice bath and reconstitute each pellet with 10 ml B-PER™ solution (Bacterial-Protein Extraction Reagent, Pierce cat. 78266), 10 μl of a 100 mM MgCl2 solution, 50 μl of DNAse I (Sigma D-4263, 100 Kunits in PBS) and 100 μl of 100 mg/ml lysozyme in PBS (Sigma L-7651, final concentration 1 mg/ml).
      • 2. Transfer resuspended pellets in 50 ml centrifuge tubes and leave at room temperature for 30-40 minutes, vortexing 3-4 times.
      • 3. Centrifuge 15-20 minutes at about 30-40000×g.
      • 4. Prepare Poly-Prep (Bio-Rad) columns containing 1 ml of Fast Flow Ni-activated Chelating Sepharose (Pharmacia). Equilibrate with 50 mM phosphate buffer, 300 mM NaCl, pH 8.0.
      • 5. Store the pellet at −20° C., and load the supernatant on to the columns.
      • 6. Discard the flow through.
      • 7. Wash with 10 ml 20 mM imidazole buffer, 50 mM phosphate, 300 mM NaCl, pH 8.0.
      • 8. Elute the proteins bound to the columns with 4.5 ml (1.5 ml+1.5 ml+1.5 ml) 250 mM imidazole buffer, 50 mM phosphate, 300 mM NaCl, pH 8.0 and collect three fractions of ˜1.5 ml each. Add to each tube 15 μl DTT 200 mM (fmal concentration 2 mM).
      • 9. Measure the protein concentration of the collected fractions with the Bradford method and analyse the proteins by SDS-PAGE.
      • 10. Store the collected fractions at +4° C. while waiting for the results of the SDS-PAGE analysis.
      • 11. For immunisation prepare 4-5 aliquots of 20-100 μg each in 0.5 ml in 40% glycerol. The dilution buffer is the above elution buffer, plus 2 mM DTT. Store the aliquots at −20° C. until immunisation.
  • Purification of His-tagged Proteins from Inclusion Bodies
      • 1. Bacteria are collected from 500 ml cultures by centrifugation. If required store bacterial pellets at −20° C. Transfer the pellets from −20° C. to room temperature and reconstitute each pellet with 10 ml B-PERT™ solution, 10 μl of a 100 mM MgCl2 solution (final 1 mM), 50 μl of DNAse I equivalent to 100 Kunits units in PBS and 100 μl of a 100 mg/ml lysozyme (Sigma L-7651) solution in PBS (equivalent to 10 mg, final concentration 1 mg/ml).
      • 2. Transfer the resuspended pellets in 50 ml centrifuge tubes and let at room temperature for 30-40 minutes, vortexing 3-4 times.
      • 3. Centrifuge 15 minutes at 30-4000×g and collect the pellets.
      • 4. Dissolve the pellets with 50 mM TRIS-HCl, 1 mM TCEP {Tris(2-carboxyethyl)-phosphine hydrochloride, Pierce} , 6M guanidine hydrochloride, pH 8.5. Stir for ˜10 min. with a magnetic bar.
      • 5. Centrifuge as described above, and collect the supernatant.
      • 6. Prepare Poly-Prep (Bio-Rad) columns containing 1 ml of Fast Flow Ni-activated Chelating Sepharose (Pharmacia). Wash the columns twice with 5 ml of H2O and equilibrate with 50 mM TRIS-HCl, 1 mM TCEP, 6M guanidine hydrochloride, pH 8.5.
      • 7. Load the supernatants from step 5 onto the columns, and wash with 5 ml of 50 mM TRIS-HCl buffer, 1 mM TCEP, 6M urea, pH 8.5
      • 8. Wash the columns with 10 ml of 20 mM imidazole, 50 mM TRIS-HCl , 6M urea, 1 mM TCEP, pH 8.5. Collect and set aside the first 5 ml for possible further controls.
      • 9. Elute proteins bound to columns with 4.5 ml buffer containing 250 mM imidazole, 50 mM TRIS-HCl, 6M urea, 1 mM TCEP, pH 8.5. Add the elution buffer in three 1.5 ml aliquots, and collect the corresponding three fractions. Add to each fraction 15 μl DTT (final concentration 2 mM).
      • 10. Measure eluted protein concentration with Bradford method and analyse proteins by SDS-PAGE.
      • 11. Dialyse overnight the selected fraction against 50 mM Na phosphate buffer, pH 8.8, containing 10% glycerol, 0.5 M arginine, 5 mM reduced glutathione, 0.5 mM oxidized glutathione, 2 M urea.
      • 12. Dialyse against 50 mM Na phosphate buffer, pH 8.8, containing 10% glycerol, 0.5 M arginine, 5 mM reduced glutathione, 0.5 mM oxidized glutathione.
      • 13. Clarify the dialysed protein preparation by centrifugation and discard the non-soluble material and measure the protein concentration with the Bradford method.
      • 14. For each protein destined to the immunization prepare 4-5 aliquot of 20-100 μg each in 0.5 ml after having adjusted the glycerol content up to 40%. Store the prepared aliquots at −20° C. until immunization.
  • Purification of GST-fusion Proteins from E.coli
      • 1. Bacteria are collected from 500 ml cultures by centrifugation. If required store bacterial pellets at −20° C. Transfer the pellets from −20° C. to room temperature and reconstitute each pellet with 10 ml B-PER™ solution, 10 μl of a 100 mM MgCl2 solution (final 1 mM), 50 μl of DNAse I equivalent to 100 Kunits units in PBS and 100 μl of a 100 mg/ml lysozyme (Sigma L-7651) solution in PBS (equivalent to 10 mg, final concentration 1 mg/ml).
      • 2. Transfer the resuspended pellets in 50 ml centrifuge tubes and let at room temperature for 30-40 minutes, vortexing 3-4 times.
      • 3. Centrifuge 15-20 minutes at about 30-40000×g.
      • 4. Discard centrifigation pellets and load supernatants onto the chromatography columns, as follows.
      • 5. Prepare Poly-Prep (Bio-Rad) columns containing 0.5 ml of Glutathione-Sepharose 4B resin. Wash the columns twice with 1 ml of H2O and equilibrate with 10 ml PBS, pH7.4.
      • 6. Load supernatants on to the columns and discard the flow through.
      • 7. Wash the columns with 10 ml PBS, pH 7.4.
      • 8. Elute proteins bound to columns with 4.5 ml of 50 mM TRIS buffer, 10 mM reduced glutathione, pH 8.0, adding 1.5 ml+1.5 ml+1.5 ml and collecting the respective 3 fractions of ˜1.5 ml each.
      • 9. Measure protein concentration of the fractions with the Bradford method and analyse the proteins by SDS-PAGE.
      • 10. Store the collected fractions at +4° C. while waiting for the results of the SDS-PAGE analysis.
      • 11. For each protein destined for immunisation prepare 4-5 aliquots of 20-100 μg each in 0.5 ml of 40% glycerol. The dilution buffer is 50 mM TRIS-HCl, 2 mM DTT, pH 8.0. Store the aliquots at −20° C. until immunisation.
  • Immunisations with GBS Proteins
  • The purified proteins were used to immunise groups of four CD-1 mice intraperitoneally. 20 μg of each purified protein was injected in Freund's adjuvant at days 1, 21 & 35. Immune responses were monitored by using samples taken on day 0 & 49. Sera were analysed as pools of sera from each group of mice.
  • FACScan Bacteria Binding Assay Procedure.
  • GBS serotype V 2603 V/R strain was plated on TSA blood agar plates and incubated overnight at 37° C. Bacterial colonies were collected from the plates using a sterile dracon swab and inoculated into 100 ml Todd Hewitt Broth. Bacterial growth was monitored every 30 minutes by following OD600. Bacteria were grown until OD600=0.7-0.8. The culture was centrifuged for 20 minutes at 5000 rpm. The supernatant was discarded and bacteria were washed once with PBS, resuspended in 1/2 culture volume of PBS containing 0.05% paraformaldehyde, and incubated for 1 hour at 37° C. and then overnight at 4° C.
  • 50 μl bacterial cells (OD600 0.1) were washed once with PBS and resuspended in 20 μl blocking serum (Newborn Calf Serum, Sigma) and incubated for 20 minutes at room temperature. The cells were then incubated with 100 μl diluted sera (1:200) in dilution buffer (20% Newborn Calf Serum 0.1% BSA in PBS) for 1 hour at 4° C. Cells were centrifuged at 5000 rpm, the supernatant aspirated and cells washed by adding 200 μl washing buffer (0.1% BSA in PBS). 50 μl R-Phicoerytrin conjugated F(ab)2 goat anti-mouse, diluted 1:100 in dilution buffer, was added to each sample and incubated for 1 hour at 4° C. Cells were spun down by centrifugation at 5000 rpm and washed by adding 200 μl of washing buffer. The supernatant was aspirated and cells resuspended in 200 μl PBS. Samples were transferred to FACScan tubes and read. The condition for FACScan setting were: FL2 on; FSC-H threshold:54; FSC PMT Voltage: E 02; SSC PMT: 516; Amp. Gains 2.63; FL-2 PMT: 728. Compensation values: 0.
  • Samples were considered as positive if they had a Δ mean values >50 channel values.
  • Whole Extracts Preparation
  • GBS serotype III COHI strain and serotype V 2603 V/R strain cells were grown overnight in Todd Hewitt Broth. 1 ml of the culture was inoculated into 100 ml Todd Hewitt Broth. Bacterial growth was monitored every 30 minutes by following OD600. The bacteria were grown until the OD reached 0.7-0.8. The culture was centrifuged for 20 minutes at 5000 rpm. The supernatant was discarded and bacteria were washed once with PBS, resuspended in 2 ml 50 mM Tris-HCl, pH 6.8 adding 400 units of Mutanolysin (Sigma-Aldrich) and incubated 3 hrs at 37° C. After 3 cycles of freeze/thaw, cellular debris were removed by centrifugation at 14000 g for 15 minutes and the protein concentration of the supernatant was measured by the Bio-Rad Protein assay, using BSA as a standard.
  • Western Blotting
  • Purified proteins (50 ng) and total cell extracts (25 μg) derived from GBS serotype III COH1 strain and serotype V 2603 V/R strain were loaded on 12% or 15% SDS-PAGE and transferred to a nitrocellulose membrane. The transfer was performed for 1 hours at 100 V at 4° C., in transferring buffer (25 mM Tris base, 192 mM glycine, 20% methanol). The membrane was saturated by overnight incubation at 4° C. in saturation buffer (5 % skimmed milk, 0.1% Tween 20 in PBS). The membrane was incubated for 1 hour at room temperature with 1:1000 mouse sera diluted in saturation buffer. The membrane was washed twice with washing buffer (3 % skimmed milk, 0.1% Tween 20 in PBS) and incubated for 1 hour with a 1:5000 dilution of horseradish peroxidase labelled anti-mouse Ig (Bio-Rad). The membrane was washed twice with 0.1% Tween 20 in PBS and developed with the Opti-4CN Substrate Kit (Bio-Rad). The reaction was stopped by adding water.
  • Unless otherwise indicated, lanes 1, 2 and 3 of blots in the drawings are: (1) the purified protein; (2) GBS-III extracts; and (3) GBS-V extracts. Molecular weight markers are also shown.
  • In vivo Passive Protection Assay in Neonatal Sepsis Mouse Model.
  • The immune sera collected from the CD1 immunized mice were tested in a mouse neonatal sepsis model to verify their protective efficacy in mice challenged with GBS serotype III. Newborn Balb/C littermates were randomly divided in two groups within 24 hrs from birth and injected subcutaneously with 25μl of diluted sera (1:15) from immunized CD1 adult mice. One group received preimmune sera, the other received immune sera. Four hours later all pups were challenged with a 75% lethal dose of the GBS serotype III COH1 strain. The challenge dose obtained diluting a mid log phase culture was administered subcutaneously in 25 μl of saline. The number of pups surviving GBS infection was assessed every 12 hours for 4 days.
  • Identification of GAS16
  • Example 1
  • A DNA sequence (GASx127) was identified in S.pyogenes <SEQ ID 7275>which encodes the amino acid sequence <SEQ ID 7276>. Analysis of this protein sequence reveals the following:
    Possible site: 17
    >>> Seems to have a cleavable N-term signal seq.
       INTEGRAL Likelihood = −3.93
    Transmembrane 312-328 (311-337)
    ----- Final Results -----
    bacterial membrane --- Certainty = 0.2572
    (Affirmative) < succ>
    bacterial outside --- Certainty = 0.0000
    (Not Clear) < succ>
    bacterial cytoplasm --- Certainty = 0.0000
    (Not Clear) < succ>

    No corresponding DNA sequence was identified in S.agalactiae.
  • The protein has homology with the following sequences in the GENPEPT database:
    >GP:AAC97152 GB:U49397 unknown [Streptococcus pyogenes]
    Identities = 125/355 (35%), Positives = 191/355 (53%),
    Gaps = 26/355 (7%)
    Query: 1 MKLRHLLLTGAALTSFA-----ATTVHGET--VVNGAKLTVTKNL-DLVNSNALIPNTDF 52
    MK   LLL  A L +       +  +  ET  V++G+ L V K      + N L+P  D+
    Sbjct: 1 MKKNKLLLATAILATALGMASMSQNIKAETAGVIDGSTLVVKKTFPSYTDDNVLMPKADY 60
    Query: 53 TFKIEPDTTVN---EDGNKFK-GVALNTPMTK-VTYTNSDKGGSNTKTAEFDFSEVTFEK 107
    +FK+E D       +DG   K GV      TK + Y+NSDK  +  K+  F+F+ V F
    Sbjct: 61 SFKVEADDNAKGKTKDGLDIKPGVIDGLENTKTIRYSNSDKITAKEKSVNFEFANVKFPG 120
    Query: 108 PGVYYYKVTEEKIDKVPGVSYDTTSYTVQVHVLWNEEQQKPVATYIVGYKEGS--KVPIQ 165
     GVY Y V E   +K  G++YD+  +TV V+V+ N+E       YIV  + G   K P+
    Sbjct: 121 VGVYRYTVAEVNGNKA-GITYDSQQWTVDVYVV-NKEGGGFEVKYIVSTEVGQSEKKPVL 178
    Query: 166 FKNSLDSTTLTVKKKVSGTGGDRSKDFNFGLTLKANQYYKASEKVMIEKTTKGGQAPVQT 225
    FKNS D+T+L ++K+V+G  G+  + F+F L L  N+ +   EK  +    +GG+
    Sbjct: 179 FKNSFDTTSLKIEKQVTGNTGEHQRLFSFTLLLTPNECF---EKGQVVNILQGGETK--- 232
    Query: 226 EASIDQLYHFTLKDGESIKVTNLPVGVDYVVTEDDYKSEKYTTNVEVSPQDGAVKNIAGN 285
    +  I + Y FTLKD  S+ ++ LPVG++Y +TE+D   + Y T+  +   + +     G
    Sbjct: 233 KVVIGEEYSFTLKDKGSVTLSQLPVGIEYKLTEEDVTKDGYKTSATLKDGEQSSTYELGK 292
    Query: 286 STEQETSTDKDMTITFTNKKDFEVPTGVAMTVAPYIALGIVAVGGALYFVKKKNA 340
      + + S D+   I  TNK+D +VPTGV  T+AP+  L IVA+GG +Y  K+K A
    Sbjct: 293 DHKTDKSADE---IVVTNKRDTQVPTGVVGTLAPFAVLSIVAIGGVIYITKRKKA 344

    Based on this analysis, it was predicted that this GAS-specific protein and its epitopes, could be useful antigens for vaccines or diagnostics.

