US20070050855A1 - Modified transferrin fusion proteins - Google Patents

Modified transferrin fusion proteins Download PDF

Info

Publication number
US20070050855A1
US20070050855A1 US11/504,099 US50409906A US2007050855A1 US 20070050855 A1 US20070050855 A1 US 20070050855A1 US 50409906 A US50409906 A US 50409906A US 2007050855 A1 US2007050855 A1 US 2007050855A1
Authority
US
United States
Prior art keywords
protein
fusion protein
transferrin
peptide
therapeutic
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US11/504,099
Inventor
Christopher Prior
Char-Huei Lai
Homayoun Sadeghi
Andrew Turner
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Individual
Original Assignee
Individual
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from US10/231,494 external-priority patent/US20040023334A1/en
Application filed by Individual filed Critical Individual
Priority to US11/504,099 priority Critical patent/US20070050855A1/en
Publication of US20070050855A1 publication Critical patent/US20070050855A1/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/79Transferrins, e.g. lactoferrins, ovotransferrins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • A61K47/644Transferrin, e.g. a lactoferrin or ovotransferrin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • A61P31/18Antivirals for RNA viruses for HIV
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • A61P7/06Antianaemics
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/555Interferons [IFN]
    • C07K14/565IFN-beta
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K7/00Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04Linear peptides containing only normal peptide links
    • C07K7/06Linear peptides containing only normal peptide links having 5 to 11 amino acids
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K7/00Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04Linear peptides containing only normal peptide links
    • C07K7/08Linear peptides containing only normal peptide links having 12 to 20 amino acids
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; CARE OF BIRDS, FISHES, INSECTS; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2217/00Genetically modified animals
    • A01K2217/05Animals comprising random inserted nucleic acids (transgenic)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/035Fusion polypeptide containing a localisation/targetting motif containing a signal for targeting to the external surface of a cell, e.g. to the outer membrane of Gram negative bacteria, GPI- anchored eukaryote proteins
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/16011Human Immunodeficiency Virus, HIV
    • C12N2740/16111Human Immunodeficiency Virus, HIV concerning HIV env
    • C12N2740/16122New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes

Definitions

  • the present invention relates to therapeutic proteins or peptides and soluble toxin receptor fragments with extended serum stability or serum half-life fused to or inserted in a transferrin molecule modified to reduce or inhibit glycosylation, iron binding and/or transferrin receptor binding.
  • the present invention includes IFN- ⁇ , GLP-1, EMP1, and T-20 fused to or inserted in a transferrin molecule or a modified transferrin molecule.
  • the present invention also includes an anti-toxin fusion protein comprising a fragment of synaptotagmin 1 fused to or inserted in a transferrin molecule or a modified transferrin molecule.
  • Therapeutic proteins or peptides in their native state or when recombinantly produced are typically labile molecules exhibiting short periods of serum stability or short serum half-lives. In addition, these molecules are often extremely labile when formulated, particularly when formulated in aqueous solutions for diagnostic and therapeutic purposes.
  • PEG Polyethylene glycol
  • Therapeutic proteins or peptides have also been stabilized by fusion to a heterologous protein capable of extending the serum half-life of the therapeutic protein.
  • therapeutic proteins fused to albumin and antibody fragments may exhibit extended serum half-live when compared to the therapeutic protein in the unfused state. See U.S. Pat. Nos. 5,876,969 and 5,766,88.
  • glycosylated human transferrin Tf
  • Tf glycosylated human transferrin
  • NGF nerve growth factor
  • CNTF ciliary neurotrophic factor
  • the Tf portion of the molecule is glycosylated and binds to two atoms of iron, which is required for Tf binding to its receptor on a cell and, according to the inventors of these patents, to target delivery of the NGF or CNTF moiety across the blood-brain barrier.
  • Transferrin fusion proteins have also been produced by inserting an HIV-1 protease sequence into surface exposed loops of glycosylated transferrin to investigate the ability to produce another form of Tf fusion for targeted delivery to the inside of a cell via the Tf receptor (Ali et al. (1999) J. Biol. Chem. 274(34):24066-24073).
  • Serum transferrin is a monomeric glycoprotein with a molecular weight of 80,000 daltons that binds iron in the circulation and transports it to various tissues via the transferrin receptor (TfR) (Aisen et al. (1980) Ann. Rev. Biochem. 49: 357-393; MacGillivray et al. (1981) J. Biol. Chem. 258: 3543-3553, U.S. Pat. No. 5,026,651). Tf is one of the most common serum molecules, comprising up to about 5-10% of total serum proteins.
  • Carbohydrate deficient transferrin occurs in elevated levels in the blood of alcoholics and exhibits a longer half life (approximately 14-17 days) than that of glycosylated transferrin (approximately 7-10 days).
  • Carbohydrate deficient transferrin occurs in elevated levels in the blood of alcoholics and exhibits a longer half life (approximately 14-17 days) than that of glycosylated transferrin (approximately 7-10 days).
  • Tf has been well characterized and the mechanism of receptor binding, iron binding and release and carbonate ion binding have been elucidated (U.S. Pat. Nos. 5,026,651, 5,986,067 and MacGillivray et al. (1983) J. Biol. Chem. 258(6):3543-3546).
  • Transferrin and antibodies that bind the transferrin receptor have also been used to deliver or carry toxic agents to tumor cells as cancer therapy (Baselga and Mendelsohn, 1994), and transferrin has been used as a non-viral gene therapy vector to vehicle to deliver DNA to cells (Frank et al., 1994; Wagner et al., 1992).
  • Transferrin fusion proteins have not, however, been modified or engineered to extend the serum half-life of a therapeutic protein or peptide or to increase bioavailability by reducing or inhibiting glycosylation of the Tf moiety or to reduce or prevent iron and/or Tf receptor binding.
  • the present invention includes modified Tf fusion proteins comprising at least one therapeutic protein, polypeptide or peptide entity, wherein the Tf portion is engineered to extend the serum half-life or bioavailability of the molecule.
  • the invention also includes pharmaceutical formulations and compositions comprising the fusion proteins, methods of extending the serum stability, serum half-life and bioavailability of a therapeutic protein by fusion to modified transferrin, nucleic acid molecules encoding the modified Tf fusion proteins, and the like.
  • Another aspect of the present invention relates to methods of treating a patient with a modified Tf fusion protein.
  • the modified Tf fusion proteins comprise a human transferrin Tf moiety that has been modified to reduce or prevent glycosylation and/or iron and receptor binding.
  • the present invention provides fusion proteins comprising therapeutic proteins fused to or inserted into the transferrin or modified transferrin molecules.
  • the therapeutic proteins of the present invention include ⁇ -interferon ( ⁇ -IFN), glucagon-like peptide (GLP-1), EPO (erythropoietin) mimetic peptide (EMP1), and T-20.
  • the present invention also provides fusion proteins comprising a soluble toxin receptor fragment that bins a toxin fused to or inserted into the transferrin or modified transferrin molecules.