Claims (23)

1. A protein comprising the amino acid sequence SEQ ID NO:7276.
2. A protein having 50% or greater sequence identity to the protein of claim 1.
3. A protein comprising a fragment of 7 or more consecutive amino acids from the amino acid sequence SEQ ID NO:7276.
4. An antibody which binds to a protein selected from the group consisting of:
(a) a protein comprising the amino acid sequence SEQ ID NO:7276;
(b) a protein having 50% or greater sequence identity to (a); and
(c) a protein comprising a fragment of 7 or more consecutive amino acids from the amino acid sequence SEQ ID NO:7276.
5. The antibody of claim 4 which is a monoclonal antibody, a chimeric antibody, a humanized antibody, or a fully human antibody.
6. A nucleic acid molecule which encodes a protein selected from the group consisting of:
(a) a protein comprising the amino acid sequence SEQ ID NO:7276;
(b) a protein having 50% or greater sequence identity to (a); and
(c) a protein comprising a fragment of 7 or more consecutive amino acids from the amino acid sequence SEQ ID NO:7276, or the complement thereof.
7. The nucleic acid molecule of claim 6 comprising the nucleotide sequence SEQ ID NO:7275.
8. A nucleic acid molecule comprising a fragment of 10 or more consecutive nucleotides from the nucleotide sequence SEQ ID NO:7275 or the complement thereof.
9. A nucleic acid molecule comprising a nucleotide sequence having 50% or greater sequence identity to the nucleic acid sequence SEQ ID NO:7275 or the complement thereof.
10. A nucleic acid molecule which can hybridize under stringent conditions to a nucleic acid molecule encoding a protein selected from the group consisting of:
(a) a protein comprising the amino acid sequence SEQ ID NO:7276;
(b) a protein having 50% or greater sequence identity to (a); and
(c) a protein comprising a fragment of 7 or more consecutive amino acids from the amino acid sequence SEQ ID NO:7276, or the complement thereof.
11. A composition comprising an active agent selected from the group consisting of:
(a) a protein comprising the amino acid sequence SEQ ID NO:7276;
(b) a protein having 50% or greater sequence identity to (a);
(c) a protein comprising a fragment of 7 or more consecutive amino acids from the amino acid sequence SEQ ID NO: 7276;
(d) an antibody which binds to (a), (b), or (c);
(e) a nucleic acid molecule which encodes (a), (b), or (c) or the complement thereof;
(f) a nucleic acid molecule comprising a fragment of 10 or more consecutive nucleotides from the nucleotide sequence SEQ ID NO:7275 or the complement thereof;
(g) a nucleic acid molecule comprising a nucleotide sequence having 50% or greater sequence identity to (e) or (f); and
(h) a nucleic acid molecule which can hybridize to (e), (f), or (g) under high stringency conditions.
12. The composition of claim 11 which is an immunogenic composition, a vaccine composition, or a diagnostic composition.
13. A method of treatment, comprising administering to a patient in need thereof a therapeutically effective amount of the composition of claim 11.
14. A hybrid protein represented by the formula NH2-A-[-X-L-]n-B-COOH, wherein X is the amino acid sequence SEQ ID NO:7276, L is an optional linker amino acid sequence, A is an optional N-terminal amino acid sequence, B is an optional C-terminal amino acid sequence, and n is an integer greater than 1.
15. A kit comprising primers for amplifying a template sequence contained with a Streptococcus nucleic acid sequence, the kit comprising a first primer and a second primer, wherein the first primer is substantially complementary to the template sequence and the second primer is substantially complementary to a complement of the template sequence, wherein the parts of the primers which have substantial complementarity defme the termini of the template sequence to be amplified, wherein the template sequence comprises SEQ ID NO:7275.
16. A kit comprising first and second single-stranded oligonucleotides which allow amplification of a Streptococcus template nucleic acid sequence contained in a single- or double-stranded nucleic acid (or mixture thereof), wherein: (a) the first oligonucleotide comprises a primer sequence which is substantially complementary to said template nucleic acid sequence; (b) the second oligonucleotide comprises a primer sequence which is substantially complementary to the complement of said template nucleic acid sequence; (c) the first oligonucleotide and/or the second oligonucleotide comprise(s) sequence which is not compementary to said template nucleic acid; and (d) said primer sequences define the termini of the template sequence to be amplified, wherein the template sequence comprises SEQ ID NO:7275.
17. The kit of claim 16, wherein the non-complementary sequence(s) of (c) comprise a restriction site and/or a promoter sequence.
18. A computer-readable medium containing one or both of SEQ ID NOS: 7276 and 7275.
19. A process for detecting Streptococcus in a biological sample, comprising the step of contacting under hybridizing conditions a nucleic acid selected from the group consisting of:
(a) a nucleic acid molecule which encodes a protein selected from the group consisting of:
(1) a protein comprising the amino acid sequence SEQ ID NO:7276;
(2) a protein having 50% or greater sequence identity to (1); and
(3) a protein comprising a fragment of 7 or more consecutive amino acids from the amino acid sequence SEQ ID NO:7276, or the complement thereof;
(b) a nucleic acid molecule comprising the nucleotide sequence SEQ ID NO:7275;
(c) a nucleic acid molecule comprising a fragment of 10 or more consecutive nucleotides from the nucleotide sequence SEQ ID NO:7275 or the complement thereof; and
(d) a nucleic acid molecule comprising a nucleotide sequence having 50% or greater sequence identity to the nucleotide sequence SEQ ID NO:7275 or the complement thereof.
20. The process of claim 19, wherein the process involves nucleic acid amplification.
21. A process for determining whether a compound binds to a protein selected from the group consisting of:
(a) a protein comprising the amino acid sequence SEQ ID NO:7276;
(b) a protein having 50% or greater sequence identity to (a); and
(c) a protein comprising a fragment of 7 or more consecutive amino acids from the amino acid sequence SEQ ID NO:7276, comprising contacting a test compound with the protein and determining whether the test compound binds to the protein.
22. A composition comprising:
(a) a protein selected from the group consisting of:
(1) a protein comprising the amino acid sequence SEQ ID NO:7276;
(2) a protein having 50% or greater sequence identity to (1); and
(3) a protein comprising a fragment of 7 or more consecutive amino acids from the amino acid sequence SEQ ID NO:7276; and
(b) one or more of the following antigens:
a protein antigen from Helicobacter pylori;
a protein antigen from N.meningitidis serogroup B;
an outer-membrane vesicle (OMV) preparation from N.meningitidis serogroup B;
a saccharide antigen from N.meningitidis serogroup A, C, W135 and/or Y;
a saccharide antigen from Streptococcus pneumoniae;
an antigen from hepatitis A virus;
an antigen from hepatitis B virus;
an antigen from hepatitis C virus;
an antigen from Bordetella pertussis;
a diphtheria antigen;
a tetanus antigen;
a saccharide antigen from Haemophilus influenzae B.
an antigen from N.gonorrhoeae;
an antigen from Chlamydia pneumoniae;
an antigen from Chlamydia trachomatis;
an antigen from Porphyromonas gingivalis;
polio antigen(s);
rabies antigen(s);
measles, mumps and/or rubella antigens;
influenza antigen(s);
an antigen from Moraxella catarrhalis; and/or
an antigen from Staphylococcus aureus.
23. A composition comprising two or more proteins, wherein each protein is a protein selected from the group consisting of:
(a) a protein comprising the amino acid sequence SEQ ID NO:7276;
(b) a protein having 50% or greater sequence identity to (a); and
(c) a protein comprising a fragment of 7 or more consecutive amino acids from the amino acid sequence SEQ ID NO:7276.
US11/434,137 2000-10-27 2006-05-16 Nucleic acids and proteins from streptococcus groups A & B Abandoned US20060210579A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US11/434,137 US20060210579A1 (en) 2000-10-27 2006-05-16 Nucleic acids and proteins from streptococcus groups A & B

Applications Claiming Priority (9)

Application Number Priority Date Filing Date Title
GB0026333.5 2000-10-27
GB0026333A GB0026333D0 (en) 2000-10-27 2000-10-27 Streptococcus antigens
GB0028727A GB0028727D0 (en) 2000-11-24 2000-11-24 Streptococcus antigens
GB0028727.6 2000-11-24
GB0105640.7 2001-03-07
GB0105640A GB0105640D0 (en) 2001-03-07 2001-03-07 Streptococcus proteins
PCT/GB2001/004789 WO2002034771A2 (en) 2000-10-27 2001-10-29 Nucleic acids and proteins from streptococcus groups a & b
US41518203A 2003-10-14 2003-10-14
US11/434,137 US20060210579A1 (en) 2000-10-27 2006-05-16 Nucleic acids and proteins from streptococcus groups A & B

Related Parent Applications (2)

Application Number Title Priority Date Filing Date
PCT/GB2001/004789 Continuation WO2002034771A2 (en) 2000-10-27 2001-10-29 Nucleic acids and proteins from streptococcus groups a & b
US41518203A Continuation 2000-10-27 2003-10-14

Publications (1)

Publication Number Publication Date
US20060210579A1 true US20060210579A1 (en) 2006-09-21

Family

ID=27255953

Family Applications (10)

Application Number Title Priority Date Filing Date
US10/415,182 Expired - Fee Related US7939087B2 (en) 2000-10-27 2001-10-29 Nucleic acids and proteins from Streptococcus groups A & B
US11/434,127 Expired - Fee Related US7955604B2 (en) 2000-10-27 2006-05-16 Nucleic acids and proteins from streptococcus groups A and B
US11/434,199 Expired - Fee Related US8137673B2 (en) 2000-10-27 2006-05-16 Nucleic acids and proteins from Streptococcus groups A & B
US11/434,137 Abandoned US20060210579A1 (en) 2000-10-27 2006-05-16 Nucleic acids and proteins from streptococcus groups A & B
US11/434,203 Expired - Fee Related US8431139B2 (en) 2000-10-27 2006-05-16 Nucleic acids and proteins from Streptococcus groups A and B
US11/434,184 Expired - Fee Related US8025890B2 (en) 2000-10-27 2006-05-16 Nucleic acids and proteins from streptococcus groups A and B
US13/598,657 Abandoned US20130129740A1 (en) 2000-10-27 2012-08-30 Nucleic acids and proteins from streptococcus groups a and b
US14/751,790 Expired - Lifetime US9840538B2 (en) 2000-10-27 2015-06-26 Nucleic acids and proteins from Streptococcus groups A and B
US15/166,010 Expired - Lifetime US9738693B2 (en) 2000-10-27 2016-05-26 Nucleic acids and proteins from streptococcus groups A and B
US15/805,453 Expired - Fee Related US10428121B2 (en) 2000-10-27 2017-11-07 Nucleic acids and proteins from streptococcus groups A and B

Family Applications Before (3)

Application Number Title Priority Date Filing Date
US10/415,182 Expired - Fee Related US7939087B2 (en) 2000-10-27 2001-10-29 Nucleic acids and proteins from Streptococcus groups A & B
US11/434,127 Expired - Fee Related US7955604B2 (en) 2000-10-27 2006-05-16 Nucleic acids and proteins from streptococcus groups A and B
US11/434,199 Expired - Fee Related US8137673B2 (en) 2000-10-27 2006-05-16 Nucleic acids and proteins from Streptococcus groups A & B

Family Applications After (6)

Application Number Title Priority Date Filing Date
US11/434,203 Expired - Fee Related US8431139B2 (en) 2000-10-27 2006-05-16 Nucleic acids and proteins from Streptococcus groups A and B
US11/434,184 Expired - Fee Related US8025890B2 (en) 2000-10-27 2006-05-16 Nucleic acids and proteins from streptococcus groups A and B
US13/598,657 Abandoned US20130129740A1 (en) 2000-10-27 2012-08-30 Nucleic acids and proteins from streptococcus groups a and b
US14/751,790 Expired - Lifetime US9840538B2 (en) 2000-10-27 2015-06-26 Nucleic acids and proteins from Streptococcus groups A and B
US15/166,010 Expired - Lifetime US9738693B2 (en) 2000-10-27 2016-05-26 Nucleic acids and proteins from streptococcus groups A and B
US15/805,453 Expired - Fee Related US10428121B2 (en) 2000-10-27 2017-11-07 Nucleic acids and proteins from streptococcus groups A and B

Country Status (17)

Country Link
US (10) US7939087B2 (en)
EP (10) EP1328543B1 (en)
JP (5) JP4254931B1 (en)
AT (1) ATE439372T1 (en)
AU (2) AU2002214127B2 (en)
CA (2) CA2881568C (en)
CY (1) CY1110698T1 (en)
DE (1) DE60139563D1 (en)
DK (1) DK1328543T3 (en)
ES (1) ES2330083T3 (en)
HK (1) HK1153754A1 (en)
IL (5) IL154853A0 (en)
MX (2) MXPA03003690A (en)
NZ (6) NZ583028A (en)
SG (1) SG165981A1 (en)
WO (1) WO2002034771A2 (en)
ZA (1) ZA200302739B (en)

Cited By (17)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20060210581A1 (en) * 2000-10-27 2006-09-21 Novartis Vaccines And Diagnostics, Inc. Nucleic acids and proteins from streptococcus groups A & B
US20070065464A1 (en) * 2003-07-31 2007-03-22 Chiron Corporation Immunogenic compositions for streptococcus pyogenes
US20080182265A1 (en) * 2007-01-31 2008-07-31 Gc Corporation Method for measuring the number of oral streptococci and a pcr primers-probe set used for the same
US20080220010A1 (en) * 2003-09-15 2008-09-11 Novartis Vaccines And Diagnostics Srl Immunogenic Compositions for Streptococcus Agalactiae
US20090042794A1 (en) * 2001-07-06 2009-02-12 Id Biomedical Corporation Group b streptococcus antigens and corresponding dna fragments
US7491402B2 (en) * 1998-12-24 2009-02-17 Auckland Uniservices Limited Superantigens SMEZ-2, SPE-G, SPE-H and SPE-J and uses thereof
US20090117113A1 (en) * 2004-10-08 2009-05-07 Chiron Corporation Immunogenic And Therapeutic Compositions For Streptococcus Pyogenes
US20090162392A1 (en) * 2007-12-21 2009-06-25 Novartis Ag Mutant forms of streptolysin o
US20100303864A1 (en) * 2002-08-26 2010-12-02 Herve Tettelin Conserved and specific streptococcal genomes
US20110020386A1 (en) * 2009-06-29 2011-01-27 Todd Gierahn Vaccines and compositions against streptococcus pneumoniae
US20110038879A1 (en) * 2006-10-30 2011-02-17 Novartis Ag Immunogenic and therapeutic compositions for streptococcus pyogenes
US7993650B2 (en) 2003-07-04 2011-08-09 Affibody Ab Polypeptides having binding affinity for HER2
US20110206692A1 (en) * 2006-06-09 2011-08-25 Novartis Ag Conformers of bacterial adhesins
US8287885B2 (en) 2007-09-12 2012-10-16 Novartis Ag GAS57 mutant antigens and GAS57 antibodies
US20130136760A1 (en) * 2000-12-21 2013-05-30 Id Biomedical Corporation Of Quebec Streptococcus pyogenes antigens and corresponding dna fragments
US8778358B2 (en) 2004-07-29 2014-07-15 Novartis Vaccines And Diagnostics, Inc. Immunogenic compositions for gram positive bacteria such as Streptococcus agalactiae
US9393294B2 (en) 2011-01-20 2016-07-19 Genocea Biosciences, Inc. Vaccines and compositions against Streptococcus pneumoniae