  • the soluble toxin receptor may be synaptotagmin 1 and the soluble fragment is amino acids 1-53.
  • FIG. 1 shows an alignment of the N and C Domains of Human (Hu) transferrin (Tf) with similarities and identities highlighted.
  • FIGS. 2A-2B show an alignment of transferrin sequences from different species. Light shading: Similarity; Dark shading: Identity
  • FIG. 3 shows the location of a number of Tf surface exposed insertion sites for therapeutic proteins, polypeptides or peptides.
  • the present invention is based in part on the finding by the inventors that therapeutic proteins can be stabilized to extend their serum half-life and/or activity in vivo by genetically fusing the therapeutic proteins to transferrin, modified transferrin, or a portion of transferrin or modified transferrin sufficient to extend the half-life of the therapeutic protein in serum.
  • the modified transferrin fusion proteins include a transferrin protein or domain covalently linked to a therapeutic protein or peptide, wherein the transferrin portion is modified to contain one or more amino acid substitutions, insertions or deletions compared to a wild-type transferrin sequence.
  • Tf fusion proteins are engineered to reduce or prevent glycosylation within the Tf or a Tf domain.
  • the Tf protein or Tf domain(s) is modified to exhibit reduced or no binding to iron or carbonate ion, or to have a reduced affinity or not bind to a Tf receptor (TfR).
  • the therapeutic proteins contemplated by the present invention include, but are not limited to polypeptides, antibodies, peptides, or fragments or variants thereof.
  • the therapeutic proteins of the present invention include ⁇ - interferon, glucagon-like peptide-1 (GLP-1), EPO mimetic peptide (EMP1), and T-20.
  • the present invention also contemplates anti-toxin fusion proteins comprising a soluble toxin receptor fragment fused or inserted into transferrin or modified transferrin.
  • the soluble toxin receptor fragment binds a specific toxin.
  • the soluble toxin receptor fragment is amino acids 1-53 (SEQ ID NO: 4) of synaptotagmin 1.
  • the present invention therefore includes transferrin fusion proteins, therapeutic compositions comprising the fusion proteins, and methods of treating, preventing, or ameliorating diseases or disorders by administering the fusion proteins.
  • a transferrin fusion protein of the invention includes at least a fragment or variant of a therapeutic protein and at least a fragment or variant of modified transferrin, which are associated with one another, preferably by genetic fusion (i.e., the transferrin fusion protein is generated by translation of a nucleic acid in which a polynucleotide encoding all or a portion of a therapeutic protein is joined in-frame with a polynucleotide encoding all or a portion of modified transferrin) or chemical conjugation to one another.
  • the therapeutic protein and transferrin protein once part of the transferrin fusion protein, may be referred to as a “portion”, “region” or “moiety” of the transferrin fusion protein (e.g., a “therapeutic protein portion” or a “transferrin protein portion”).
  • the invention provides a transferrin fusion protein comprising, or alternatively consisting of, a therapeutic protein and a modified serum transferrin protein. In other embodiments, the invention provides a transferrin fusion protein comprising, or alternatively consisting of, a biologically active and/or therapeutically active fragment of a therapeutic protein and a modified transferrin protein. In other embodiments, the invention provides a transferrin fusion protein comprising, or alternatively consisting of, a biologically active and/or therapeutically active variant of a therapeutic protein and modified transferrin protein. In further embodiments, the invention provides a transferrin fusion protein comprising a therapeutic protein, and a biologically active and/or therapeutically active fragment of modified transferrin. In another embodiment, the therapeutic protein portion of the transferrin fusion protein is the active form of the therapeutic protein.
  • biological activity refers to a function or set of activities performed by a therapeutic molecule, protein or peptide in a biological context (i.e., in an organism or an in vitro facsimile thereof).
  • Biological activities may include but are not limited to the functions of the therapeutic molecule portion of the claimed fusion proteins, such as, but not limited to, the induction of extracellular matrix secretion from responsive cell lines, the induction of hormone secretion, the induction of chemotaxis, the induction of mitogenesis, the induction of differentiation, or the inhibition of cell division of responsive cells.
  • a fusion protein or peptide of the invention is considered to be biologically active if it exhibits one or more biological activities of its therapeutic protein's native counterpart.
  • an “amino acid corresponding to” or an “equivalent amino acid” in a transferrin sequence is identified by alignment to maximize the identity or similarity between a first transferrin sequence and at least a second transferrin sequence.
  • the number used to identify an equivalent amino acid in a second transferrin sequence is based on the number used to identify the corresponding amino acid in the first transferrin sequence.
  • these phrases may be used to describe the amino acid residues in human transferrin compared to certain residues in rabbit serum transferrin.
  • fragment of a Tf protein or “Tf protein,” or “portion of a Tf protein” refer to an amino acid sequence comprising at least about 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% of a naturally occurring Tf protein or mutant thereof.
  • genes refers to any segment of DNA associated with a biological function.
  • genes include, but are not limited to, coding sequences and/or the regulatory sequences required for their expression.
  • Genes can also include nonexpressed DNA segments that, for example, form recognition sequences for other proteins.
  • Genes can be obtained from a variety of sources, including cloning from a source of interest or synthesizing from known or predicted sequence information, and may include sequences designed to have desired parameters.
  • a “heterologous polynucleotide” or a “heterologous nucleic acid” or a “heterologous gene” or a “heterologous sequence” or an “exogenous DNA segment” refers to a polynucleotide, nucleic acid or DNA segment that originates from a source foreign to the particular host cell, or, if from the same source, is modified from its original form.
  • a heterologous gene in a host cell includes a gene that is endogenous to the particular host cell, but has been modified.
  • the terms refer to a DNA segment which is foreign or heterologous to the cell, or homologous to the cell but in a position within the host cell nucleic acid in which the element is not ordinarily found.
  • a signal sequence native to a yeast cell but attached to a human Tf sequence is heterologous.
  • an “isolated” nucleic acid sequence refers to a nucleic acid sequence which is essentially free of other nucleic acid sequences, e.g., at least about 20% pure, preferably at least about 40% pure, more preferably about 60% pure, even more preferably about 80% pure, most preferably about 90% pure, and even most preferably about 95% pure, as determined by agarose gel electrophoresis.
  • an isolated nucleic acid sequence can be obtained by standard cloning procedures used in genetic engineering to relocate the nucleic acid sequence from its natural location to a different site where it will be reproduced.
  • the cloning procedures may involve excision and isolation of a desired nucleic acid fragment comprising the nucleic acid sequence encoding the polypeptide, insertion of the fragment into a vector molecule, and incorporation of the recombinant vector into a host cell where multiple copies or clones of the nucleic acid sequence will be replicated.
  • the nucleic acid sequence may be of genomic, cDNA, RNA, semisynthetic, synthetic origin, or any combinations thereof.
  • two or more DNA coding sequences are said to be “joined” or “fused” when, as a result of in-frame fusions between the DNA coding sequences, the DNA coding sequences are translated into a polypeptide fusion.
  • fusion in reference to Tf fusions includes, but is not limited to, attachment of at least one therapeutic protein, polypeptide or peptide to the N-terminal end of Tf, attachment to the C-terminal end of Tf, and/or insertion between any two amino acids within Tf.
  • modified transferrin refers to a transferrin molecule that exhibits at least one modification of its amino acid sequence, compared to wildtype transferrin.
  • modified transferrin fusion protein refers to a protein formed by the fusion of at least one molecule of modified transferrin (or a fragment or variant thereof) to at least one molecule of a therapeutic protein (or fragment or variant thereof), preferably an antibody variable region.
  • nucleic acid or “polynucleotide” refer to deoxyribonucleotides or ribonucleotides and polymers thereof in either single- or double-stranded form. Unless specifically limited, the terms encompass nucleic acids containing analogues of natural nucleotides that have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g. degenerate codon substitutions) and complementary sequences as well as the sequence explicitly indicated.
  • degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al. (1991) Nucleic Acid Res. 19:5081; Ohtsuka et al. (1985) J. Biol. Chem. 260:2605-2608; Cassol et al. (1992); Rossolini et al. (1994) Mol. Cell. Probes 8:91-98).
  • nucleic acid is used interchangeably with gene, cDNA, and mRNA encoded by a gene.
  • DNA segment is referred to as “operably linked” when it is placed into a functional relationship with another DNA segment.
  • DNA for a signal sequence is operably linked to DNA encoding a fusion protein of the invention if it is expressed as a preprotein that participates in the secretion of the fusion protein; a promoter or enhancer is operably linked to a coding sequence if it stimulates the transcription of the sequence.
  • DNA sequences that are operably linked are contiguous, and in the case of a signal sequence or fusion protein both contiguous and in reading phase.
  • enhancers need not be contiguous with the coding sequences whose transcription they control. Linking, in this context, is accomplished by ligation at convenient restriction sites or at adapters or linkers inserted in lieu thereof.
  • promoter refers to a region of DNA involved in binding RNA polymerase to initiate transcription.
  • the term “subject” can be a human, a mammal, or an animal.
  • the subject being treated is a patient in need of treatment.
  • recombinant refers to a cell, tissue or organism that has undergone transformation with recombinant DNA.
  • a targeting entity, protein, polypeptide or peptide refers to such molecules that binds specifically to a particular cell type (normal e.g., lymphocytes or abnormal e.g., cancer cell) and therefore may be used to target a transferrin fusion protein or compound (drug, or cytotoxic agent) to that cell type specifically.
  • therapeutic protein refers to proteins, polypeptides, antibodies, peptides fragments or variants thereof, having one or more therapeutic and/or biological activities.
  • Therapeutic proteins encompassed by the invention include but are not limited to proteins, polypeptides, peptides, antibodies and biologics.
  • the terms peptides, proteins, and polypeptides are used interchangeably herein and include soluble toxin receptors.
  • therapeutic protein may refer to the endogenous or naturally occurring correlate of a therapeutic protein.
  • a polypeptide displaying a “therapeutic activity” or a protein that is “therapeutically active” is meant a polypeptide that possesses one or more known biological and/or therapeutic activities associated with a therapeutic protein such as one or more of the therapeutic proteins described herein or otherwise known in the art.
  • a “therapeutic protein” is a protein that is useful to treat, prevent or ameliorate a disease, condition or disorder. Such a disease, condition or disorder may be in humans or in a non-human animal, e.g., veterinary use.
  • therapeutically effective amount refers to that amount of the transferrin fusion protein comprising a therapeutic molecule which, when administered to a subject in need thereof, is sufficient to effect treatment.
  • the amount of transferrin fusion protein which constitutes a “therapeutically effective amount” will vary depending on the therapeutic protein used, the severity of the condition or disease, and the age and body weight of the subject to be treated, but can be determined routinely by one of ordinary skill in the art having regard to his/her own knowledge and to this disclosure.
  • toxin refers to a poisonous substance of biological origin.
  • transformation refers to the transfer of nucleic acid (i.e., a nucleotide polymer) into a cell.
  • genetic transformation refers to the transfer and incorporation of DNA, especially recombinant DNA, into a cell.
  • transformant refers to a cell, tissue or organism that has undergone transformation.
  • transgene refers to a nucleic acid that is inserted into an organism, host cell or vector in a manner that ensures its function.
  • transgenic refers to cells, cell cultures, organisms, bacteria, fungi, animals, plants, and progeny of any of the preceding, which have received a foreign or modified gene and in particular a gene encoding a modified Tf fusion protein by one of the various methods of transformation, wherein the foreign or modified gene is from the same or different species than the species of the organism receiving the foreign or modified gene.
  • variants or variant refers to a polynucleotide or nucleic acid differing from a reference nucleic acid or polypeptide, but retaining essential properties thereof. Generally, variants are overall closely similar, and, in many regions, identical to the reference nucleic acid or polypeptide.
  • variant refers to a therapeutic protein portion of a transferrin fusion protein of the invention, differing in sequence from a native therapeutic protein but retaining at least one functional and/or therapeutic property thereof as described elsewhere herein or otherwise known in the art.
  • the term “vector” refers broadly to any plasmid, phagemid or virus encoding an exogenous nucleic acid.
  • the term is also to be construed to include non-plasmid, non-phagemid and non-viral compounds which facilitate the transfer of nucleic acid into virions or cells, such as, for example, polylysine compounds and the like.
  • the vector may be a viral vector that is suitable as a delivery vehicle for delivery of the nucleic acid, or mutant thereof, to a cell, or the vector may be a non-viral vector which is suitable for the same purpose. Examples of viral and non-viral vectors for delivery of DNA to cells and tissues are well known in the art and are described, for example, in Ma et al.
  • viral vectors include, but are not limited to, a recombinant vaccinia virus, a recombinant adenovirus, a recombinant retrovirus, a recombinant adeno-associated virus, a recombinant avian pox virus, and the like (Cranage et al., 1986, EMBO J. 5:3057-3063; International Patent Application No. WO94/17810, published Aug. 18, 1994; International Patent Application No. WO94/23744, published Oct. 27, 1994).
  • non-viral vectors include, but are not limited to, liposomes, polyamine derivatives of DNA, and the like.
  • wild type refers to a polynucleotide or polypeptide sequence that is naturally occurring.
  • the present invention provides fusion proteins comprising therapeutic protein or soluble toxin receptor fragment and transferrin or modified transferrin.
  • the therapeutic proteins provided by the present invention include ⁇ -IFN, GLP-1, EMP1, and T-20.
  • the soluble toxin receptor fragment is amino acids 1-53 (SEQ ID NO: 4) of synaptotagmin 1. Any transferrin may be used to make modified Tf fusion proteins of the invention.