Families Citing this family (219)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU1463097A (en) 1996-01-04 1997-08-01 Rican Limited Helicobacter pylori bacterioferritin
US7087235B2 (en) * 1997-06-25 2006-08-08 The United States Of America As Represented By The Secretary Of The Army Fusion protein of streptococcal pyrogenic exotoxins
PL201887B1 (en) 1998-12-22 2009-05-29 Microscience Ltd Genes and proteins, and their use
US6890539B2 (en) 1998-12-22 2005-05-10 Microscience, Ltd. Genes and proteins, and their use
CA2397710A1 (en) * 1999-12-23 2001-07-05 Vmax Limited Streptococcus pyogenes virulence genes and proteins and their use
AU2001296864A1 (en) 2000-08-31 2002-03-13 Mayo Foundation For Medical Education And Research Detection of varicella-zoster virus
US7082569B2 (en) 2001-01-17 2006-07-25 Outlooksoft Corporation Systems and methods providing dynamic spreadsheet functionality
ATE465272T1 (en) 2001-01-31 2010-05-15 Mayo Foundation DETECTION OF HERPEX SIMPLEX VIRUS
US7691571B2 (en) 2001-01-31 2010-04-06 Mayo Foundation For Medical Education And Research Detection of bordetella
WO2002066650A2 (en) 2001-02-21 2002-08-29 Shire Biochem Inc. Streptococcus pyogenes polypeptides and corresponding dna fragments
GB0107658D0 (en) 2001-03-27 2001-05-16 Chiron Spa Streptococcus pneumoniae
IL158328A0 (en) 2001-04-13 2004-05-12 Wyeth Corp Surface proteins of streptococcus pyogenes
AU2008207670B2 (en) * 2001-04-13 2011-06-16 Wyeth Surface proteins of streptococcus pyogenes
EP1390505A2 (en) * 2001-05-02 2004-02-25 Shire Biochem Inc. Antigens of group b streptococcus and corresponding dna fragments
GB0115176D0 (en) 2001-06-20 2001-08-15 Chiron Spa Capular polysaccharide solubilisation and combination vaccines
GB0118249D0 (en) 2001-07-26 2001-09-19 Chiron Spa Histidine vaccines
GB0121591D0 (en) 2001-09-06 2001-10-24 Chiron Spa Hybrid and tandem expression of neisserial proteins
EP2335723A1 (en) 2001-12-12 2011-06-22 Novartis Vaccines and Diagnostics S.r.l. Immunisation against chlamydia trachomatis
GB0130228D0 (en) * 2001-12-18 2002-02-06 Hansa Medica Ab Protein
GB0210128D0 (en) * 2002-05-02 2002-06-12 Chiron Spa Nucleic acids and proteins from streptococcus groups A & B
ATE534669T1 (en) * 2002-05-28 2011-12-15 Omrix Biopharmaceuticals Inc METHOD FOR OBTAINING ANTI-IDIOTYPE ANTIBODIES
AU2003246495A1 (en) * 2002-07-15 2004-02-02 Id Biomedical Corporation Polypeptide of streptococcus pyogenes
AU2003250684A1 (en) * 2002-07-31 2004-02-16 Affinium Pharmaceuticals, Inc. Deoxyuridine 5' triphosphate nucleotidohydrolase polypeptides and structures
NZ538075A (en) * 2002-08-12 2006-05-26 Akzo Nobel Nv 22.5 kD Streptococcus uberis protein or immunogenic fragment thereof mixed an additional antigen that is pathogenic to cows in a vaccine to treat bovine mastitis
DE10239629A1 (en) * 2002-08-23 2004-04-08 Idt Impfstoffwerk Dessau-Tornau Gmbh Non-recombinant subunit vaccine against Streptococcus suis infections in pigs
US20040081646A1 (en) * 2002-08-29 2004-04-29 Engler Jeffrey A. Group B Streptococcal phage lysin
GB0220194D0 (en) 2002-08-30 2002-10-09 Chiron Spa Improved vesicles
PT1551357E (en) * 2002-09-13 2014-10-10 Novartis Vaccines & Diagnostic Group b streptococcus vaccine
US7074598B2 (en) 2002-09-25 2006-07-11 Mayo Foundation For Medical Education And Research Detection of vancomycin-resistant enterococcus spp.
US7365176B2 (en) 2002-09-26 2008-04-29 Mayo Foundation For Medical Education And Research Detection of Epstein-Barr virus
WO2004033709A2 (en) * 2002-10-08 2004-04-22 Emory University Methods, probes, and kits for detecting group a streptococcus
EP2314604A3 (en) * 2002-10-15 2011-05-25 Intercell AG Nucleic acids coding for adhesion factors of group B streptococcus, adhesion factors of group B streptococcus and further uses thereof
BR0315767A (en) 2002-11-01 2005-09-06 Glaxosmithkline Biolog Sa Immunogenicity composition, method for making a vaccine, kit, vaccine, container with a water repellent inner surface, and method for preserving a composition comprising ipv and a stabilizing agent
PT2279746E (en) 2002-11-15 2013-12-09 Novartis Vaccines & Diagnostic Surface proteins in neisseria meningitidis
GB0227346D0 (en) 2002-11-22 2002-12-31 Chiron Spa 741
DE10300335B4 (en) * 2003-01-09 2008-06-26 Iep Gmbh oxidoreductase
CN102512670A (en) * 2003-03-04 2012-06-27 英特塞尔股份公司 Streptococcus pyogenes antigens
GB0308198D0 (en) 2003-04-09 2003-05-14 Chiron Srl ADP-ribosylating bacterial toxin
EP2298934A1 (en) 2003-04-15 2011-03-23 Intercell AG S. pneumoniae antigens
CA2522986A1 (en) * 2003-05-07 2004-11-18 Intercell Ag Streptococcus agalactiae antigens i + ii
EP2267006A1 (en) * 2003-05-30 2010-12-29 Intercell AG Enterococcus antigens
ES2596553T3 (en) 2003-06-02 2017-01-10 Glaxosmithkline Biologicals Sa Immunogenic compositions based on microparticles comprising adsorbed toxoid and an antigen containing a polysaccharide
ES2432013T3 (en) * 2003-08-15 2013-11-29 Id Biomedical Corporation Of Quebec Pharmaceutical compositions for use in the treatment of Streptococcus Pyogenes infection
EP1663303B1 (en) * 2003-09-15 2011-05-04 Novartis Vaccines and Diagnostics, Inc. Immunogenic compositions for streptococcus agalactiae
DE602004032550D1 (en) * 2003-09-15 2011-06-16 Novartis Vaccines & Diagnostic IMMUNOGENIC COMPOSITIONS FOR STREPTOCOCCUS AGALACTIAE
US7427475B2 (en) * 2003-11-18 2008-09-23 Mayo Foundation For Medical Education And Research Detection of group B streptococcus
GB0410866D0 (en) 2004-05-14 2004-06-16 Chiron Srl Haemophilius influenzae
CA2571421A1 (en) 2004-06-24 2006-01-05 Nicholas Valiante Compounds for immunopotentiation
EP1768662A2 (en) 2004-06-24 2007-04-04 Novartis Vaccines and Diagnostics, Inc. Small molecule immunopotentiators and assays for their detection
DK1766012T3 (en) * 2004-07-02 2011-09-19 Avi Biopharma Inc Antisense antibacterial method and compound
TWI377564B (en) * 2004-08-17 2012-11-21 Panasonic Corp Information storage medium and multiplexing device
WO2006019106A1 (en) * 2004-08-17 2006-02-23 Matsushita Electric Industrial Co., Ltd. Information recording medium, data sorting device, and data reproducing device
GB0421465D0 (en) * 2004-09-27 2004-10-27 Chiron Srl Group A streptococcus protein
GB0424092D0 (en) 2004-10-29 2004-12-01 Chiron Srl Immunogenic bacterial vesicles with outer membrane proteins
CA2582661C (en) 2004-11-09 2015-08-11 Gen-Probe Incorporated Compositions and methods for detecting group a streptococci
CA2591510A1 (en) * 2004-12-22 2006-06-29 Novartis Vaccines And Diagnostics, Inc. Group b streptococcus
ES2589927T3 (en) 2005-01-21 2016-11-17 Merck Sharp & Dohme Corp. Polypeptides to induce a protective immune response against Staphylococcus aureus
GB0502096D0 (en) 2005-02-01 2005-03-09 Chiron Srl Purification of streptococcal capsular polysaccharide
GB0502095D0 (en) * 2005-02-01 2005-03-09 Chiron Srl Conjugation of streptococcal capsular saccharides
US20060177859A1 (en) 2005-02-07 2006-08-10 Gen-Probe Incorporated Compositions and methods for detecting group B streptococci
EP1858920B1 (en) 2005-02-18 2016-02-03 GlaxoSmithKline Biologicals SA Proteins and nucleic acids from meningitis/sepsis-associated escherichia coli
SG164344A1 (en) 2005-02-18 2010-09-29 Novartis Vaccines & Diagnostics Srl Immunogens from uropathogenic escherichia coli
EP1919934A2 (en) * 2005-05-13 2008-05-14 Novartis Vaccines and Diagnostics, Inc. Serum resistance factors of gram positive bacteria
FR2886312B1 (en) * 2005-05-26 2012-12-14 Abag NEW PROTEINS FOR IN VITRO DIAGNOSIS AND PREVENTION OF STREPTOCOCCUS PYOGENES INFECTIONS
US8431136B2 (en) 2005-06-27 2013-04-30 Glaxosmithkline Biologicals S.A. Immunogenic composition
US8067571B2 (en) 2005-07-13 2011-11-29 Avi Biopharma, Inc. Antibacterial antisense oligonucleotide and method
WO2007016938A2 (en) * 2005-07-27 2007-02-15 Stichting Katholieke Universiteit Methods for diagnosing colon cancer and streptococcus bovis proteins for use in the method
EP1937304A2 (en) * 2005-08-24 2008-07-02 Novartis Vaccines and Diagnostics S.r.l. Zwitterionization of capsular saccharides
WO2007047749A1 (en) 2005-10-18 2007-04-26 Novartis Vaccines And Diagnostics Inc. Mucosal and systemic immunizations with alphavirus replicon particles
WO2007081447A2 (en) 2005-11-22 2007-07-19 Novartis Vaccines And Diagnostics, Inc. Norovirus and sapovirus antigens
GB0524066D0 (en) 2005-11-25 2006-01-04 Chiron Srl 741 ii
EP2368570A3 (en) 2006-01-18 2012-05-02 University Of Chicago Compositions and methods related to staphylococcal bacterium proteins
CA2646539A1 (en) 2006-03-23 2007-09-27 Novartis Ag Imidazoquinoxaline compounds as immunomodulators
ATE514794T1 (en) 2006-05-12 2011-07-15 Gen Probe Inc COMPOSITIONS AND METHODS FOR THE DETECTION OF ENTEROCOCCAL NUCLEIC ACIDS
JP2009542196A (en) * 2006-07-07 2009-12-03 インターセル アーゲー Small Streptococcus pyogenes antigens and their use
EP2586790A3 (en) 2006-08-16 2013-08-14 Novartis AG Immunogens from uropathogenic Escherichia coli
GB0700562D0 (en) 2007-01-11 2007-02-21 Novartis Vaccines & Diagnostic Modified Saccharides
EP2120984A2 (en) 2007-01-12 2009-11-25 Intercell AG Protective proteins of s. agalactiae, combinations thereof and methods of using the same
EP2173902A4 (en) * 2007-07-03 2013-01-09 Mt Sinai Hospital Therapeutics and diagnostics for group a streptococci
GB0713880D0 (en) 2007-07-17 2007-08-29 Novartis Ag Conjugate purification
WO2009026615A1 (en) * 2007-08-24 2009-03-05 University Of Wollongong Group a streptococcus pharmaceutical compositions and methods thereof
AU2013203022B2 (en) * 2007-09-12 2015-09-03 Glaxosmithkline Biologicals S.A. GAS57 mutant antigens and GAS57 antibodies
EP2234635B1 (en) * 2007-12-19 2017-01-25 Rhovac APS Rhoc-based immunotherapy
GB0818453D0 (en) 2008-10-08 2008-11-12 Novartis Ag Fermentation processes for cultivating streptococci and purification processes for obtaining cps therefrom
ES2532946T3 (en) 2008-02-21 2015-04-06 Novartis Ag Meningococcal PUfH polypeptides
SI2268618T1 (en) 2008-03-03 2015-09-30 Novartis Ag Compounds and compositions as tlr activity modulators
US8247170B2 (en) * 2008-05-16 2012-08-21 Medical Diagnostic Laboratories, Llc Detection of penicillin tolerance in Group B Streptococcus: single nucleotide polymorphisms in penicillin binding protein 4
US9545431B1 (en) * 2008-05-23 2017-01-17 The United States Of America, As Represented By The Secretary Of Agriculture Isolated recombinant cDNA
MX2010014358A (en) * 2008-06-20 2011-07-04 Wyeth Llc Compositions and methods of use of orf1358 from beta-hemolytic streptococcal strains.
JP2011525112A (en) 2008-06-20 2011-09-15 ワイス・エルエルシー Composition of ORF554 from β-hemolytic Streptococcus strain and method of use
AU2009309416B2 (en) 2008-10-27 2015-05-28 Glaxosmithkline Biologicals S.A. Purification method
NO2356135T3 (en) * 2008-11-05 2018-03-24
US8465751B2 (en) * 2009-01-12 2013-06-18 Novartis Ag Cna—B domain antigens in vaccines against gram positive bacteria
ITMI20090946A1 (en) 2009-05-28 2010-11-29 Novartis Ag EXPRESSION OF RECOMBINANT PROTEINS
US9517263B2 (en) 2009-06-10 2016-12-13 Glaxosmithkline Biologicals Sa Benzonaphthyridine-containing vaccines
EP2443250B8 (en) 2009-06-16 2016-09-21 GlaxoSmithKline Biologicals SA High-throughput complement-mediated antibody-dependent and opsonic bactericidal assays
CN102596240B (en) 2009-08-27 2015-02-04 诺华股份有限公司 Hybrid polypeptides including meningococcal fHBP sequences
MX2012002723A (en) 2009-09-02 2012-04-11 Novartis Ag Immunogenic compositions including tlr activity modulators.
TWI445708B (en) 2009-09-02 2014-07-21 Irm Llc Compounds and compositions as tlr activity modulators
CA2779798C (en) 2009-09-30 2019-03-19 Novartis Ag Conjugation of staphylococcus aureus type 5 and type 8 capsular polysaccharides
MX2012004850A (en) 2009-10-27 2012-05-22 Novartis Ag Modified meningococcal fhbp polypeptides.
EP3199177A1 (en) 2009-10-30 2017-08-02 GlaxoSmithKline Biologicals S.A. Purification of staphylococcus aureus type 5 and type 8 capsular saccharides
WO2011057148A1 (en) 2009-11-05 2011-05-12 Irm Llc Compounds and compositions as tlr-7 activity modulators
ES2631977T3 (en) 2009-12-15 2017-09-07 Glaxosmithkline Biologicals Sa Homogeneous suspension of immunopotentiating compounds and uses thereof
ES2707778T3 (en) 2009-12-30 2019-04-05 Glaxosmithkline Biologicals Sa Immunogens polysaccharides conjugated with carrier proteins of E. coli
KR101853513B1 (en) 2010-03-23 2018-04-30 노파르티스 아게 Compounds (cystein based lipopeptides) and compositions as tlr2 agonists used for treating infections, inflammations, respiratory diseases etc.
KR20130121699A (en) 2010-05-28 2013-11-06 테트리스 온라인, 인코포레이티드 Interactive hybrid asynchronous computer game infrastructure
AU2011257980B2 (en) 2010-05-28 2016-06-30 Sarepta Therapeutics, Inc. Oligonucleotide analogues having modified intersubunit linkages and/or terminal groups
US9770463B2 (en) 2010-07-06 2017-09-26 Glaxosmithkline Biologicals Sa Delivery of RNA to different cell types
US20130171241A1 (en) 2010-07-06 2013-07-04 Novartis Ag Liposomes with lipids having an advantageous pka-value for rna delivery
DK2591114T3 (en) 2010-07-06 2016-08-29 Glaxosmithkline Biologicals Sa Immunization of large mammals with low doses of RNA
US9192661B2 (en) 2010-07-06 2015-11-24 Novartis Ag Delivery of self-replicating RNA using biodegradable polymer particles
LT2590676T (en) 2010-07-06 2016-10-25 Glaxosmithkline Biologicals Sa Virion-like delivery particles for self-replicating rna molecules
LT3243526T (en) 2010-07-06 2020-02-10 Glaxosmithkline Biologicals S.A. Delivery of rna to trigger multiple immune pathways
RU2577983C2 (en) 2010-08-31 2016-03-20 Новартис Аг Lipids suitable for liposomal delivery of rna encoding protein
ES2918649T3 (en) 2010-08-31 2022-07-19 Glaxosmithkline Biologicals Sa Pegylated liposomes for delivery of RNA encoding an immunogen
WO2012031243A2 (en) 2010-09-03 2012-03-08 Avi Biopharma, Inc. dsRNA MOLECULES COMPRISING OLIGONUCLEOTIDE ANALOGS HAVING MODIFIED INTERSUBUNIT LINKAGES AND/OR TERMINAL GROUPS
AU2011300418B2 (en) 2010-09-10 2016-05-12 Glaxosmithkline Biologicals Sa Meningococcus overexpressing NadA and/or NHBA and outer membrane vesicles derived therefrom
GB201101665D0 (en) 2011-01-31 2011-03-16 Novartis Ag Immunogenic compositions
BR112013008700B8 (en) 2010-10-11 2022-10-04 Novartis Ag SELF-REPLICATING RNA MOLECULE, ALPHAVIRUS REPLICON PARTICLE, COMPOSITION, RECOMBINANT DNA MOLECULE, USE OF SELF-REPLICATING RNA MOLECULE
WO2012085668A2 (en) 2010-12-24 2012-06-28 Novartis Ag Compounds
WO2012097313A2 (en) 2011-01-14 2012-07-19 The Regents Of The University Of California Therapeutic antibodies against ror-1 protein and methods for use of same
US10286056B2 (en) 2011-01-27 2019-05-14 Glaxosmithkline Biologicals S.A. Adjuvant nanoemulsions with crystallisation inhibitors
WO2012129483A1 (en) 2011-03-24 2012-09-27 Novartis Ag Adjuvant nanoemulsions with phospholipids
ES2861428T3 (en) 2011-07-06 2021-10-06 Glaxosmithkline Biologicals Sa Liposomes that have a useful N: P ratio for delivery of RNA molecules
WO2013006838A1 (en) 2011-07-06 2013-01-10 Novartis Ag Immunogenic combination compositions and uses thereof
US9149541B2 (en) 2011-07-08 2015-10-06 Novartis Ag Tyrosine ligation process
EP2557424A1 (en) * 2011-08-11 2013-02-13 InGen Biosciences Method for diagnosing Streptococcus, Enterococcus and Pepstostreptococcus genera infections
TR201900264T4 (en) 2011-08-31 2019-02-21 Glaxosmithkline Biologicals Sa Pegylated liposomes for delivery of the immunogen encoding RNA.
CN103917245B (en) 2011-09-14 2017-06-06 葛兰素史密丝克莱恩生物有限公司 Method for preparing glycoprotein glycoconjugate
CN104080479B (en) 2011-11-07 2019-11-05 葛兰素史密丝克莱恩生物有限公司 Carrier molecules including spr0096 and spr2021 antigen
KR102271212B1 (en) 2011-11-18 2021-07-01 사렙타 쎄러퓨틱스, 인코퍼레이티드 Functionally-modified oligonucleotides and subunits thereof
RU2014127714A (en) 2011-12-08 2016-01-27 Новартис Аг TOXIN VACCINE Clostridium difficile
GB201122458D0 (en) 2011-12-30 2012-02-08 Univ Wageningen Modified cascade ribonucleoproteins and uses thereof
WO2013114363A2 (en) * 2012-01-30 2013-08-08 Yeda Research And Development Co.Ltd. Antimicrobial agents
CA2865028A1 (en) 2012-02-24 2013-08-29 Novartis Ag Pilus proteins and compositions
US9120111B2 (en) 2012-02-24 2015-09-01 Rain Bird Corporation Arc adjustable rotary sprinkler having full-circle operation and automatic matched precipitation
NZ700399A (en) 2012-03-20 2016-07-29 Sarepta Therapeutics Inc Boronic acid conjugates of oligonucleotide analogues
GB201206366D0 (en) * 2012-04-11 2012-05-23 Absynth Biologics Ltd Bacterial vaccine
BR112014026812A8 (en) 2012-04-26 2022-10-04 Novartis Ag ANTIGENS AND ANTIGEN COMBINATIONS
US10279026B2 (en) 2012-04-26 2019-05-07 Glaxosmithkline Biologicals Sa Antigens and antigen combinations
MX2014014067A (en) 2012-05-22 2015-02-04 Novartis Ag Meningococcus serogroup x conjugate.
EA038924B1 (en) 2012-05-25 2021-11-10 Те Риджентс Оф Те Юниверсити Оф Калифорния Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription
BR112014031891A2 (en) 2012-06-19 2017-08-01 Univ Minnesota genetic targeting in plants using DNA viruses
US9156043B2 (en) 2012-07-13 2015-10-13 Rain Bird Corporation Arc adjustable rotary sprinkler with automatic matched precipitation
EP3400960A1 (en) 2012-09-18 2018-11-14 GlaxoSmithKline Biologicals S.A. Outer membrane vesicles
WO2014053521A2 (en) 2012-10-02 2014-04-10 Novartis Ag Nonlinear saccharide conjugates
CN104717977A (en) 2012-10-03 2015-06-17 诺华股份有限公司 Immunogenic composition
KR102531576B1 (en) 2012-12-06 2023-05-11 시그마-알드리치 컴퍼니., 엘엘씨 Crispr-based genome modification and regulation
TR201807340T4 (en) 2013-02-01 2018-06-21 Glaxosmithkline Biologicals Sa Intradermal administration of immunological compositions comprising bell-like receptor agonists.
JP6352950B2 (en) 2013-03-08 2018-07-04 ノバルティス アーゲー Lipids and lipid compositions for active drug delivery
AU2014235794A1 (en) 2013-03-14 2015-10-22 Caribou Biosciences, Inc. Compositions and methods of nucleic acid-targeting nucleic acids
MX2015011985A (en) * 2013-03-15 2016-04-07 Univ Minnesota Engineering plant genomes using crispr/cas systems.
US9234213B2 (en) 2013-03-15 2016-01-12 System Biosciences, Llc Compositions and methods directed to CRISPR/Cas genomic engineering systems
PL231394B1 (en) 2013-06-28 2019-02-28 Instytut Immunologii I Terapii Doświadczalnej Im Ludwika Hirszfelda Polskiej Akademii Nauk Diagnostic test for Streptococcus agalactiae infections
WO2015042423A2 (en) * 2013-09-19 2015-03-26 Zoetis Llc Vaccine
WO2015070193A1 (en) * 2013-11-11 2015-05-14 Liu Oliver Compositions and methods for targeted gene disruption in prokaryotes
WO2015082501A1 (en) 2013-12-03 2015-06-11 Virometix Ag Proline-rich peptides protective against s. pneumoniae
US20150166982A1 (en) 2013-12-12 2015-06-18 President And Fellows Of Harvard College Methods for correcting pi3k point mutations
EP3083579B1 (en) 2013-12-19 2022-01-26 Novartis AG Lipids and lipid compositions for the delivery of active agents
PT3083556T (en) 2013-12-19 2020-03-05 Novartis Ag Lipids and lipid compositions for the delivery of active agents
RS61246B1 (en) 2014-02-28 2021-01-29 Glaxosmithkline Biologicals Sa Modified meningococcal fhbp polypeptides
CN106794141B (en) 2014-07-16 2021-05-28 诺华股份有限公司 Method for encapsulating nucleic acids in lipid nanoparticle hosts
GB201415602D0 (en) * 2014-09-03 2014-10-15 Moredun Res Inst Streptococcal antigens
EP3188760B1 (en) 2014-09-05 2023-12-06 Novartis AG Lipids and lipid compositions for the delivery of active agents
WO2016057954A2 (en) * 2014-10-10 2016-04-14 Board Of Regents Of The University Of Texas System Exogenous terminators for controlling fungal gene expression
WO2016077382A2 (en) * 2014-11-11 2016-05-19 Massachusetts Eye & Ear Infirmary Conjunctivitis vaccines
BR112017017812A2 (en) 2015-02-23 2018-04-10 Crispr Therapeutics Ag Materials and methods for treatment of hemoglobinopathies
EP3061826A1 (en) 2015-02-27 2016-08-31 Novartis AG Flavivirus replicons
US11020417B2 (en) 2015-06-04 2021-06-01 Sarepta Therapeutics, Inc Methods and compounds for treatment of lymphocyte-related diseases and conditions
EA039366B1 (en) 2015-06-24 2022-01-19 Джей Си Ар ФАРМАСЬЮТИКАЛЗ КО., ЛТД. Anti-human transferrin receptor antibody permeating blood-brain barrier
CA2990565A1 (en) 2015-06-24 2016-12-29 Jcr Pharmaceuticals Co., Ltd. Fusion protein containing bdnf and anti-human transferrin receptor antibody
US9872188B2 (en) * 2015-07-28 2018-01-16 Futurewei Technologies, Inc. Adaptive filtering based network anomaly detection
WO2017031189A1 (en) * 2015-08-17 2017-02-23 Zuchem, Inc. Production of activated tdp-deoxysugars in recombinant microorganisms
CN105112350B (en) * 2015-09-06 2019-02-01 西北农林科技大学 A kind of method for building up of reuteri non-resistant marker gene integration system and its application
JP7109784B2 (en) 2015-10-23 2022-08-01 プレジデント アンド フェローズ オブ ハーバード カレッジ Evolved Cas9 protein for gene editing
US10652910B2 (en) * 2015-11-05 2020-05-12 Intel IP Corporation Long-term evolution (LTE) and wireless local area network (WLAN) aggregation (LWA) connection procedures
US11208649B2 (en) 2015-12-07 2021-12-28 Zymergen Inc. HTP genomic engineering platform
US9988624B2 (en) 2015-12-07 2018-06-05 Zymergen Inc. Microbial strain improvement by a HTP genomic engineering platform
BR112018011503A2 (en) 2015-12-07 2018-12-04 Zymergen Inc corynebacterium glutamicum promoters
BE1024634B1 (en) 2016-04-05 2018-05-14 Gsk Vaccines S.R.L. IMMUNOGENIC COMPOSITIONS
JP2019519241A (en) 2016-06-30 2019-07-11 ザイマージェン インコーポレイテッド Method for producing a glucose permease library and its use
WO2018005655A2 (en) 2016-06-30 2018-01-04 Zymergen Inc. Methods for generating a bacterial hemoglobin library and uses thereof
WO2018027078A1 (en) 2016-08-03 2018-02-08 President And Fellows Of Harard College Adenosine nucleobase editors and uses thereof
US11661590B2 (en) 2016-08-09 2023-05-30 President And Fellows Of Harvard College Programmable CAS9-recombinase fusion proteins and uses thereof
US11542509B2 (en) 2016-08-24 2023-01-03 President And Fellows Of Harvard College Incorporation of unnatural amino acids into proteins using base editing
CN106169969B (en) * 2016-08-31 2020-01-10 华为技术有限公司 Method, related equipment and system for establishing label switching path of virtual private network
WO2018071868A1 (en) 2016-10-14 2018-04-19 President And Fellows Of Harvard College Aav delivery of nucleobase editors
WO2018119359A1 (en) 2016-12-23 2018-06-28 President And Fellows Of Harvard College Editing of ccr5 receptor gene to protect against hiv infection
IL276191B2 (en) 2016-12-26 2024-02-01 Japan Chem Res Novel anti-human transferrin receptor antibody capable of penetrating blood-brain barrier
WO2018165504A1 (en) 2017-03-09 2018-09-13 President And Fellows Of Harvard College Suppression of pain by gene editing
KR20190127797A (en) 2017-03-10 2019-11-13 프레지던트 앤드 펠로우즈 오브 하바드 칼리지 Cytosine to Guanine Base Editing Agent
CN108624516B (en) * 2017-03-20 2022-08-26 华东理工大学 Method for improving metabolite amount in fermentation cells and preparing IDMS standard substance
CA3057192A1 (en) 2017-03-23 2018-09-27 President And Fellows Of Harvard College Nucleobase editors comprising nucleic acid programmable dna binding proteins
WO2018199775A1 (en) * 2017-04-26 2018-11-01 Auckland Uniservices Analytical and therapeutic methods and compositions, and uses thereof
US11560566B2 (en) 2017-05-12 2023-01-24 President And Fellows Of Harvard College Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation
US11732274B2 (en) 2017-07-28 2023-08-22 President And Fellows Of Harvard College Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE)
US11319532B2 (en) 2017-08-30 2022-05-03 President And Fellows Of Harvard College High efficiency base editors comprising Gam
CA3082251A1 (en) 2017-10-16 2019-04-25 The Broad Institute, Inc. Uses of adenosine base editors
PL239045B1 (en) * 2018-01-09 2021-11-02 Inst Immunologii I Terapii Doswiadczalnej Polskiej Akademii Nauk Diagnostic test for detection of infections and/or carrying of Streptococcus agalactiae, using the selected polypeptide markers
EP3749767A1 (en) 2018-02-05 2020-12-16 Vertex Pharmaceuticals Incorporated Materials and methods for treatment of hemoglobinopathies
US11268077B2 (en) 2018-02-05 2022-03-08 Vertex Pharmaceuticals Incorporated Materials and methods for treatment of hemoglobinopathies
IL276608B2 (en) 2018-02-12 2024-04-01 Inimmune Corp Toll-like receptor ligands
US11541105B2 (en) 2018-06-01 2023-01-03 The Research Foundation For The State University Of New York Compositions and methods for disrupting biofilm formation and maintenance
CN109064036B (en) * 2018-08-08 2021-07-06 武汉大学 Ecosystem service supply and demand index change detection method facing management field
EP3607967A1 (en) 2018-08-09 2020-02-12 GlaxoSmithKline Biologicals S.A. Modified meningococcal fhbp polypeptides
MX2021011426A (en) 2019-03-19 2022-03-11 Broad Inst Inc Methods and compositions for editing nucleotide sequences.
CN113966234A (en) 2019-05-10 2022-01-21 葛兰素史克生物有限公司 Production of conjugates
CN110489587B (en) * 2019-07-31 2023-04-28 西安邮电大学 Tire trace image feature extraction method in local gradient direction three-value mode
US10948568B1 (en) * 2019-09-12 2021-03-16 Cypress Semiconductor Corporation Radar detection in a wireless LAN
CN111048833B (en) * 2019-10-30 2022-04-26 深圳市卓能新能源股份有限公司 High-voltage electrolyte and high-voltage lithium ion power battery
IL297761A (en) 2020-05-08 2022-12-01 Broad Inst Inc Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence
CN111518857A (en) * 2020-06-11 2020-08-11 江苏海飞生物科技有限公司 Enzyme method for producing glucosamine salt and purification method thereof
WO2022096590A1 (en) 2020-11-04 2022-05-12 Eligo Bioscience Phage-derived particles for in situ delivery of dna payload into c. acnes population
EP4346891A1 (en) * 2021-06-01 2024-04-10 The Regents of University of California Protective vaccine antigen against streptococcal infection
WO2023021427A1 (en) 2021-08-16 2023-02-23 Glaxosmithkline Biologicals Sa Freeze-drying of lipid nanoparticles (lnps) encapsulating rna and formulations thereof
WO2023021421A1 (en) 2021-08-16 2023-02-23 Glaxosmithkline Biologicals Sa Low-dose lyophilized rna vaccines and methods for preparing and using the same
GB202208089D0 (en) 2022-06-01 2022-07-13 Glaxosmithkline Biologicals Sa Immunogenic composition
GB202208093D0 (en) 2022-06-01 2022-07-13 Glaxosmithkline Biologicals Sa Immunogenic composition

Citations (73)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4454121A (en) * 1982-07-27 1984-06-12 The University Of Tennessee Research Corporation Synthetic peptides corresponding to antigenic determinants of the M protein of Streptococcus pyogenes
US4659561A (en) * 1983-02-18 1987-04-21 The University Of Vermont And State Agricultural College Process for treating the oral cavity
US4666886A (en) * 1983-01-25 1987-05-19 Ciba-Geigy Corporation Novel peptide derivatives
US5098827A (en) * 1988-02-26 1992-03-24 The University Of Florida Novel bacterial markers for pathogenic group B streptococci
US5354846A (en) * 1988-11-18 1994-10-11 Michael Kehoe Streptolysin O antigen derivatives, its production and uses
US5378620A (en) * 1991-08-30 1995-01-03 Beckman Instruments, Inc. Streptolysin O derivatives
US5391712A (en) * 1991-08-30 1995-02-21 Beckman Instruments, Inc. Non-hemolytic streptolysin O variants
US5445820A (en) * 1992-11-28 1995-08-29 Boehringer Mannheim Gmbh Streptolysin O peptide antigens and methods for the determination of streptolysin antibodies
US5585098A (en) * 1993-11-23 1996-12-17 Ovimmune, Inc. Oral administration of chicken yolk immunoglobulins to lower somatic cell count in the milk of lactating ruminants
US5604109A (en) * 1986-10-08 1997-02-18 New Horizons Diagnostics Corporation Method for exposing Group A streptococcal antigens and an improved diagnostic test for the identification of Group A streptococci
US5648241A (en) * 1989-09-15 1997-07-15 The General Hospital Corporation Conjugate vaccine against group B streptococcus
US5700648A (en) * 1989-01-04 1997-12-23 Kehoe; Michael Streptolysin O antigen derivatives, their production and uses
US5821088A (en) * 1990-05-11 1998-10-13 Siga Pharmaceuticals, Inc. Use of gram-positive bacteria to express recombinant proteins
US5846547A (en) * 1996-01-22 1998-12-08 Regents Of The University Of Minnesota Streptococcal C5a peptidase vaccine
US5968763A (en) * 1994-10-07 1999-10-19 The Rockefeller University Method for screening inhibitors of the enzyme which cleaves the anchor of surface proteins from gram positive bacteria
US6030835A (en) * 1993-12-02 2000-02-29 Baylor College Of Medicine Methods and composition for identifying group a streptococcus
US6174528B1 (en) * 1994-10-14 2001-01-16 Counsel Of The Queensland Institute Of Medical Research Synthetic peptides and vaccines comprising same
US20020025516A1 (en) * 1998-06-05 2002-02-28 Michael Terence Black Nrde
US6372222B1 (en) * 1995-06-07 2002-04-16 Baxter International Inc. Antigenic group B Streptococcus type II and type III polysaccharide fragments having a 2, 5-anhydro-D-mannose terminal structure and conjugate vaccine thereof
US20020045737A1 (en) * 1997-05-06 2002-04-18 Human Genome Sciences, Inc. Enterococcus faecalis polynucleotides and polypeptides
US6391634B1 (en) * 1986-07-29 2002-05-21 G. D. Searle & Co. Monoclonal antibodies and their production and use
US20020061569A1 (en) * 2000-03-21 2002-05-23 Robert Haselbeck Identification of essential genes in prokaryotes
US6406883B1 (en) * 1997-09-26 2002-06-18 Luetticken Rudolf Lmb gene of Streptococcus agalactiae
US20020086023A1 (en) * 2000-10-10 2002-07-04 University Of Tennessee Research Corporation Streptococcal streptolysin S vaccines
US6420152B1 (en) * 1993-06-23 2002-07-16 Beckman Instruments, Inc. Recombinant DNase B derived from Streptococcus pyogenes
US6426074B1 (en) * 1997-03-19 2002-07-30 The Brigham And Women's Hospital Inc. Group B Streptococcus vaccine
US20030109690A1 (en) * 1999-09-29 2003-06-12 Human Genome Sciences, Inc. Colon and colon cancer associated polynucleotides and polypeptides
US6579711B1 (en) * 1997-10-17 2003-06-17 Nestec S.A. Lactic acid bacteria species
US20030157122A1 (en) * 2000-10-10 2003-08-21 University Of Tennessee Research Corporation Streptococcal streptolysin S vaccines
US20030171337A1 (en) * 2000-06-07 2003-09-11 Aylward James Harrison Therapeutic agents - II
US6635623B1 (en) * 1997-06-13 2003-10-21 Baylor College Of Medicine Lipoproteins as nucleic acid vectors
US6669703B2 (en) * 2002-02-13 2003-12-30 Ming-Jeng Shue Vaginal suppository delivery device
US20040029129A1 (en) * 2001-10-25 2004-02-12 Liangsu Wang Identification of essential genes in microorganisms
US6716433B1 (en) * 1997-09-12 2004-04-06 University Of Tennessee Research Foundation Group a streptococcal vaccines
US6737521B1 (en) * 1990-05-11 2004-05-18 The Rockefeller University Delivery and expression of a hybrid surface protein on the surface of gram positive bacteria
US20040101536A1 (en) * 1998-04-20 2004-05-27 Chiron S.P.A. Vaccine formulations comprising antiidiotypic antibodies which immunologically mimic group B streptococcal carbohydrates
US6747437B2 (en) * 2002-09-27 2004-06-08 Wu's Tech Co., Ltd. Portable labor-saving battery device for electric vehicle
US6777547B1 (en) * 2000-01-31 2004-08-17 Andreas Podbielski Collagen-binding proteins from streptococcus pyogenes
US20040219639A1 (en) * 1995-06-08 2004-11-04 University Of Saskatchewan Camp factor of streptococcus uberis
US20040236072A1 (en) * 2001-04-13 2004-11-25 Olmsted Stephen Bruce Surface proteins of streptococcus pyogenes
US6833356B1 (en) * 1999-08-25 2004-12-21 Medimmune, Inc. Pneumococcal protein homologs and fragments for vaccines
US6843999B1 (en) * 1998-12-31 2005-01-18 Actinova Limited Streptococcal ABC transporter protein
US20050020813A1 (en) * 2001-03-27 2005-01-27 Vega Masignani Streptococcus pneumoniae proteins and nucleic acids
US20050181388A1 (en) * 2002-04-02 2005-08-18 Affinium Pharmaceuticals, Inc. Novel purified polypeptides from bacteria
US6936252B2 (en) * 1998-07-27 2005-08-30 Microbial Technics Limited Streptococcus pneumoniae proteins and nucleic acid molecules
US20050214918A1 (en) * 2002-04-08 2005-09-29 Affinium Pharmaceuticals, Inc. Novel purified polypeptides from streptococcus pneumoniae
US20050288866A1 (en) * 2004-02-06 2005-12-29 Council Of Scientific And Industrial Research Computational method for identifying adhesin and adhesin-like proteins of therapeutic potential
US20060039922A1 (en) * 1997-12-31 2006-02-23 Stressgen Biotechnologies Corporation, A Canadian Corporation Streptococcal heat shock proteins of the Hsp60 family
US20060041961A1 (en) * 2004-03-25 2006-02-23 Abad Mark S Genes and uses for pant improvement
US20060073530A1 (en) * 2001-08-15 2006-04-06 Olaf Schneewind Methods and compositions involving sortase B
US7033765B1 (en) * 1997-02-20 2006-04-25 Toronto Research Chemicals, Inc. Site-specific drug delivery
US7041814B1 (en) * 1998-02-18 2006-05-09 Genome Therapeutics Corporation Nucleic acid and amino acid sequences relating to Enterobacter cloacae for diagnostics and therapeutics
US20060115479A1 (en) * 2002-10-15 2006-06-01 Intercell Ag Nucleic acids coding for adhesion factor of group b streptococcus, adhesion factors of group b streptococcus and further uses thereof
US7063850B1 (en) * 1998-12-22 2006-06-20 University Of Tennessee Research Foundation Protective antigen of group A Streptococci
US20060160121A1 (en) * 2004-10-05 2006-07-20 Wyeth Probe arrays for detecting multiple strains of different species
US20060165716A1 (en) * 2004-07-29 2006-07-27 Telford John L Immunogenic compositions for gram positive bacteria such as streptococcus agalactiae
US7098182B2 (en) * 1998-07-27 2006-08-29 Microbial Technics Limited Nucleic acids and proteins from group B streptococcus
US20060194751A1 (en) * 2003-03-04 2006-08-31 Intercell Ag Streptococcus pyogenes antigens
US7101692B2 (en) * 1999-04-15 2006-09-05 The Regents Of The University Of California Identification of sortase gene
US20060210580A1 (en) * 2000-10-27 2006-09-21 Novartis Vaccines And Diagnostics, Inc. Nucleic acids and proteins from streptococcus groups A & B
US7128919B2 (en) * 2000-08-08 2006-10-31 St. Jude Children's Research Hospital Group B streptococcus polypeptides nucleic acids and therapeutic compositions and vaccines thereof
US7128918B1 (en) * 1998-12-23 2006-10-31 Id Biomedical Corporation Streptococcus antigens
US20060269541A1 (en) * 2003-05-07 2006-11-30 Intercell Ag S.agalactiae antigens I + II
US20060275315A1 (en) * 2002-05-02 2006-12-07 Chiron Srl Nucleic acids and proteins from streptococcus groups a & b
US20070036828A1 (en) * 2002-09-13 2007-02-15 Chiron Corporation Group b streptococcus vaccine
US20070053924A1 (en) * 2002-08-26 2007-03-08 Herve Tettelin Conserved and specific streptococcal genomes
US20070065464A1 (en) * 2003-07-31 2007-03-22 Chiron Corporation Immunogenic compositions for streptococcus pyogenes
US20070128229A1 (en) * 2002-04-12 2007-06-07 Wyeth Surface proteins of Streptococcus pyogenes
US20070141635A1 (en) * 2003-08-08 2007-06-21 David James Novel translocation assay
US7247308B2 (en) * 2000-07-06 2007-07-24 Id Biomedical Corporation Streptococcus pyogenes antigens
US7348006B2 (en) * 2001-07-26 2008-03-25 Novartis Vaccines And Diagnostics, S.R.L. Vaccines comprising aluminium adjuvants and histidine
US7407664B2 (en) * 2001-05-18 2008-08-05 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services, Centers For Disease Control And Prevention Peptide vaccines against group A streptococci
US20080220010A1 (en) * 2003-09-15 2008-09-11 Novartis Vaccines And Diagnostics Srl Immunogenic Compositions for Streptococcus Agalactiae