  • Wild-type human Tf is a 679 amino acid protein, of approximately 75 kDa (not accounting for glycosylation), with two main domains, N (about 330 amino acids) and C (about 340 amino acids), which appear to originate from a gene duplication. See GenBank accession numbers NM001063, XM002793, M12530, XM039845, XM 039847 and S95936 (www.ncbi.n1m.nih.gov), all of which are herein incorporated by reference in their entirety, as well as SEQ ID NOS: 1, 2 and 3. The two domains have diverged over time but retain a large degree of identity/similarity ( FIG. 1 ).
  • TfR Tf receptor
  • TfR Tf receptor
  • endocytosis then occurs whereby the TfR/Tf complex is transported to the endosome, at which point the localized drop in pH results in release of bound iron and the recycling of the TfR/Tf complex to the cell surface and release of Tf (known as apoTf in its un-iron bound form).
  • Receptor binding is through the C domain of Tf.
  • the two glycosylation sites in the C domain do not appear to be involved in receptor binding as unglycosylated iron bound Tf does bind the receptor.
  • Tf can carry two iron atoms. These are complexed in the space between the N1 and N2, C1 and C2 subdomains resulting in a conformational change in the molecule. Tf crosses the blood brain barrier (BBB) via the Tf receptor.
  • BBB blood brain barrier
  • the iron binding sites comprise at least of amino acids Asp 63 (Asp 82 of SEQ ID NO: 2 which comprises the native Tf signal sequence); Asp 392 (Asp 411 of SEQ ID NO: 2); Tyr 95 (Tyr 114 of SEQ ID NO: 2); Tyr 426 (Tyr 445 of SEQ ID NO: 2); Tyr 188 (Tyr 207 of SEQ ID NO: 2); Tyr 514 or 517 (Tyr 533 or Tyr 536 SEQ ID NO:2); His 249 (His 268 of SEQ ID NO: 2); His 585 (His 604 of SEQ ID NO: 2), the hinge regions comprise at least N domain amino acid residues 94-96, 245-247 and/or 316-318 as well as C domain amino acid residues 425-427, 581-582 and/or 652-658, the carbonate binding sites comprise at least of amino acids Thr 120 (Thr 139 of SEQ ID NO: 2); Thr 452 (Thr 471 of SEQ ID NO:
  • the transferrin fusion protein includes a modified human transferrin, although any animal Tf molecule may be used to produce the fusion proteins of the invention, including human Tf variants, cow, pig, sheep, dog, rabbit, rat, mouse, hamster, echnida, platypus, chicken, frog, hornworm, monkey, as well as other bovine, canine and avian species (see FIG. 2 for a representative set of Tf sequences). All of these Tf sequences are readily available in GenBank and other public databases.
  • the human Tf nucleotide sequence is available (see SEQ ID NOS: 1, 2 and 3 and the accession numbers described above and available at www.ncbi.n1m.nih.gov/) and can be used to make genetic fusions between Tf or a domain of Tf and the therapeutic molecule of choice. Fusions may also be made from related molecules such as lacto transferrin (lactoferrin) GenBank Acc: NM — 002343) and melanotransferrin (GenBank Acc. NM — 013900, murine melanotransferrin).
  • lacto transferrin lactoferrin
  • melanotransferrin GenBank Acc. NM — 013900, murine melanotransferrin
  • Lactoferrin a natural defense iron-binding protein, has been found to possess antibacterial, antimycotic, antiviral, antineoplastic and anti-inflammatory activity.
  • the protein is present in exocrine secretions that are commonly exposed to normal flora: milk, tears, nasal exudate, saliva, bronchial mucus, gastrointestinal fluids, cervico-vaginal mucus and seminal fluid.
  • Lf is a major constituent of the secondary specific granules of circulating polymorphonuclear neutrophils (PMNs). The apoprotein is released on degranulation of the PMNs in septic areas.
  • Lf A principal function of Lf is that of scavenging free iron in fluids and inflamed areas so as to suppress free radical-mediated damage and decrease the availability of the metal to invading microbial and neoplastic cells.
  • Melanotransferrin is a glycosylated protein found at high levels in malignant melanoma cells and was originally named human melanoma antigen p97 (Brown et al., 1982, Nature, 296: 171-173). It possesses high sequence homology with human serum transferrin, human lactoferrin, and chicken transferrin (Brown et al., 1982, Nature, 296: 171-173; Rose et al., Proc. Natl. Acad. Sci., 1986, 83: 1261-1265). However, unlike these receptors, no cellular receptor has been identified for melanotransferrin.
  • the transferrin portion of the transferrin fusion protein of the invention includes a transferrin splice variant.
  • a transferrin splice variant can be a splice variant of human transferrin.
  • the human transferrin splice variant can be that of Genbank Accession AAA61140.
  • the transferrin portion of the transferrin fusion protein of the invention includes a lactoferrin splice variant.
  • a human serum lactoferrin splice variant can be a novel splice variant of a neutrophil lactoferrin.
  • the neutrophil lactoferrin splice variant can be that of Genbank Accession AAA59479.
  • the neutrophil lactoferrin splice variant can comprise the following amino acid sequence EDCIALKGEADA (SEQ ID NO: 5), which includes the novel region of splice-variance.
  • Modified Tf fusions may be made with any Tf protein, fragment, domain, or engineered domain.
  • fusion proteins may be produced using the full-length Tf sequence, with or without the native Tf signal sequence.
  • Transferrin fusion proteins may also be made using a single Tf domain, such as an individual N or C domain.
  • the use of a single or double N domain is advantageous as the Tf glycosylation sites reside in the C domain and the N domain, on its own, does not bind iron or the Tf receptor.
  • fusions of a therapeutic protein to a single or double C domain may be produced, wherein the C domain is altered to reduce, inhibit or prevent glycosylation, iron binding and/or Tf receptor binding. See U.S. Provisional Application 60/406,977, which is herein incorporated by reference in its entirety.
  • a C terminal domain or lobe modified to function as an N-like domain is modified to exhibit glycosylation patterns or iron binding properties substantially like that of a native or wild-type N domain or lobe.
  • the C domain or lobe is modified so that it is not glycosylated and does not bind iron by substitution of the relevant C domain regions or amino acids to those present in the corresponding regions or sites of a native or wild-type N domain.
  • a Tf moiety comprising “two N domains or lobes” includes a Tf molecule that is modified to replace the native C domain or lobe with a native or wild-type N domain or lobe or a modified N domain or lobe or contains a C domain that has been modified to function substantially like a wild-type or modified N domain.
  • the transferrin portion of the transferrin fusion protein includes at least two N terminal lobes of transferrin. In further embodiments, the transferrin portion of the transferrin fusion protein includes at least two N terminal lobes of transferrin derived from human serum transferrin.
  • the transferrin portion of the transferrin fusion protein includes, comprises, or consists of at least two N terminal lobes of transferrin having a mutation in at least one amino acid residue selected from the group consisting of Asp63, Gly65, Tyr95, Tyr188, and His249 of SEQ ID NO: 3.