Family Cites Families (239)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US2386796A (en) 1942-08-05 1945-10-16 Bond Crown & Cork Co Extruding device
US3676548A (en) * 1970-09-18 1972-07-11 Lilly Co Eli Method of vaccinating swine against jowl abscess disease
DE2855719A1 (en) 1978-12-22 1980-07-10 Siemens Ag DENTAL HANDPIECE ARRANGEMENT
US4336336A (en) 1979-01-12 1982-06-22 President And Fellows Of Harvard College Fused gene and method of making and using same
AU545912B2 (en) 1980-03-10 1985-08-08 Cetus Corporation Cloned heterologous jive products in bacillies
ZA811368B (en) 1980-03-24 1982-04-28 Genentech Inc Bacterial polypedtide expression employing tryptophan promoter-operator
NZ199722A (en) 1981-02-25 1985-12-13 Genentech Inc Dna transfer vector for expression of exogenous polypeptide in yeast;transformed yeast strain
JPS57181099A (en) 1981-04-29 1982-11-08 Biogen Nv Bacillus cloning vector, recombinant dna molecule, bacillus host transformed thereby and manufacture of polypeptide expressing dna order and being coded thereby
US4551433A (en) 1981-05-18 1985-11-05 Genentech, Inc. Microbial hybrid promoters
US4425330A (en) * 1981-05-20 1984-01-10 Cornell Research Foundation, Inc. Bovine mastitis vaccine and method for detecting efficacy thereof
US4405712A (en) 1981-07-01 1983-09-20 The United States Of America As Represented By The Department Of Health And Human Services LTR-Vectors
US4769330A (en) 1981-12-24 1988-09-06 Health Research, Incorporated Modified vaccinia virus and methods for making and using the same
US4603112A (en) 1981-12-24 1986-07-29 Health Research, Incorporated Modified vaccinia virus
US4876197A (en) 1983-02-22 1989-10-24 Chiron Corporation Eukaryotic regulatable transcription
CA1341116C (en) 1983-02-22 2000-10-17 Rae Lyn Burke Yeast expression systems with vectors having gapdh or pyk promoters and synthesis or foreign protein
JPS59166086A (en) 1983-03-09 1984-09-19 Teruhiko Beppu Novel development type plasmid and development of vitular prochymosin gene in escherichia coli using it
US4546083A (en) 1983-04-22 1985-10-08 Stolle Research & Development Corporation Method and device for cell culture growth
US4588684A (en) 1983-04-26 1986-05-13 Chiron Corporation a-Factor and its processing signals
JPS59205983A (en) 1983-04-28 1984-11-21 ジエネツクス・コ−ポレイシヨン Development of different kind gene by procaryotic microorganism
US4663280A (en) 1983-05-19 1987-05-05 Public Health Research Institute Of The City Of New York Expression and secretion vectors and method of constructing vectors
EP0127839B1 (en) 1983-05-27 1992-07-15 THE TEXAS A&amp;M UNIVERSITY SYSTEM Method for producing a recombinant baculovirus expression vector
US4689406A (en) 1983-08-10 1987-08-25 Amgen Enhancement of microbial expression of polypeptides
US4870008A (en) 1983-08-12 1989-09-26 Chiron Corporation Secretory expression in eukaryotes
JPS6054685A (en) 1983-09-02 1985-03-29 Suntory Ltd Improved manifestation vector and its use
EP0136907A3 (en) 1983-10-03 1986-12-30 Genentech, Inc. A xenogeneic expression control system, a method of using it, expression vectors containing it, cells transformed thereby and heterologous proteins produced therefrom
DK518384A (en) 1984-01-31 1985-07-01 Idaho Res Found VECTOR FOR THE MANUFACTURE OF A GENE PRODUCT IN INSECT CELLS, PROCEDURE FOR ITS MANUFACTURING AND ITS USE
DK219084D0 (en) * 1984-05-02 1984-05-02 Frederik Carl Peter Lindberg ANTIGEN
US4880734A (en) 1984-05-11 1989-11-14 Chiron Corporation Eukaryotic regulatable transcription
EP0164556B1 (en) 1984-05-11 1994-03-02 Chiron Corporation Enhanced yeast transcription employing hybrid promoter region constructs
CA1282721C (en) 1984-06-04 1991-04-09 Bernard Roizman Herpes simplex virus as a vector
US5288641A (en) 1984-06-04 1994-02-22 Arch Development Corporation Herpes Simplex virus as a vector
US4738921A (en) 1984-09-27 1988-04-19 Eli Lilly And Company Derivative of the tryptophan operon for expression of fused gene products
US4745056A (en) 1984-10-23 1988-05-17 Biotechnica International, Inc. Streptomyces secretion vector
US4837148A (en) 1984-10-30 1989-06-06 Phillips Petroleum Company Autonomous replication sequences for yeast strains of the genus pichia
US4762915A (en) 1985-01-18 1988-08-09 Liposome Technology, Inc. Protein-liposome conjugates
US4797368A (en) 1985-03-15 1989-01-10 The United States Of America As Represented By The Department Of Health And Human Services Adeno-associated virus as eukaryotic expression vector
CA1260858A (en) 1985-03-28 1989-09-26 Lawrence S. Cousens Expression using fused genes providing for protein product
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
US4683202A (en) 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences
US6103243A (en) * 1985-05-15 2000-08-15 Biotechnology Australia Pty, Ltd Oral vaccines
US4865974A (en) 1985-09-20 1989-09-12 Cetus Corporation Bacterial methionine N-terminal peptidase
US4777127A (en) 1985-09-30 1988-10-11 Labsystems Oy Human retrovirus-related products and methods of diagnosing and treating conditions associated with said retrovirus
JPS6296086A (en) 1985-10-21 1987-05-02 Agency Of Ind Science & Technol Composite plasmid
US5139941A (en) 1985-10-31 1992-08-18 University Of Florida Research Foundation, Inc. AAV transduction vectors
US5091309A (en) 1986-01-16 1992-02-25 Washington University Sindbis virus vectors
US4861719A (en) 1986-04-25 1989-08-29 Fred Hutchinson Cancer Research Center DNA constructs for retrovirus packaging cell lines
FI871919A (en) 1986-05-02 1987-11-03 Gist Brocades Nv SEKRETIONSSIGNALSELEKTIONSVEKTORER FOER EXTRACELLULAER PROTEINSYNTES HOS BACILLUS-BAKTERIER.
WO1988002406A2 (en) 1986-10-02 1988-04-07 Massachusetts Institute Of Technology Methods of regulating metabolic stability of proteins
JPS63123383A (en) 1986-11-11 1988-05-27 Mitsubishi Kasei Corp Hybrid promoter, manifestation regulating dna sequence and manifestation vector
GB8702816D0 (en) 1987-02-07 1987-03-11 Al Sumidaie A M K Obtaining retrovirus-containing fraction
US5219740A (en) 1987-02-13 1993-06-15 Fred Hutchinson Cancer Research Center Retroviral gene transfer into diploid fibroblasts for gene therapy
CA1304020C (en) 1987-03-23 1992-06-23 Meher H. Irani High level expression in yeast
US4980289A (en) 1987-04-27 1990-12-25 Wisconsin Alumni Research Foundation Promoter deficient retroviral vector
WO1989001973A2 (en) 1987-09-02 1989-03-09 Applied Biotechnology, Inc. Recombinant pox virus for immunization against tumor-associated antigens
DK463887D0 (en) 1987-09-07 1987-09-07 Novo Industri As GAERLEADER
DE3852823T2 (en) 1987-09-11 1995-05-24 Whitehead Biomedical Inst TRANSDUCTION-CHANGED FIBROBLASTS AND THEIR USE.
US4929555A (en) 1987-10-19 1990-05-29 Phillips Petroleum Company Pichia transformation
DE318216T1 (en) 1987-11-18 1990-06-13 Chiron Corp., Emeryville, Calif., Us NANBV DIAGNOSTICS AND VACCINE.
SE456639B (en) 1987-11-27 1988-10-24 Golf Comback Ab C O Wiklund GOLF TRAINING DEVICE INCLUDING A HOUSE WITH LINEN DRUM
WO1989005349A1 (en) 1987-12-09 1989-06-15 The Australian National University Method of combating viral infections
CA1340772C (en) 1987-12-30 1999-09-28 Patricia Tekamp-Olson Expression and secretion of heterologous protiens in yeast employing truncated alpha-factor leader sequences
US4973551A (en) 1988-01-15 1990-11-27 Merck & Co., Inc. Vector for the expression of fusion proteins and protein immunogens
US5591624A (en) 1988-03-21 1997-01-07 Chiron Viagene, Inc. Retroviral packaging cell lines
WO1989009271A1 (en) 1988-03-21 1989-10-05 Viagene, Inc. Recombinant retroviruses
US5662896A (en) 1988-03-21 1997-09-02 Chiron Viagene, Inc. Compositions and methods for cancer immunotherapy
US5206152A (en) 1988-04-08 1993-04-27 Arch Development Corporation Cloning and expression of early growth regulatory protein genes
US5422120A (en) 1988-05-30 1995-06-06 Depotech Corporation Heterovesicular liposomes
AP129A (en) 1988-06-03 1991-04-17 Smithkline Biologicals S A Expression of retrovirus gag protein eukaryotic cells
GB8815795D0 (en) 1988-07-02 1988-08-10 Bkl Extrusions Ltd Glazing bead
EP0432216A1 (en) 1988-09-01 1991-06-19 Whitehead Institute For Biomedical Research Recombinant retroviruses with amphotropic and ecotropic host ranges
GB8827038D0 (en) 1988-11-18 1988-12-21 Kehoe M Streptolysin o antigens & uses
DE3841091A1 (en) 1988-12-07 1990-06-13 Behringwerke Ag SYNTHETIC ANTIGENS, METHOD FOR THEIR PRODUCTION AND THEIR USE
JP3237842B2 (en) 1988-12-16 2001-12-10 オランダ国 Pneumolysin mutants and pneumococcal vaccines produced therefrom
US5217879A (en) 1989-01-12 1993-06-08 Washington University Infectious Sindbis virus vectors
EP0378881B1 (en) 1989-01-17 1993-06-09 ENIRICERCHE S.p.A. Synthetic peptides and their use as universal carriers for the preparation of immunogenic conjugates suitable for the development of synthetic vaccines
WO1990007936A1 (en) 1989-01-23 1990-07-26 Chiron Corporation Recombinant therapies for infection and hyperproliferative disorders
JPH04503306A (en) 1989-02-01 1992-06-18 ザ・ジェネラル・ホスピタル・コーポレーション Herpes simplex virus type 1 expression vector
JP3140757B2 (en) 1989-02-06 2001-03-05 デイナ・フアーバー・キヤンサー・インステイテユート Packaging defective HIV provirus, cell lines and uses thereof
KR920701453A (en) 1989-03-17 1992-08-11 미리엄 디. 멕코나헤이 External regulation of gene expression
US5703055A (en) 1989-03-21 1997-12-30 Wisconsin Alumni Research Foundation Generation of antibodies through lipid mediated DNA delivery
ES2200016T3 (en) 1989-03-21 2004-03-01 Vical Incorporated EXPRESSION OF EXECUTIVE POLINUCLEOTIDIC SEQUENCES IN A VERTEBRATE.
JPH0832638B2 (en) 1989-05-25 1996-03-29 カイロン コーポレイション Adjuvant formulation comprising submicron oil droplet emulsion
EP0486573B1 (en) 1989-08-15 1995-10-11 Pasminco Australia Limited Absorption of zinc vapour in molten lead
EP1001032A3 (en) 1989-08-18 2005-02-23 Chiron Corporation Recombinant retroviruses delivering vector constructs to target cells
US5585362A (en) 1989-08-22 1996-12-17 The Regents Of The University Of Michigan Adenovirus vectors for gene therapy
US5166057A (en) 1989-08-28 1992-11-24 The Mount Sinai School Of Medicine Of The City University Of New York Recombinant negative strand rna virus expression-systems
GB8919607D0 (en) 1989-08-30 1989-10-11 Wellcome Found Novel entities for cancer therapy
IT1237764B (en) 1989-11-10 1993-06-17 Eniricerche Spa SYNTHETIC PEPTIDES USEFUL AS UNIVERSAL CARRIERS FOR THE PREPARATION OF IMMUNOGENIC CONJUGATES AND THEIR USE FOR THE DEVELOPMENT OF SYNTHETIC VACCINES.
AU7007491A (en) 1990-02-02 1991-08-08 Schweiz. Serum- & Impfinstitut Bern Cdna corresponding to the genome of negative-strand rna viruses, and process for the production of infectious negative-strand rna viruses
NZ237464A (en) 1990-03-21 1995-02-24 Depotech Corp Liposomes with at least two separate chambers encapsulating two separate biologically active substances
CA2039921A1 (en) 1990-04-16 1991-10-17 Xandra O. Breakefield Transfer and expression of gene sequences into central nervous system cells using herpes simplex virus mutants with deletions in genes for viral replication
WO1991018088A1 (en) 1990-05-23 1991-11-28 The United States Of America, Represented By The Secretary, United States Department Of Commerce Adeno-associated virus (aav)-based eucaryotic vectors
US5149655A (en) 1990-06-21 1992-09-22 Agracetus, Inc. Apparatus for genetic transformation
ATE128628T1 (en) 1990-08-13 1995-10-15 American Cyanamid Co FIBER HEMAGGLUTININ FROM BORDETELLA PERTUSSIS AS A CARRIER FOR CONJUGATE VACCINE.
CA2092195C (en) 1990-09-21 2000-04-18 Douglas J. Jolly Retroviral packaging cell line
US5173414A (en) 1990-10-30 1992-12-22 Applied Immune Sciences, Inc. Production of recombinant adeno-associated virus vectors
WO1992007945A1 (en) 1990-10-30 1992-05-14 Dana Farber Cancer Institute Cell type specific alteration of levels of gene products in neural cells
SE9003978D0 (en) 1990-12-13 1990-12-13 Henrik Garoff DNA EXPRESSION SYSTEM BASED ON A VIRUS REPLICATION
CA2098849C (en) 1990-12-20 2007-07-10 Ralph R. Weichselbaum Control of gene expression by ionizing radiation
JP3534749B2 (en) 1991-08-20 2004-06-07 アメリカ合衆国 Adenovirus-mediated gene transfer into the gastrointestinal tract
FR2681786A1 (en) 1991-09-27 1993-04-02 Centre Nat Rech Scient RECOMBINANT VECTORS OF VIRAL ORIGIN, PROCESS FOR OBTAINING SAME AND THEIR USE FOR THE EXPRESSION OF POLYPEPTIDES IN MUSCLE CELLS.
NZ244306A (en) 1991-09-30 1995-07-26 Boehringer Ingelheim Int Composition for introducing nucleic acid complexes into eucaryotic cells, complex containing nucleic acid and endosomolytic agent, peptide with endosomolytic domain and nucleic acid binding domain and preparation
IL103059A0 (en) 1991-09-30 1993-02-21 Boehringer Ingelheim Int Conjugates for introducing nucleic acid into higher eucaryotic cells
US5252479A (en) 1991-11-08 1993-10-12 Research Corporation Technologies, Inc. Safe vector for gene therapy
WO1993010218A1 (en) 1991-11-14 1993-05-27 The United States Government As Represented By The Secretary Of The Department Of Health And Human Services Vectors including foreign genes and negative selective markers
GB9125623D0 (en) 1991-12-02 1992-01-29 Dynal As Cell modification
JPH07503372A (en) 1992-01-23 1995-04-13 バイカル・インコーポレイテッド In vitro gene transfer
IT1262896B (en) 1992-03-06 1996-07-22 CONJUGATE COMPOUNDS FORMED FROM HEAT SHOCK PROTEIN (HSP) AND OLIGO-POLY-SACCHARIDES, THEIR USE FOR THE PRODUCTION OF VACCINES.
FR2688514A1 (en) 1992-03-16 1993-09-17 Centre Nat Rech Scient Defective recombinant adenoviruses expressing cytokines and antitumour drugs containing them
JPH07507689A (en) 1992-06-08 1995-08-31 ザ リージェンツ オブ ザ ユニバーシティ オブ カリフォルニア Specific tissue targeting methods and compositions
WO1993025698A1 (en) 1992-06-10 1993-12-23 The United States Government As Represented By The Vector particles resistant to inactivation by human serum
HU219808B (en) 1992-06-25 2001-08-28 Smithkline Beecham Biologicals S.A. Vaccine composition containing adjuvant and process for preparation thereof
GB2269175A (en) 1992-07-31 1994-02-02 Imperial College Retroviral vectors
JPH08501686A (en) 1992-09-25 1996-02-27 ローン−プーラン・ロレ・ソシエテ・アノニム Adenovirus vector for transfer of foreign gene to cells in central nervous system, especially brain
WO1994011506A1 (en) 1992-11-18 1994-05-26 Arch Development Corporation Adenovirus-mediated gene transfer to cardiac and vascular smooth muscle
AU680459B2 (en) 1992-12-03 1997-07-31 Genzyme Corporation Gene therapy for cystic fibrosis
US5478745A (en) 1992-12-04 1995-12-26 University Of Pittsburgh Recombinant viral vector system
FI93733C (en) * 1993-01-29 1995-05-26 Kaarina Tikkanen Streptococcus suis bacterium adhesin protein and process for its preparation
EP0613947B1 (en) 1993-02-01 2004-03-03 Beckman-Coulter, Inc. Mitogenic factor, gene thereof and method of microdetection therefor
US5348358A (en) 1993-02-22 1994-09-20 Selick David A Contact lens insertion tool
US6015889A (en) * 1993-03-19 2000-01-18 Gunnar Lindahl Protein rib, a cell surface protein that confers immunity to many strains of the group B streptococcus: process for purification of the protein, reagent kit and pharmaceutical composition
DE69405551T3 (en) 1993-03-23 2005-10-20 Smithkline Beecham Biologicals S.A. 3-0-DEAZYLATED MONOPHOSPHORYL LIPID A-CONTAINING VACCINE COMPOSITIONS
DE4311651A1 (en) 1993-04-08 1994-10-13 Boehringer Ingelheim Int Virus for the transport of foreign DNA into higher eukaryotic cells
WO1994023697A1 (en) 1993-04-22 1994-10-27 Depotech Corporation Cyclodextrin liposomes encapsulating pharmacologic compounds and methods for their use
DK0626452T3 (en) * 1993-05-17 2000-02-14 Akzo Nobel Nv Vaccine against infection of Streptococcus suis
JPH09501309A (en) 1993-05-26 1997-02-10 アメリカ合衆国 Adeno-associated viral rep protein and bacterial protein-containing fusion protein
FR2705686B1 (en) 1993-05-28 1995-08-18 Transgene Sa New defective adenoviruses and corresponding complementation lines.
ES2249761T3 (en) 1993-06-24 2006-04-01 Advec Inc. ADENOVIRUS VECTORS FOR GENE THERAPY.
NZ269156A (en) 1993-07-13 1996-03-26 Rhone Poulenc Rorer Sa Defective recombinant adenovirus vector incapable of replicating autonomously in a target cell and its use in gene therapy
CA2167706A1 (en) 1993-07-27 1995-02-09 Nigel Fraser Modified dna virus vectors and uses therefor
US5631236A (en) 1993-08-26 1997-05-20 Baylor College Of Medicine Gene therapy for solid tumors, using a DNA sequence encoding HSV-Tk or VZV-Tk
US5362865A (en) 1993-09-02 1994-11-08 Monsanto Company Enhanced expression in plants using non-translated leader sequences
CA2523216C (en) 1993-09-15 2010-11-16 Chiron Corporation Recombinant alphavirus vectors
FR2710536B1 (en) 1993-09-29 1995-12-22 Transgene Sa Anti-cancer use of a viral vector comprising a gene which modulates the immune and / or inflammatory response.
WO1995009654A1 (en) 1993-10-01 1995-04-13 The Government Of The United States Of America, Represented By The Secretary, Department Of Health And Human Services Gene therapy of the nervous system
DK0797676T3 (en) 1993-10-25 2006-04-18 Canji Inc Recombinant adenoviral vector and methods for its use
US5693506A (en) 1993-11-16 1997-12-02 The Regents Of The University Of California Process for protein production in plants
CA2176712C (en) 1993-11-16 2000-05-23 Mantripragada Sankaram Synthetic membrane vesicles with controlled release of encapsulated biologically active substances
FR2712603B1 (en) 1993-11-18 1996-02-09 Centre Nat Rech Scient Recombinant viruses, preparation and use in gene therapy.
GB9326253D0 (en) 1993-12-23 1994-02-23 Smithkline Beecham Biolog Vaccines
JPH07241786A (en) 1994-03-08 1995-09-19 Fanuc Ltd Control device for industrial robot
US6780406B1 (en) 1994-03-21 2004-08-24 The Regents Of The University Of Michigan Inhibition of vascular smooth muscle cell proliferation administering a thymidine kinase gene
US7252989B1 (en) 1994-04-04 2007-08-07 Board Of Regents, The University Of Texas System Adenovirus supervector system
CA2189067A1 (en) 1994-04-28 1995-11-09 Gary J. Nabel Gene delivery vector using plasmid dna packaged into an adenovirus and a packaging cell line
DE69535669T2 (en) 1994-05-09 2008-12-04 Oxford Biomedica (Uk) Ltd. RETROVIRAL VECTORS WITH REDUCED RECOMBINATION RATE
ATE336587T1 (en) 1994-06-10 2006-09-15 Genvec Inc ADENOVIRUS VECTOR SYSTEMS AND CELL LINES
US6207646B1 (en) 1994-07-15 2001-03-27 University Of Iowa Research Foundation Immunostimulatory nucleic acid molecules
CA2194761C (en) 1994-07-15 2006-12-19 Arthur M. Krieg Immunomodulatory oligonucleotides
FR2723588B1 (en) 1994-08-12 1996-09-20 Rhone Poulenc Rorer Sa ADENOVIRUS COMPRISING A GENE ENCODING GLUTATHIONE PEROXYDASE
IL117483A (en) 1995-03-17 2008-03-20 Bernard Brodeur Proteinase k resistant surface protein of neisseria meningitidis
AU5741996A (en) 1995-05-22 1996-12-11 Chiron Corporation Position-specific integration of vector constructs into eukaryotic genomes mediated by a chimeric integrase protein
GB9513261D0 (en) 1995-06-29 1995-09-06 Smithkline Beecham Biolog Vaccines
US6355255B1 (en) * 1998-12-07 2002-03-12 Regents Of The University Of Minnesota Streptococcal C5a peptidase vaccine
US5753235A (en) 1996-02-15 1998-05-19 Heska Corporation Recombinant canine herpesviruses
US6346392B1 (en) * 1996-11-27 2002-02-12 Smithkline Beecham Corporation Polynucleotides encoding a novel glutamine transport ATP-binding protein
IES960488A2 (en) 1996-07-03 1997-11-19 Trinity College Dublin Subunit Vaccine for Streptococcus Equi
US5945278A (en) * 1996-07-08 1999-08-31 The Finnish National Public Health Institute Method and system for enhanced production of commercially important exoproteins in gram-positive bacteria
EP0821070A1 (en) 1996-07-22 1998-01-28 Carelli, Claude Marcel Henri Pit-1 gene polymorphism and trait selection in animals
DE19630390A1 (en) 1996-07-26 1998-01-29 Chiron Behring Gmbh & Co Proteins, in particular membrane proteins from Helicobacter pylori, their production and use
CA2264012C (en) 1996-08-13 2011-04-26 Chiron Corporation Compositions and methods for polynucleotide delivery
ATE292980T1 (en) 1996-10-11 2005-04-15 Univ California IMMUNO-STIMULATING OLIGONUCLEOTIDE CONJUGATES
EP1770164B1 (en) 1996-10-31 2010-09-01 Human Genome Sciences, Inc. Streptococcus pneumoniae antigens and vaccines
WO1998019689A1 (en) 1996-11-01 1998-05-14 Smithkline Beecham Corporation Novel coding sequences
US5980898A (en) 1996-11-14 1999-11-09 The United States Of America As Represented By The U.S. Army Medical Research & Material Command Adjuvant for transcutaneous immunization
NZ337924A (en) * 1997-02-20 2002-09-27 Klaus Kimmeldirk Site-specific drug delivery compounds comprising an anchoring moiety, a linking group and a drug
WO1998037919A1 (en) 1997-02-28 1998-09-03 University Of Iowa Research Foundation USE OF NUCLEIC ACIDS CONTAINING UNMETHYLATED CpG DINUCLEOTIDE IN THE TREATMENT OF LPS-ASSOCIATED DISORDERS
ATE441432T1 (en) 1997-03-10 2009-09-15 Ottawa Hospital Res Inst USE OF NON-METHYLATED CPG DINUCLEOTIDE IN COMBINATION WITH ALUMINUM AS ADJUVANTS
EP1003531B1 (en) 1997-05-20 2007-08-22 Ottawa Health Research Institute Processes for preparing nucleic acid constructs
CA2291483C (en) 1997-06-06 2012-09-18 Dynavax Technologies Corporation Immunostimulatory oligonucleotides, compositions thereof and methods of use thereof
GB9712347D0 (en) 1997-06-14 1997-08-13 Smithkline Beecham Biolog Vaccine
GB9713156D0 (en) 1997-06-20 1997-08-27 Microbiological Res Authority Vaccines
EP1009382B1 (en) 1997-09-05 2003-06-18 GlaxoSmithKline Biologicals S.A. Oil in water emulsions containing saponins
WO1999013084A1 (en) 1997-09-12 1999-03-18 Id Vaccine Group a streptococcal vaccines
AU9507698A (en) * 1997-09-26 1999-04-23 Med Immune, Inc. (lmb) gene of (streptococcus agalactiae)
BR9813930A (en) 1997-11-06 2006-12-19 Chiron Spa neisserial antigen
AU748950B2 (en) 1997-11-21 2002-06-13 New Zealand Pastoral Agriculture Research Institute Limited Zoocin A immunity factor
CA2307846A1 (en) 1997-11-21 1999-06-03 Genset S.A. Chlamydia pneumoniae genomic sequence and polypeptides, fragments thereof and uses thereof, in particular for the diagnosis, prevention and treatment of infection
BR9814912A (en) 1997-11-28 2000-10-03 Genset Sa Genetic sequence and polypeptides of chlamydia trachomatis, fragments thereof and uses thereof, in particular for the diagnosis, prevention and treatment of infection
EP1047784B2 (en) 1998-01-14 2015-03-18 Novartis Vaccines and Diagnostics S.r.l. Neissera meningitidis antigens
HU228497B1 (en) 1998-02-20 2013-03-28 Id Biomedical Corp Quebec Group b steptococcus antigens
US6303114B1 (en) 1998-03-05 2001-10-16 The Medical College Of Ohio IL-12 enhancement of immune responses to T-independent antigens
WO1999052549A1 (en) 1998-04-09 1999-10-21 Smithkline Beecham Biologicals S.A. Adjuvant compositions
NZ532665A (en) 1998-05-01 2005-11-25 Inst Genomic Research Neisseria meningitidis antigens and compositions
CA2327387C (en) * 1998-05-07 2012-07-03 Gx Biosystems A/S Cytotoxin-based biological containment
ES2512496T3 (en) * 1998-07-22 2014-10-24 Stichting Dienst Landbouwkundig Onderzoek Vaccines and diagnostic tests for Streptococcus suis
JP2002531055A (en) 1998-07-27 2002-09-24 マイクロビアル テクニクス リミティッド S. pneumoniae protein and nucleic acid molecules
JP2002531054A (en) * 1998-07-27 2002-09-24 マイクロビアル テクニクス リミティッド Nucleic acids and proteins from group B streptococci
GB9817052D0 (en) 1998-08-05 1998-09-30 Smithkline Beecham Biolog Vaccine
MXPA01003557A (en) 1998-10-09 2004-04-05 Chiron Corp Neisseria genomic sequences and methods of their use.
DE122007000087I1 (en) 1998-10-16 2008-03-27 Glaxosmithkline Biolog Sa ADJUVANCY SYSTEMS AND VACCINES
US6175001B1 (en) 1998-10-16 2001-01-16 The Scripps Research Institute Functionalized pyrimidine nucleosides and nucleotides and DNA's incorporating same
AU1722300A (en) 1998-11-12 2000-05-29 Regents Of The University Of California, The Chlamydia pneumoniae genome sequence
GB9828000D0 (en) 1998-12-18 1999-02-10 Chiron Spa Antigens
BR0009163A (en) 1999-03-19 2001-12-26 Smithkline Beecham Biolog Vaccine
US6790950B2 (en) 1999-04-09 2004-09-14 Pharmacia & Upjohn Company Anti-bacterial vaccine compositions
JP2002541808A (en) 1999-04-09 2002-12-10 テクラブ, インコーポレイテッド Recombinant toxin A protein carrier for polysaccharide conjugate vaccine
CA2365523A1 (en) 1999-04-15 2000-10-26 The Regents Of The University Of California Identification of sortase gene
BRPI0010612B8 (en) 1999-04-19 2021-05-25 Smithkline Beecham Biologicals S A vaccines
WO2000078787A1 (en) 1999-06-21 2000-12-28 University Of Utah Research Foundation ISOLATED GENES FROM VIRULENT GROUP B $i(STREPTOCOCCUS AGALACTIAE)
GB9921125D0 (en) * 1999-09-07 1999-11-10 Microbial Technics Limited Proteins
KR20020038770A (en) 1999-09-24 2002-05-23 장 스테판느 Use of combination of polyoxyethylene sorbitan ester and octoxynol as adjuvant and its use in vaccines
CZ20021045A3 (en) 1999-09-24 2002-08-14 Smithkline Beecham Biologicals S. A. Auxiliary preparation
EP2275129A3 (en) 2000-01-17 2013-11-06 Novartis Vaccines and Diagnostics S.r.l. Outer membrane vesicle (OMV) vaccine comprising N. meningitidis serogroup B outer membrane proteins
US6620585B1 (en) * 2000-08-02 2003-09-16 Elitra Pharmaceuticals, Inc. Use of ectoenzymes and secreted enzymes to monitor cellular proliferation
FR2814754B1 (en) * 2000-10-04 2005-09-09 Pasteur Institut LISTERIA INNOCUA, GENOME AND APPLICATIONS
AU2002306849A1 (en) 2001-03-21 2002-10-08 Elitra Pharmaceuticals, Inc. Identification of essential genes in microorganisms
FR2824074A1 (en) * 2001-04-26 2002-10-31 Pasteur Institut SEQUENCE OF THE GENOME STREPTOCOCCUS AGALACTIAE, APPLICATION TO THE DEVELOPMENT OF VACCINES, DIAGNOSIS TOOLS, AND THE IDENTIFICATION OF THERAPEUTIC TARGETS
AU2002317107B2 (en) * 2001-07-06 2008-06-12 Id Biomedical Corporation Group B streptococcus antigens and corresponding DNA fragments
DE10136578B4 (en) * 2001-07-27 2005-05-04 Micronas Gmbh Method for testing a chip with a housing and for equipping a circuit board with the housing and chip with a housing
AU2002365223A1 (en) * 2001-10-26 2003-09-02 Id Biomedical Corporation Of Washington Multivalent streptococcal vaccine compositions and methods for use
EP1465659A4 (en) * 2001-12-21 2005-09-14 Children S Hospital And Region Use of a novel cell surface protease from group b streptococcus
AU2002359923B2 (en) * 2001-12-27 2007-12-20 Taisho Pharmaceutical Co., Ltd. 6-fluorobicyclo[3.1.0]hexane derivatives
JP2005535287A (en) 2002-02-11 2005-11-24 アイディー バイオメディカル コーポレイション Group B Streptococcus antigen
US6593093B1 (en) * 2002-02-20 2003-07-15 Mayo Foundation For Medical Education And Research Detection of group a Streptococcus
US20060134640A1 (en) * 2003-04-22 2006-06-22 Institut Pasteur Inhibiting the growth of bacterial biofilms
US20050016201A1 (en) 2003-07-22 2005-01-27 Ivanov Igor C. Multi-staged heating system for fabricating microelectronic devices
EP1663303B1 (en) 2003-09-15 2011-05-04 Novartis Vaccines and Diagnostics, Inc. Immunogenic compositions for streptococcus agalactiae
WO2005108419A1 (en) 2004-05-07 2005-11-17 Lea-Ann Kirkham Mutant cholesterol-binding cytolysin proteins
US20080213308A1 (en) * 2004-09-14 2008-09-04 Nicholas Valiante Imidazoquinoline Compounds
GB0421465D0 (en) 2004-09-27 2004-10-27 Chiron Srl Group A streptococcus protein
AU2005294275B2 (en) 2004-10-08 2012-09-13 Glaxosmithkline Biologicals S.A. Immunogenic and therapeutic compositions for Streptococcus pyogenes
CA2591510A1 (en) 2004-12-22 2006-06-29 Novartis Vaccines And Diagnostics, Inc. Group b streptococcus
GB0428394D0 (en) * 2004-12-24 2005-02-02 Chiron Srl Saccharide conjugate vaccines
GB0502096D0 (en) 2005-02-01 2005-03-09 Chiron Srl Purification of streptococcal capsular polysaccharide
GB0502095D0 (en) 2005-02-01 2005-03-09 Chiron Srl Conjugation of streptococcal capsular saccharides
EP1858920B1 (en) * 2005-02-18 2016-02-03 GlaxoSmithKline Biologicals SA Proteins and nucleic acids from meningitis/sepsis-associated escherichia coli
EP1919934A2 (en) 2005-05-13 2008-05-14 Novartis Vaccines and Diagnostics, Inc. Serum resistance factors of gram positive bacteria
EP1937304A2 (en) * 2005-08-24 2008-07-02 Novartis Vaccines and Diagnostics S.r.l. Zwitterionization of capsular saccharides
EP1770171A1 (en) 2005-09-29 2007-04-04 Universität Zu Köln DNA microarray for rapid identification of Candida albicans in blood cultures.
GB0522303D0 (en) 2005-11-01 2005-12-07 Chiron Srl Culture method
WO2007081447A2 (en) * 2005-11-22 2007-07-19 Novartis Vaccines And Diagnostics, Inc. Norovirus and sapovirus antigens
DK176565B1 (en) 2006-02-03 2008-09-08 Quilts Of Denmark As Furniture legs with light
GB0605757D0 (en) * 2006-03-22 2006-05-03 Chiron Srl Separation of conjugated and unconjugated components
ATE522541T1 (en) 2006-06-09 2011-09-15 Novartis Ag BACTERIAL ADHESIN CONFORMERS
JP2009542196A (en) 2006-07-07 2009-12-03 インターセル アーゲー Small Streptococcus pyogenes antigens and their use
WO2009027768A2 (en) * 2006-07-26 2009-03-05 Novartis Ag Immunogenic compositions for gram positive bacteria
WO2008108830A2 (en) 2006-10-30 2008-09-12 Novartis Ag Immunogenic and therapeutic compositions for streptococcus pyogenes
ES2561483T3 (en) * 2007-09-12 2016-02-26 Glaxosmithkline Biologicals Sa GAS57 mutant antigens and GAS57 antibodies
KR101773114B1 (en) * 2007-12-21 2017-08-30 노파르티스 아게 Mutant forms of streptolysin o