  • the transferrin portion of the modified transferrin fusion protein includes a recombinant human serum transferrin N-terminal lobe mutant having a mutation at Lys206 or His207 of SEQ ID NO: 3.
  • the transferrin portion of the transferrin fusion protein includes, comprises, or consists of at least two C terminal lobes of transferrin. In further embodiments, the transferrin portion of the transferrin fusion protein includes at least two C terminal lobes of transferrin derived from human serum transferrin.
  • the C terminal lobe mutant further includes a mutation of at least one of Asn413 and Asn611 of SEQ ID NO: 3 which does not allow glycosylation.
  • the transferrin portion of the transferrin fusion protein includes at least two C terminal lobes of transferrin having a mutation in at least one amino acid residue selected from the group consisting of Asp392, Tyr426, Tyr514, Tyr517 and His585 of SEQ ID NO: 3, wherein the mutant retains the ability to bind metal.
  • the transferrin portion of the transferrin fusion protein includes at least two C terminal lobes of transferrin having a mutation in at least one amino acid residue selected from the group consisting of Tyr426, Tyr514, Tyr517 and His585 of SEQ ID NO: 3, wherein the mutant has a reduced ability to bind metal.
  • the transferrin portion of the transferrin fusion protein includes at least two C terminal lobes of transferrin having a mutation in at least one amino acid residue selected from the group consisting of Asp392, Tyr426, Tyr517 and His585 of SEQ ID NO:3, wherein the mutant does not retain the ability to bind metal and functions substantially like an N domain.
  • the Tf or Tf portion will be of sufficient length to increase the serum stability, in vitro solution stability or bioavailability of the therapeutic protein or peptide or soluble toxin receptor compared to the serum stability (half-life), in vitro stability or bioavailability of therapeutic protein or peptide or soluble toxin receptor in an unfused state.
  • Such an increase in stability, serum half-life or bioavailability may be about a 30%, 50%, 70%, 80%, 90% or more increase over the unfused therapeutic protein or peptide or soluble toxin receptor.
  • the transferrin fusion proteins comprising modified transferrin exhibit a serum half-life of about 10-20 or more days, about 12-18 days or about 14-17 days.
  • the two N-linked glycosylation sites, amino acid residues corresponding to N413 and N611 of SEQ ID NO:3 may be mutated for expression in a yeast system to prevent glycosylation or hypermannosylationn and extend the serum half-life of the fusion protein and/or therapeutic protein or peptide or soluble toxin receptor (to produce asialo-, or in some instances, monosialo-Tf or disialo-Tf).
  • mutations may be to the adjacent residues within the N-X-S/T glycosylation site to prevent or substantially reduce glycosylation. See U.S. Pat.
  • the transferrin fusion protein includes a modified transferrin molecule wherein the transferrin exhibits reduced glycosylation, including but not limited to asialo- monosialo- and disialo-forms of Tf.
  • the transferrin portion of the transferrin fusion protein includes a recombinant transferrin mutant that is mutated to prevent glycosylation.
  • the transferrin portion of the transferrin fusion protein includes a recombinant transferrin mutant that is fully glycosylated.
  • the transferrin portion of the transferrin fusion protein includes a recombinant human serum transferrin mutant that is mutated to prevent glycosylation, wherein at least one of Asn413 and Asn61 1 of SEQ ID NO:3 are mutated to an amino acid which does not allow glycosylation.
  • the transferrin portion of the transferrin fusion protein includes a recombinant human serum transferrin mutant that is mutated to prevent or substantially reduce glycosylation, wherein mutations may be to the adjacent residues within the N-X-S/T glycosylation site.
  • modified Tf fusion proteins of the invention may also be engineered to not bind iron and/or not bind the Tf receptor.
  • the iron binding is retained and the iron binding ability of Tf may be used in two ways, one to deliver a therapeutic protein or peptide(s) to the inside of a cell and/or across the BBB.
  • These embodiments that bind iron and/or the Tf receptor will often be engineered to reduce or prevent glycosylation to extend the serum half-life of the therapeutic protein.
  • the N domain alone will not bind to TfR when loaded with iron, and the iron bound C domain will bind TfR but not with the same affinity as the whole molecule.
  • the transferrin portion of the transferrin fusion protein includes a recombinant transferrin mutant having a mutation wherein the mutant does not retain the ability to bind metal.
  • the transferrin portion of the transferrin fusion protein includes a recombinant transferrin mutant having a mutation wherein the mutant has a weaker binding avidity for metal than wild-type serum transferrin.
  • the transferrin portion of the transferrin fusion protein includes a recombinant transferrin mutant having a mutation wherein the mutant has a stronger binding avidity for metal than wild-type serum transferrin.
  • the transferrin portion of the transferrin fusion protein includes a recombinant transferrin mutant having a mutation wherein the mutant does not retain the ability to bind to the transferrin receptor.
  • the transferrin portion of the transferrin fusion protein includes a recombinant transferrin mutant having a mutation wherein the mutant has a weaker binding avidity for the transferrin receptor than wild-type serum transferrin.
  • the transferrin portion of the transferrin fusion protein includes a recombinant transferrin mutant having a mutation wherein the mutant has a stronger binding avidity for the transferrin receptor than wild-type serum transferrin.
  • the transferrin portion of the transferrin fusion protein includes a recombinant transferrin mutant having a mutation wherein the mutant does not retain the ability to bind to carbonate.
  • the transferrin portion of the transferrin fusion protein includes a recombinant transferrin mutant having a mutation wherein the mutant has a weaker binding avidity for carbonate than wild-type serum transferrin.
  • the transferrin portion of the transferrin fusion protein includes a recombinant transferrin mutant having a mutation wherein the mutant has a stronger binding avidity for carbonate than wild-type serum transferrin.
  • the transferrin portion of the transferrin fusion protein includes a recombinant human serum transferrin mutant having a mutation in at least one amino acid residue selected from the group consisting of Asp63, Gly65, Tyr95, Tyr188, His249, Asp392, Tyr426, Tyr514, Tyr517 and His585 of SEQ ID NO: 3, wherein the mutant retains the ability to bind metal.
  • a recombinant human serum transferrin mutant having a mutation in at least one amino acid residue selected from the group consisting of Asp63, Gly65, Tyr95, Tyr188, His249, Asp392, Tyr426, Tyr514, Tyr517 and His585 of SEQ ID NO: 3, wherein the mutant has a reduced ability to bind metal.
  • a recombinant human serum transferrin mutant having a mutation in at least one amino acid residue selected from the group consisting of Asp63, Gly65, Tyr95, Tyr188, His249, Asp392, Tyr426, Tyr517 and His585 of SEQ ID NO: 3, wherein the mutant does not retain the ability to bind metal.