Patent Citations (95)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4454121A (en) * 1982-07-27 1984-06-12 The University Of Tennessee Research Corporation Synthetic peptides corresponding to antigenic determinants of the M protein of Streptococcus pyogenes
US4666886A (en) * 1983-01-25 1987-05-19 Ciba-Geigy Corporation Novel peptide derivatives
US4659561A (en) * 1983-02-18 1987-04-21 The University Of Vermont And State Agricultural College Process for treating the oral cavity
US6391634B1 (en) * 1986-07-29 2002-05-21 G. D. Searle & Co. Monoclonal antibodies and their production and use
US5604109A (en) * 1986-10-08 1997-02-18 New Horizons Diagnostics Corporation Method for exposing Group A streptococcal antigens and an improved diagnostic test for the identification of Group A streptococci
US5098827A (en) * 1988-02-26 1992-03-24 The University Of Florida Novel bacterial markers for pathogenic group B streptococci
US5354846A (en) * 1988-11-18 1994-10-11 Michael Kehoe Streptolysin O antigen derivatives, its production and uses
US5700648A (en) * 1989-01-04 1997-12-23 Kehoe; Michael Streptolysin O antigen derivatives, their production and uses
US5908629A (en) * 1989-09-15 1999-06-01 The General Hospital Corporation Conjugate vaccine for group B streptococcus
US5858362A (en) * 1989-09-15 1999-01-12 The General Hospital Corporation Conjugate vaccine for group B Streptococcus
US5648241A (en) * 1989-09-15 1997-07-15 The General Hospital Corporation Conjugate vaccine against group B streptococcus
US6342223B1 (en) * 1989-09-15 2002-01-29 The General Hospital Corporation & Brigham And Women's Hospital Immunogenic composition for group B Streptococcus
US5820860A (en) * 1989-09-15 1998-10-13 The General Hospital Corp. Conjugate vaccine for group B streptococcus
US5968521A (en) * 1989-09-15 1999-10-19 The General Hospital Corporation Conjugate vaccine for group B Streptococcus
US5843444A (en) * 1989-09-15 1998-12-01 The General Hospital Corporation Conjugate vaccine for group B streptococcus
US5847081A (en) * 1989-09-15 1998-12-08 The General Hospital Corp. Conjugate vaccine for group B Streptococcus
US5821088A (en) * 1990-05-11 1998-10-13 Siga Pharmaceuticals, Inc. Use of gram-positive bacteria to express recombinant proteins
US6737521B1 (en) * 1990-05-11 2004-05-18 The Rockefeller University Delivery and expression of a hybrid surface protein on the surface of gram positive bacteria
US5391712A (en) * 1991-08-30 1995-02-21 Beckman Instruments, Inc. Non-hemolytic streptolysin O variants
US5378620A (en) * 1991-08-30 1995-01-03 Beckman Instruments, Inc. Streptolysin O derivatives
US5445820A (en) * 1992-11-28 1995-08-29 Boehringer Mannheim Gmbh Streptolysin O peptide antigens and methods for the determination of streptolysin antibodies
US6420152B1 (en) * 1993-06-23 2002-07-16 Beckman Instruments, Inc. Recombinant DNase B derived from Streptococcus pyogenes
US5585098A (en) * 1993-11-23 1996-12-17 Ovimmune, Inc. Oral administration of chicken yolk immunoglobulins to lower somatic cell count in the milk of lactating ruminants
US6030835A (en) * 1993-12-02 2000-02-29 Baylor College Of Medicine Methods and composition for identifying group a streptococcus
US5968763A (en) * 1994-10-07 1999-10-19 The Rockefeller University Method for screening inhibitors of the enzyme which cleaves the anchor of surface proteins from gram positive bacteria
US6174528B1 (en) * 1994-10-14 2001-01-16 Counsel Of The Queensland Institute Of Medical Research Synthetic peptides and vaccines comprising same
US6372222B1 (en) * 1995-06-07 2002-04-16 Baxter International Inc. Antigenic group B Streptococcus type II and type III polysaccharide fragments having a 2, 5-anhydro-D-mannose terminal structure and conjugate vaccine thereof
US20040219639A1 (en) * 1995-06-08 2004-11-04 University Of Saskatchewan Camp factor of streptococcus uberis
US5846547A (en) * 1996-01-22 1998-12-08 Regents Of The University Of Minnesota Streptococcal C5a peptidase vaccine
US7033765B1 (en) * 1997-02-20 2006-04-25 Toronto Research Chemicals, Inc. Site-specific drug delivery
US20030035805A1 (en) * 1997-03-19 2003-02-20 The Brigham And Women's Hospital Inc. Group B Streptococcus vaccine
US6426074B1 (en) * 1997-03-19 2002-07-30 The Brigham And Women's Hospital Inc. Group B Streptococcus vaccine
US20020045737A1 (en) * 1997-05-06 2002-04-18 Human Genome Sciences, Inc. Enterococcus faecalis polynucleotides and polypeptides
US6635623B1 (en) * 1997-06-13 2003-10-21 Baylor College Of Medicine Lipoproteins as nucleic acid vectors
US6716433B1 (en) * 1997-09-12 2004-04-06 University Of Tennessee Research Foundation Group a streptococcal vaccines
US6406883B1 (en) * 1997-09-26 2002-06-18 Luetticken Rudolf Lmb gene of Streptococcus agalactiae
US6579711B1 (en) * 1997-10-17 2003-06-17 Nestec S.A. Lactic acid bacteria species
US20060039922A1 (en) * 1997-12-31 2006-02-23 Stressgen Biotechnologies Corporation, A Canadian Corporation Streptococcal heat shock proteins of the Hsp60 family
US7041814B1 (en) * 1998-02-18 2006-05-09 Genome Therapeutics Corporation Nucleic acid and amino acid sequences relating to Enterobacter cloacae for diagnostics and therapeutics
US20040101536A1 (en) * 1998-04-20 2004-05-27 Chiron S.P.A. Vaccine formulations comprising antiidiotypic antibodies which immunologically mimic group B streptococcal carbohydrates
US20020025516A1 (en) * 1998-06-05 2002-02-28 Michael Terence Black Nrde
US7098182B2 (en) * 1998-07-27 2006-08-29 Microbial Technics Limited Nucleic acids and proteins from group B streptococcus
US6936252B2 (en) * 1998-07-27 2005-08-30 Microbial Technics Limited Streptococcus pneumoniae proteins and nucleic acid molecules
US7063850B1 (en) * 1998-12-22 2006-06-20 University Of Tennessee Research Foundation Protective antigen of group A Streptococci
US7128918B1 (en) * 1998-12-23 2006-10-31 Id Biomedical Corporation Streptococcus antigens
US20070116712A1 (en) * 1998-12-23 2007-05-24 Id Biomedical Corporation Novel streptococcus antigens
US6843999B1 (en) * 1998-12-31 2005-01-18 Actinova Limited Streptococcal ABC transporter protein
US7101692B2 (en) * 1999-04-15 2006-09-05 The Regents Of The University Of California Identification of sortase gene
US6833356B1 (en) * 1999-08-25 2004-12-21 Medimmune, Inc. Pneumococcal protein homologs and fragments for vaccines
US20030109690A1 (en) * 1999-09-29 2003-06-12 Human Genome Sciences, Inc. Colon and colon cancer associated polynucleotides and polypeptides
US6777547B1 (en) * 2000-01-31 2004-08-17 Andreas Podbielski Collagen-binding proteins from streptococcus pyogenes
US20050019345A1 (en) * 2000-01-31 2005-01-27 Andreas Podbielski Collagen-binding proteins from Streptococcus pyogenes
US7169902B2 (en) * 2000-01-31 2007-01-30 Andreas Podbielski Collagen-binding proteins from Streptococcus pyogenes
US20020061569A1 (en) * 2000-03-21 2002-05-23 Robert Haselbeck Identification of essential genes in prokaryotes
US20030171337A1 (en) * 2000-06-07 2003-09-11 Aylward James Harrison Therapeutic agents - II
US7247308B2 (en) * 2000-07-06 2007-07-24 Id Biomedical Corporation Streptococcus pyogenes antigens
US20080038268A1 (en) * 2000-07-06 2008-02-14 Id Biomedical Corporation Streptococcus Pyogenes Antigens
US7128919B2 (en) * 2000-08-08 2006-10-31 St. Jude Children's Research Hospital Group B streptococcus polypeptides nucleic acids and therapeutic compositions and vaccines thereof
US20020086023A1 (en) * 2000-10-10 2002-07-04 University Of Tennessee Research Corporation Streptococcal streptolysin S vaccines
US20030157122A1 (en) * 2000-10-10 2003-08-21 University Of Tennessee Research Corporation Streptococcal streptolysin S vaccines
US20070098737A1 (en) * 2000-10-10 2007-05-03 University Of Tennessee Research Corporation Streptococcal streptolysin S vaccines
US20060210581A1 (en) * 2000-10-27 2006-09-21 Novartis Vaccines And Diagnostics, Inc. Nucleic acids and proteins from streptococcus groups A & B
US20060210582A1 (en) * 2000-10-27 2006-09-21 Novartis Vaccines And Diagnostics, Inc. Nucleic acids and proteins from streptococcus groups A & B
US20060210580A1 (en) * 2000-10-27 2006-09-21 Novartis Vaccines And Diagnostics, Inc. Nucleic acids and proteins from streptococcus groups A & B
US20060258849A1 (en) * 2000-10-27 2006-11-16 Novartis Vaccines And Diagnostics, Inc. Nucleic acids and proteins from streptococcus groups A & B
US20050020813A1 (en) * 2001-03-27 2005-01-27 Vega Masignani Streptococcus pneumoniae proteins and nucleic acids
US20040236072A1 (en) * 2001-04-13 2004-11-25 Olmsted Stephen Bruce Surface proteins of streptococcus pyogenes
US20070128211A1 (en) * 2001-04-13 2007-06-07 Wyeth Surface proteins of Streptococcus pyogenes
US20070128210A1 (en) * 2001-04-13 2007-06-07 Wyeth Surface proteins of Streptococcus pyogenes
US20090022753A1 (en) * 2001-04-13 2009-01-22 Wyeth Surface proteins of streptococcus pyogenes
US7407664B2 (en) * 2001-05-18 2008-08-05 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services, Centers For Disease Control And Prevention Peptide vaccines against group A streptococci
US7348006B2 (en) * 2001-07-26 2008-03-25 Novartis Vaccines And Diagnostics, S.R.L. Vaccines comprising aluminium adjuvants and histidine
US20060073530A1 (en) * 2001-08-15 2006-04-06 Olaf Schneewind Methods and compositions involving sortase B
US20040029129A1 (en) * 2001-10-25 2004-02-12 Liangsu Wang Identification of essential genes in microorganisms
US6669703B2 (en) * 2002-02-13 2003-12-30 Ming-Jeng Shue Vaginal suppository delivery device
US20050181388A1 (en) * 2002-04-02 2005-08-18 Affinium Pharmaceuticals, Inc. Novel purified polypeptides from bacteria
US20050214918A1 (en) * 2002-04-08 2005-09-29 Affinium Pharmaceuticals, Inc. Novel purified polypeptides from streptococcus pneumoniae
US20070128229A1 (en) * 2002-04-12 2007-06-07 Wyeth Surface proteins of Streptococcus pyogenes
US20060275315A1 (en) * 2002-05-02 2006-12-07 Chiron Srl Nucleic acids and proteins from streptococcus groups a & b
US20070053924A1 (en) * 2002-08-26 2007-03-08 Herve Tettelin Conserved and specific streptococcal genomes
US20070036828A1 (en) * 2002-09-13 2007-02-15 Chiron Corporation Group b streptococcus vaccine
US6747437B2 (en) * 2002-09-27 2004-06-08 Wu's Tech Co., Ltd. Portable labor-saving battery device for electric vehicle
US7485710B2 (en) * 2002-10-15 2009-02-03 Intercell Ag Nucleic acids coding for adhesion factor of group B streptococcus, adhesion factors of group B streptococcus and further uses thereof
US20060115479A1 (en) * 2002-10-15 2006-06-01 Intercell Ag Nucleic acids coding for adhesion factor of group b streptococcus, adhesion factors of group b streptococcus and further uses thereof
US20060194751A1 (en) * 2003-03-04 2006-08-31 Intercell Ag Streptococcus pyogenes antigens
US20060269541A1 (en) * 2003-05-07 2006-11-30 Intercell Ag S.agalactiae antigens I + II
US7438912B2 (en) * 2003-05-07 2008-10-21 Intercell Ag S.agalactiae antigens I + II
US7709009B2 (en) * 2003-07-31 2010-05-04 Novartis Vaccines And Diagnostics, Srl Immunogenic compositions for streptococcus pyogenes
US20070065464A1 (en) * 2003-07-31 2007-03-22 Chiron Corporation Immunogenic compositions for streptococcus pyogenes
US20070141635A1 (en) * 2003-08-08 2007-06-21 David James Novel translocation assay
US20080220010A1 (en) * 2003-09-15 2008-09-11 Novartis Vaccines And Diagnostics Srl Immunogenic Compositions for Streptococcus Agalactiae
US20050288866A1 (en) * 2004-02-06 2005-12-29 Council Of Scientific And Industrial Research Computational method for identifying adhesin and adhesin-like proteins of therapeutic potential
US20060041961A1 (en) * 2004-03-25 2006-02-23 Abad Mark S Genes and uses for pant improvement
US20060165716A1 (en) * 2004-07-29 2006-07-27 Telford John L Immunogenic compositions for gram positive bacteria such as streptococcus agalactiae
US20060160121A1 (en) * 2004-10-05 2006-07-20 Wyeth Probe arrays for detecting multiple strains of different species

Cited By (47)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7491402B2 (en) * 1998-12-24 2009-02-17 Auckland Uniservices Limited Superantigens SMEZ-2, SPE-G, SPE-H and SPE-J and uses thereof
US20060210581A1 (en) * 2000-10-27 2006-09-21 Novartis Vaccines And Diagnostics, Inc. Nucleic acids and proteins from streptococcus groups A & B
US20060258849A1 (en) * 2000-10-27 2006-11-16 Novartis Vaccines And Diagnostics, Inc. Nucleic acids and proteins from streptococcus groups A & B
US10428121B2 (en) 2000-10-27 2019-10-01 Novartis Ag Nucleic acids and proteins from streptococcus groups A and B
US9840538B2 (en) 2000-10-27 2017-12-12 Novartis Ag Nucleic acids and proteins from Streptococcus groups A and B
US9738693B2 (en) 2000-10-27 2017-08-22 Novartis Ag Nucleic acids and proteins from streptococcus groups A and B
US7939087B2 (en) 2000-10-27 2011-05-10 Novartis Vaccines And Diagnostics, Inc. Nucleic acids and proteins from Streptococcus groups A & B
US20060210582A1 (en) * 2000-10-27 2006-09-21 Novartis Vaccines And Diagnostics, Inc. Nucleic acids and proteins from streptococcus groups A & B
US8431139B2 (en) 2000-10-27 2013-04-30 Novartis Vaccines And Diagnostics, Inc. Nucleic acids and proteins from Streptococcus groups A and B
US8137673B2 (en) * 2000-10-27 2012-03-20 Novartis Vaccines And Diagnostics, Inc. Nucleic acids and proteins from Streptococcus groups A & B
US20100105865A1 (en) * 2000-10-27 2010-04-29 John Telford Nucleic acids and proteins from streptococcus groups a & b
US8025890B2 (en) 2000-10-27 2011-09-27 Novartis Vaccines And Diagnostics, Inc. Nucleic acids and proteins from streptococcus groups A and B
US7955604B2 (en) 2000-10-27 2011-06-07 Novartis Vaccines And Diagnostics, Inc. Nucleic acids and proteins from streptococcus groups A and B
US8821895B2 (en) * 2000-12-21 2014-09-02 Id Biomedical Corporation Of Quebec Streptococcus pyogenes antigens and corresponding DNA fragments
US20130136760A1 (en) * 2000-12-21 2013-05-30 Id Biomedical Corporation Of Quebec Streptococcus pyogenes antigens and corresponding dna fragments
US9340586B2 (en) * 2000-12-21 2016-05-17 Id Biomedical Corporation Of Quebec Streptococcus pyogenes antigens and corresponding DNA fragments
US20150017684A1 (en) * 2000-12-21 2015-01-15 Id Biomedical Corporation Of Quebec Streptococcus pyogenes antigens and corresponding dna fragments
US7740870B2 (en) * 2001-07-06 2010-06-22 Id Biomedical Corporation Group B Streptococcus antigens and corresponding DNA fragments
US20090042794A1 (en) * 2001-07-06 2009-02-12 Id Biomedical Corporation Group b streptococcus antigens and corresponding dna fragments
US20100303864A1 (en) * 2002-08-26 2010-12-02 Herve Tettelin Conserved and specific streptococcal genomes
US7993650B2 (en) 2003-07-04 2011-08-09 Affibody Ab Polypeptides having binding affinity for HER2
US7709009B2 (en) 2003-07-31 2010-05-04 Novartis Vaccines And Diagnostics, Srl Immunogenic compositions for streptococcus pyogenes
US20070065464A1 (en) * 2003-07-31 2007-03-22 Chiron Corporation Immunogenic compositions for streptococcus pyogenes
US8128936B2 (en) 2003-07-31 2012-03-06 Novartis Vaccines And Diagnostics, S.R.L. Immunogenic compositions for Streptococcus pyogenes
US9056912B2 (en) 2003-07-31 2015-06-16 Novartis Vaccines And Diagnostics, Srl Immunogenic compositions for Streptococcus pyogenes
US8529913B2 (en) 2003-07-31 2013-09-10 Novartis Vaccines And Diagnostics, Srl Immunogenic compositions for Streptococcus pyogenes
US8945589B2 (en) 2003-09-15 2015-02-03 Novartis Vaccines And Diagnostics, Srl Immunogenic compositions for Streptococcus agalactiae
US20080220010A1 (en) * 2003-09-15 2008-09-11 Novartis Vaccines And Diagnostics Srl Immunogenic Compositions for Streptococcus Agalactiae
US8778358B2 (en) 2004-07-29 2014-07-15 Novartis Vaccines And Diagnostics, Inc. Immunogenic compositions for gram positive bacteria such as Streptococcus agalactiae
US7838010B2 (en) 2004-10-08 2010-11-23 Novartis Vaccines And Diagnostics S.R.L. Immunogenic and therapeutic compositions for Streptococcus pyogenes
US20090117113A1 (en) * 2004-10-08 2009-05-07 Chiron Corporation Immunogenic And Therapeutic Compositions For Streptococcus Pyogenes
US20110206692A1 (en) * 2006-06-09 2011-08-25 Novartis Ag Conformers of bacterial adhesins
US20110038879A1 (en) * 2006-10-30 2011-02-17 Novartis Ag Immunogenic and therapeutic compositions for streptococcus pyogenes
US20080182265A1 (en) * 2007-01-31 2008-07-31 Gc Corporation Method for measuring the number of oral streptococci and a pcr primers-probe set used for the same
US8287885B2 (en) 2007-09-12 2012-10-16 Novartis Ag GAS57 mutant antigens and GAS57 antibodies
US8858957B2 (en) 2007-09-12 2014-10-14 Novartis Ag GAS57 mutant antigens and GAS57 antibodies
US8399651B2 (en) 2007-09-12 2013-03-19 Novartis Ag Nucleic acids encoding GAS57 mutant antigens
US9102741B2 (en) 2007-09-12 2015-08-11 Novartis Ag GAS57 mutant antigens and GAS57 antibodies
US8409589B2 (en) 2007-12-21 2013-04-02 Novartis Ag Mutant forms of streptolysin O
US7731978B2 (en) 2007-12-21 2010-06-08 Novartis Ag Mutant forms of streptolysin O
US20090162392A1 (en) * 2007-12-21 2009-06-25 Novartis Ag Mutant forms of streptolysin o
US8039005B2 (en) 2007-12-21 2011-10-18 Novartis Ag Mutant forms of streptolysin O
US20110020386A1 (en) * 2009-06-29 2011-01-27 Todd Gierahn Vaccines and compositions against streptococcus pneumoniae
US10105412B2 (en) 2009-06-29 2018-10-23 Genocea Biosciences, Inc. Vaccines and compositions against Streptococcus pneumoniae
US11207375B2 (en) 2009-06-29 2021-12-28 Genocea Biosciences, Inc. Vaccines and compositions against Streptococcus pneumoniae
US9393294B2 (en) 2011-01-20 2016-07-19 Genocea Biosciences, Inc. Vaccines and compositions against Streptococcus pneumoniae
US10188717B2 (en) 2011-01-20 2019-01-29 Genocea Biosciences, Inc. Vaccines and compositions against Streptococcus pneumoniae