  • the transferrin portion of the transferrin fusion protein includes a recombinant human serum transferrin mutant having a mutation at Lys206 or His207 of SEQ ID NO: 3, wherein the mutant has a stronger binding avidity for metal than wild-type human serum transferrin (see U.S. Pat. No. 5,986,067, which is herein incorporated by reference in its entirety).
  • the transferrin portion of the transferrin fusion protein includes a recombinant human serum transferrin mutant having a mutation at Lys206 or His207 of SEQ ID NO: 3, wherein the mutant has a weaker binding avidity for metal than wild-type human serum transferrin.
  • the transferrin portion of the transferrin fusion protein includes a recombinant human serum transferrin mutant having a mutation at Lys206 or His207 of SEQ ID NO:3, wherein the mutant does not bind metal.
  • any available technique may be used to produce the transferrin fusion proteins of the invention, including but not limited to molecular techniques commonly available, for instance, those disclosed in Sambrook et al. Molecular Cloning: A Laboratory Manual, 2nd Ed., Cold Spring Harbor Laboratory Press, 1989.
  • the encoded amino acid changes are preferably of a minor nature, that is, conservative amino acid substitutions, although other, non-conservative, substitutions are contemplated as well, particularly when producing a modified transferrin portion of a Tf fusion protein, e.g., a modified Tf protein exhibiting reduced glycosylation, reduced iron binding and the like.
  • amino acid substitutions small deletions or insertions, typically of one to about 30 amino acids; insertions between transferrin domains; small amino- or carboxyl-terminal extensions, such as an amino-terminal methionine residue, or small linker peptides of less than 50, 40, 30, 20 or 10 residues between transferrin domains or linking a transferrin protein and therapeutic protein or peptide or soluble toxin receptor or a small extension that facilitates purification, such as a poly-histidine tract, an antigenic epitope or a binding domain.
  • conservative amino acid substitutions are substitutions made within the same group such as within the group of basic amino acids (such as arginine, lysine, histidine), acidic amino acids (such as glutamic acid and aspartic acid), polar amino acids (such as glutamine and asparagine), hydrophobic amino acids (such as leucine, isoleucine, valine), aromatic amino acids (such as phenylalanine, tryptophan, tyrosine) and small amino acids (such as glycine, alanine, serine, threonine, methionine).
  • basic amino acids such as arginine, lysine, histidine
  • acidic amino acids such as glutamic acid and aspartic acid
  • polar amino acids such as glutamine and asparagine
  • hydrophobic amino acids such as leucine, isoleucine, valine
  • aromatic amino acids such as phenylalanine, tryptophan, tyrosine
  • small amino acids such as gly
  • Non-conservative substitutions encompass substitutions of amino acids in one group by amino acids in another group.
  • a non-conservative substitution would include the substitution of a polar amino acid for a hydrophobic amino acid.
  • Non-conservative substitutions, deletions and insertions are particularly useful to produce Tf fusion proteins of the invention that exhibit no or reduced binding of iron, no or reduced binding of the fusion protein to the Tf receptor and/or no or reduced glycosylation.
  • Iron binding and/or receptor binding may be reduced or disrupted by mutation, including deletion, substitution or insertion into, amino acid residues corresponding to one or more of Tf N domain residues Asp63, Tyr95, Tyr188, His249 and/or C domain residues Asp 392, Tyr 426, Tyr 514 and/or His 585. Iron binding may also be affected by mutation to amino acids Lys206, Hys207 or Arg632. Carbonate binding may be reduced or disrupted by mutation, including deletion, substitution or insertion into, amino acid residues corresponding to one or more of Tf N domain residues Thr120, Arg124, Ala126, Gly 127 and/or C domain residues Thr 452, Arg 456, Ala 458 and/or Gly 459. A reduction or disruption of carbonate binding may adversely affect iron and/or receptor binding.
  • Binding to the Tf receptor may be reduced or disrupted by mutation, including deletion, substitution or insertion into, amino acid residues corresponding to one or more of Tf N domain residues described above for iron binding.
  • glycosylation may be reduced or prevented by mutation, including deletion, substitution or insertion into, amino acid residues corresponding to one or more of Tf C domain residues around the N-X-S/T sites corresponding to C domain residues N413 and/or N611 (See U.S. Pat. No. 5,986,067).
  • the N413 and/or N611 may be mutated to Glu residues.
  • glycosylation, iron and/or carbonate ions may be stripped from or cleaved off of the fusion protein.
  • available de-glycosylases may be used to cleave glycosylation residues from the fusion protein, in particular the sugar residues attached to the Tf portion
  • yeast deficient in glycosylation enzymes may be used to prevent glycosylation and/or recombinant cells may be grown in the presence of an agent that prevents glycosylation, e.g., tunicamycin.
  • mutations may be made with Tf to alter the three dimensional structure of Tf, such as modifications to the hinge region to prevent Tf folding needed for iron biding and Tf receptor recognition. For instance, mutations may be made in or around N domain amino acid residues 94-96, 245-247 and/or 316-318 as well as C domain amino acid residues 425-427, 581-582 and/or 652-658. In addition, mutations may be made in to or around the flanking regions of these sites to alter Tf structure and function.
  • the transferrin fusion protein can function as a carrier protein to extend the half life or bioavailability of the therapeutic protein as well as in some instances, delivering the therapeutic protein inside a cell and/or across the blood brain barrier.
  • the transferrin fusion protein includes a modified transferrin molecule wherein the transferrin does not retain the ability to cross the blood brain barrier.
  • the transferrin fusion protein includes a modified transferrin molecule wherein the transferrin molecule retains the ability to bind to the transferrin receptor and transport the therapeutic protein or peptide or soluble toxin receptor inside cells.
  • the transferrin fusion protein includes a modified transferrin molecule wherein the transferrin molecule does not retain the ability to bind to the transferrin receptor and transport the therapeutic protein inside cells.
  • the transferrin fusion protein includes a modified transferrin molecule wherein the transferrin molecule retains the ability to bind to the transferrin receptor and transport the therapeutic protein inside cells, but does not retain the ability to cross the blood brain barrier.
  • the transferrin fusion protein includes a modified transferrin molecule wherein the transferrin molecule retains the ability to cross the blood brain barrier, but does not retain the ability to bind to the transferrin receptor and transport the therapeutic protein inside cells.
  • the fusion of proteins of the invention may contain one or more copies of the therapeutic proteins or peptides or soluble toxin receptor attached to the N-terminus and/or the C-terminus of the Tf protein.
  • the therapeutic protein is attached to both the N- and C-terminus of the Tf protein and the fusion protein may contain one or more equivalents of the therapeutic protein on either or both ends of Tf.
  • the therapeutic protein is inserted into known domains of the Tf protein, for instance, into one or more of the loops of Tf (see Ali et al. (1999) J. Biolog. Chem. 274(34):24066-24073).
  • the therapeutic protein may be inserted into all five loops of transferrin to create a pentavalent molecule with increased avidity for the antigen, receptor, or targeting molecule, which the therapeutic protein binds.
  • the therapeutic protein is inserted between the N and C domains of Tf.
  • the therapeutic protein is inserted anywhere in the transferrin molecule.
  • the transferrin fusion protein of the invention may have one modified transferrin-derived region and one therapeutic protein region. Multiple regions of each protein, however, may be used to make a transferrin fusion protein of the invention. Similarly, more than one therapeutic protein may be used to make a transferrin fusion protein of the invention of the invention, thereby producing a multi-functional modified Tf fusion protein.
  • the transferrin fusion protein of the invention contains a therapeutic protein or portion thereof or a soluble toxin receptor fused to a transferrin molecule or portion thereof.
  • the transferrin fusion protein of the inventions contains a therapeutic protein fused to the N terminus of a transferrin molecule.
  • the transferrin fusion protein of the invention contains a therapeutic protein fused to the C terminus of a transferrin molecule.
  • the transferrin fusion protein of the invention contains a transferrin molecule fused to the N terminus of a therapeutic protein.
  • the transferrin fusion protein of the invention contains a transferrin molecule fused to the C terminus of a therapeutic protein.
  • the modified transferrin molecule contains the N terminus of a transferrin molecule fused to what would be the N terminus of a therapeutic protein. In an alternate embodiment, the modified transferrin molecule contains the N terminus of a transferrin molecule fused to the C terminus of a therapeutic protein. In a further alternate embodiment, the modified transferrin molecule contains the C terminus of a transferrin molecule fused to what would be the C terminus of a therapeutic protein. In an alternate embodiment, the modified transferrin molecule contains the C terminus of a transferrin molecule fused to the N terminus of a therapeutic protein.
  • the transferrin fusion protein of the inventions contains a therapeutic protein fused to both the N-terminus and the C-terminus of modified transferrin.
  • the therapeutic proteins fused at the N- and C-termini bind the same therapeutic proteins.
  • the therapeutic proteins fused at the N- and C-termini are different therapeutic proteins.
  • the therapeutic proteins fused to the N- and C-termini bind different therapeutic proteins which may be used to treat or prevent the same disease, disorder, or condition.
  • the therapeutic proteins fused at the N- and C-termini are different therapeutic proteins which may be used to treat or prevent diseases or disorders which are known in the art to commonly occur in patients simultaneously.
  • transferrin fusion protein of the invention may also be produced by inserting the therapeutic protein or peptide of interest (e.g., a therapeutic protein or peptide as disclosed herein, or a fragment or variant thereof) into an internal region of the modified transferrin.
  • therapeutic protein or peptide of interest e.g., a therapeutic protein or peptide as disclosed herein, or a fragment or variant thereof
  • Internal regions of modified transferrin include, but are not limited to, the iron binding sites, the hinge regions, the bicarbonate binding sites, or the receptor binding domain.
  • insertions may be made within any of the surface exposed loop regions, in addition to other areas of Tf. For instance, insertions may be made within the loops comprising Tf amino acids 32-33, 74-75, 256-257, 279-280 and 288-289 (Ali et al., supra) (See FIG.
  • insertions may also be made within other regions of Tf such as the sites for iron and bicarbonate binding, hinge regions, and the receptor binding domain as described in more detail below.
  • the loops in the Tf protein sequence that are amenable to modification/replacement for the insertion of proteins or peptides may also be used for the development of a screenable library of random peptide inserts. Any procedures may be used to produce nucleic acid inserts for the generation of peptide libraries, including available phage and bacterial display systems, prior to cloning into a Tf domain and/or fusion to the ends of Tf.
  • the N-terminus of Tf is free and points away from the body of the molecule. Fusions of proteins or peptides on the N-terminus may therefore be a preferred embodiment. Such fusions may include a linker region, such as but not limited to a poly-glycine stretch, to separate the therapeutic protein from Tf. Attention to the junction between the leader sequence, the choice of leader sequence, and the structure of the mRNA by codon manipulation/optimization (no major stem loops to inhibit ribosome progress) will increase secretion and can be readily accomplished using standard recombinant protein techniques.
  • the C-terminus of Tf appears to be more buried and secured by a disulfide bond 6 amino acids from the C-terminus.
  • the C-terminal amino acid is a proline which, depending on the way that it is orientated, will either point a fusion away or into the body of the molecule.
  • a linker or spacer moiety at the C-terminus may be used in some embodiments of the invention.
  • small molecule therapeutics may be complexed with iron and loaded on a modified transferrin fusion protein for delivery to the inside of cells and across the BBB.
  • a targeting peptide or, for example, a SCA will target the payload to a particular cell type, e.g., a cancer cell.
  • a therapeutic molecule may be used as the fusion partner to Tf according to the methods and compositions of the present invention.
  • a therapeutic molecule is typically a protein or peptide capable of exerting a beneficial biological effect in vitro or in vivo and includes proteins or peptides that exert a beneficial effect in relation to normal homeostasis, physiology or a disease state.
  • Therapeutic molecules do not include, fusion partners commonly used as markers or protein purification aids, such as galactosidases (see for example, U.S. Pat. No. 5, 986, 067 and Aldred et al. (1984) Biochem. Biophys. Res. Commun. 122: 960-965).
  • a beneficial effect as related to a disease state includes any effect that is advantageous to the treated subject, including disease prevention, disease stabilization, the lessening or alleviation of disease symptoms or a modulation, alleviation or cure of the underlying defect to produce an effect beneficial to the treated subject.
  • a modified transferrin fusion protein of the invention includes at least a fragment or variant of a therapeutic protein and at least a fragment or variant of modified serum transferrin, which are associated with one another, preferably by genetic fusion or chemical conjugation.
  • the transferrin fusion protein includes a modified transferrin molecule linked to a neuropharmaceutical agent.
  • the modified transferrin fusion protein includes transferrin at the carboxyl terminus linked to a neuropharmaceutical agent at the amino terminus.
  • the modified transferrin fusion protein includes transferrin at the amino terminus linked to a neuropharmaceutical agent at the carboxy terminus.
  • the neuropharmaceutical agent is either nerve growth factor or ciliary neurotrophic factor.
  • a modified transferrin fusion protein of the invention may contain at least a fragment or variant of a therapeutic protein.
  • the transferrin fusion proteins can contain peptide fragments or peptide variants of proteins or antibodies wherein the variant or fragment retains at least one biological or therapeutic activity.
  • the transferrin fusion proteins can contain therapeutic proteins that can be peptide fragments or peptide variants at least about 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 20, at least 25, at least 30, at least 35, or at least about 40, at least about 50, at least about 55, at least about 60 or at least about 70 or more amino acids in length fused to the N and/or C termini, inserted within, or inserted into a loop of a modified transferrin.
  • the modified transferrin fusion proteins of the present invention may contain one or more peptides. Increasing the number of peptides enhances the function of the peptides fused to transferrin and the function of the entire transferrin fusion protein.
  • the peptides may be used to make a bi- or multi-functional fusion protein by including peptide or protein domains with multiple functions. For instance, a multi-functional fusion protein can be made with a therapeutic protein and a second protein to target the fusion protein to a specific target. Other peptides may be used to induce the immune response of a cellular system, or induce an antiviral, antibacterial, or anti-pathogenic response.
  • the modified transferrin fusion molecules contain a therapeutic protein portion that can be fragments of a therapeutic protein that include the full length protein as well as polypeptides having one or more residues deleted from the amino terminus of the amino acid sequence.
  • the modified transferrin fusion molecules contain a therapeutic protein portion that can be fragments of a therapeutic protein that include the full length protein as well as polypeptides having one or more residues deleted from the carboxy terminus of the amino acid sequence.
  • the modified transferrin fusion molecules contain a therapeutic protein portion that can have one or more amino acids deleted from both the amino and the carboxy termini.
  • the modified transferrin fusion molecules contain a therapeutic protein portion that is at least about 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to a reference therapeutic protein set forth herein, or fragments thereof. In further embodiments, the transferrin fusion molecules contain a therapeutic protein portion that is at least about 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to reference polypeptides having the amino acid sequence of N- and C-terminal deletions as described above.
  • the modified transferrin fusion molecules contain the therapeutic protein portion that is at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100%, identical to, for example, the native or wild-type amino acid sequence of a therapeutic protein. Fragments, of these polypeptides are also provided.
  • the therapeutic proteins corresponding to a therapeutic protein portion of a modified transferrin fusion protein of the invention can be modified by the attachment, of one or more oligosaccharide groups.
  • the modification referred to as glycosylation can significantly affect the physical properties of proteins and can be important in protein stability, secretion, and localization. Glycosylation occurs at specific locations along the polypeptide backbone.
  • glycosylation characterized by O-linked oligosaccharides, which are attached to serine or threonine residues; and glycosylation characterized by N-linked oligosaccharides, which are attached to asparagine residues in an Asn-X-Ser/Thr sequence, where X can be an amino add except proline.
  • Variables such as protein structure and cell type influence the number and nature of the carbohydrate units within the chains at different glycosylation sites.
  • Glycosylation isomers are also common at the same site within a given cell type. For example, several types of human interferon are glycosylated.
  • Therapeutic proteins corresponding to a therapeutic protein portion of a transferrin fusion protein of the invention may be modified so that glycosylation at one or more sites is altered as a result of manipulation(s) of their nucleic acid sequence by the host cell in which they are expressed, or due to other conditions of their expression.
  • glycosylation isomers may be produced by abolishing or introducing glycosylation sites, e.g., by substitution or deletion of amino acid residues, such as substitution of glutamine for asparagine, or unglycosylated recombinant proteins may be produced by expressing the proteins in host cells that will not glycosylate them, e.g. in glycosylation-deficient yeast. These approaches are known in the art.
  • Therapeutic proteins and their nucleic acid sequences are well known in the art and available in public databases such as Chemical Abstracts Services Databases (e.g., the CAS Registry), GenBank, and GenSeq.
  • Chemical Abstracts Services Databases e.g., the CAS Registry
  • GenBank e.g., GenBank
  • GenSeq GenSeq.
  • the Accession Numbers and sequences referred to below are herein incorporated by reference in their entirety.
  • the transferrin fusion proteins of the invention are capable of a therapeutic activity and/or biologic activity, corresponding to the therapeutic activity and/or biologic activity of the therapeutic protein described elsewhere in this application.
  • the therapeutically active protein portions of the transferrin fusion proteins of the invention are fragments or variants of the reference sequences cited herein.
  • the present invention is further directed to modified Tf fusion proteins comprising fragments of the therapeutic proteins herein described. Even if deletion of one or more amino acids from the N-terminus of a protein results in modification or loss of one or more biological functions of the therapeutic protein portion, other therapeutic activities and/or functional activities (e.g., biological activities, ability to multimerize, ability to bind a ligand) may still be retained. For example, the ability of polypeptides with N-terminal deletions to induce and/or bind to antibodies which recognize the complete or mature forms of the polypeptides generally will be retained with less than the majority of the residues of the complete polypeptide removed from the N-terminus.
  • other therapeutic activities and/or functional activities e.g., biological activities, ability to multimerize, ability to bind a ligand
  • deletion of one or more amino acids from the N-terminus or C-terminus of a therapeutic protein results in modification or loss of one or more biological functions of the protein
  • other functional activities e.g., biological activities, ability to multimerize, ability to bind a ligand
  • therapeutic activities e.g., biological activities, ability to multimerize, ability to bind a ligand
  • therapeutic activities e.g., biological activities, ability to multimerize, ability to bind a ligand
  • therapeutic activities e.g., biological activities, ability to multimerize, ability to bind a ligand
  • the ability of polypeptides with C-terminal deletions to induce and/or bind to antibodies which recognize the complete or mature forms of the polypeptide generally will be retained when less than the majority of the residues of the complete or mature polypeptide are removed from the C-terminus.
  • C-terminal residues of a reference polypeptide retains therapeutic activity can readily be determined by routine methods described herein and/or otherwise known in the art
  • Peptide fragments of the therapeutic proteins can be fragments comprising, or alternatively, consisting of, an amino acid sequence that displays a therapeutic activity and/or functional activity (e.g. biological activity) of the polypeptide sequence of the therapeutic protein of which the amino acid sequence is a fragment.
  • polypeptide fragments are biologically active fragments.
  • Biologically active fragments are those exhibiting activity similar, but not necessarily identical, to an activity of a therapeutic protein used in the present invention.
  • the biological activity of the fragments may include an improved desired activity, or a decreased undesirable activity.
  • variants of proteins are overall very similar, and, in many regions, identical to the amino acid sequence of the therapeutic protein corresponding to a therapeutic protein portion of a transferrin fusion protein of the invention. Nucleic acids encoding these variants are also encompassed by the invention.
  • a polypeptide-having an amino acid sequence at least, for example, 95% “identical” to a query amino acid sequence of the present invention it is intended that the amino acid sequence of the subject polypeptide is identical to the query sequence except that the subject polypeptide sequence may include up to five amino acid alterations per each 100 amino acids of the query amino acid sequence.
  • the subject polypeptide sequence may include up to five amino acid alterations per each 100 amino acids of the query amino acid sequence.
  • up to 5% of the amino acid residues in the subject sequence may be inserted, deleted, or substituted with another amino acid.
  • These alterations of the reference sequence may occur at the amino- or carboxy-terminal positions of the reference amino acid sequence or anywhere between those terminal positions, interspersed either individually among residues in the reference sequence, or in one or more contiguous groups within the reference sequence.
  • any particular polypeptide is at least about 80%, 85%, 90%,95%, 96%, 97%, 98% or 99% identical to, for instance, the amino acid sequence of a transferrin fusion protein of the invention or a fragment thereof (such, as the therapeutic protein portion of the transferrin fusion protein or