Also Published As

Publication number Publication date
EP1671981A3 (en) 2006-07-05
US20150368304A1 (en) 2015-12-24
US20060210580A1 (en) 2006-09-21
EP2277894A1 (en) 2011-01-26
NZ583028A (en) 2011-10-28
CY1110698T1 (en) 2015-06-10
SG165981A1 (en) 2010-11-29
IL202254A (en) 2016-02-29
EP2284183A1 (en) 2011-02-16
AU2002214127B2 (en) 2007-06-07
US20060210582A1 (en) 2006-09-21
EP2277895B1 (en) 2013-08-14
US8431139B2 (en) 2013-04-30
EP2284181A1 (en) 2011-02-16
JP2013165714A (en) 2013-08-29
US20130129740A1 (en) 2013-05-23
EP1328543B1 (en) 2009-08-12
US8137673B2 (en) 2012-03-20
EP2284182A1 (en) 2011-02-16
IL238319B (en) 2019-03-31
NZ560966A (en) 2010-06-25
HK1153754A1 (en) 2012-04-05
US20060258849A1 (en) 2006-11-16
JP4874323B2 (en) 2012-02-15
CA2425303A1 (en) 2002-05-02
CA2881568C (en) 2019-09-24
DK1328543T3 (en) 2009-11-23
EP2189473A3 (en) 2010-08-11
JP2009118848A (en) 2009-06-04
US9840538B2 (en) 2017-12-12
US9738693B2 (en) 2017-08-22
MX357775B (en) 2018-07-20
JP2010508808A (en) 2010-03-25
US7955604B2 (en) 2011-06-07
ZA200302739B (en) 2005-01-26
MXPA03003690A (en) 2004-05-05
ES2330083T3 (en) 2009-12-04
IL154853A0 (en) 2003-10-31
US20180094033A1 (en) 2018-04-05
EP2896629A1 (en) 2015-07-22
NZ594877A (en) 2012-07-27
ATE439372T1 (en) 2009-08-15
JP4254931B1 (en) 2009-04-15
US20060210581A1 (en) 2006-09-21
CA2881568A1 (en) 2002-05-02
AU1412702A (en) 2002-05-06
US10428121B2 (en) 2019-10-01
US7939087B2 (en) 2011-05-10
JP2011239783A (en) 2011-12-01
NZ524888A (en) 2006-09-29
NZ540544A (en) 2007-08-31
WO2002034771A2 (en) 2002-05-02
EP2277895A1 (en) 2011-01-26
NZ593617A (en) 2012-04-27
IL154853A (en) 2010-06-16
WO2002034771A3 (en) 2003-01-16
EP2189473A2 (en) 2010-05-26
IL238319A0 (en) 2015-06-30
EP2277896A1 (en) 2011-01-26
EP1671981A2 (en) 2006-06-21
DE60139563D1 (en) 2009-09-24
IL264925A (en) 2019-05-30
US20100105865A1 (en) 2010-04-29
JP2016026494A (en) 2016-02-18
US8025890B2 (en) 2011-09-27
US20160264632A1 (en) 2016-09-15
EP1328543A2 (en) 2003-07-23

Similar Documents

Publication Publication Date Title
US8025890B2 (en) Nucleic acids and proteins from streptococcus groups A and B
US9764020B2 (en) Staphylococcus aureus proteins and nucleic acids
US20120207778A1 (en) Nucleic acids and proteins from streptococcus groups a and b
US20050020813A1 (en) Streptococcus pneumoniae proteins and nucleic acids
AU2008200977B2 (en) Nucleic acids and proteins from streptococcus groups A &amp; B
AU2004226909B2 (en) Nucleic acids and proteins from streptococcus groups A &amp; B

Legal Events

Date Code Title Description
AS Assignment

Owner name: NOVARTIS VACCINES AND DIAGNOSTICS, INC., CALIFORNI

Free format text: MERGER;ASSIGNOR:CHIRON CORPORATION;REEL/FRAME:017902/0107

Effective date: 20060420

AS Assignment

Owner name: J. CRAIG VENTER INSTITUTE, MARYLAND

Free format text: MERGER;ASSIGNOR:THE INSTITUTE FOR GENOMIC RESEARCH, INC.;REEL/FRAME:022850/0313

Effective date: 20061001

Owner name: J. CRAIG VENTER INSTITUTE,MARYLAND

Free format text: MERGER;ASSIGNOR:THE INSTITUTE FOR GENOMIC RESEARCH, INC.;REEL/FRAME:022850/0313

Effective date: 20061001

AS Assignment

Owner name: NOVARTIS VACCINES AND DIAGNOSTICS, INC., CALIFORNI

Free format text: MERGER;ASSIGNOR:CHIRON CORPORATION;REEL/FRAME:022930/0956

Effective date: 20060419

Owner name: NOVARTIS VACCINES AND DIAGNOSTICS, INC.,CALIFORNIA

Free format text: MERGER;ASSIGNOR:CHIRON CORPORATION;REEL/FRAME:022930/0956

Effective date: 20060419

AS Assignment

Owner name: NOVARTIS VACCINES AND DIAGNOSTICS, INC., CALIFORNI

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:SCARSELLI, MARIA;REEL/FRAME:022956/0119

Effective date: 20090715

Owner name: NOVARTIS VACCINES AND DIAGNOSTICS, INC.,CALIFORNIA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:SCARSELLI, MARIA;REEL/FRAME:022956/0119

Effective date: 20090715

AS Assignment

Owner name: NOVARTIS VACCINES AND DIAGNOSTICS, INC., CALIFORNI

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:NOVARTIS VACCINES AND DIAGNOSTICS SRL;REEL/FRAME:023548/0991

Effective date: 20091120

Owner name: NOVARTIS VACCINES AND DIAGNOSTICS SRL, ITALY

Free format text: CHANGE OF NAME;ASSIGNOR:CHIRON SRL;REEL/FRAME:023550/0436

Effective date: 20060428

Owner name: NOVARTIS VACCINES AND DIAGNOSTICS, INC.,CALIFORNIA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:NOVARTIS VACCINES AND DIAGNOSTICS SRL;REEL/FRAME:023548/0991

Effective date: 20091120

Owner name: NOVARTIS VACCINES AND DIAGNOSTICS SRL,ITALY

Free format text: CHANGE OF NAME;ASSIGNOR:CHIRON SRL;REEL/FRAME:023550/0436

Effective date: 20060428

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION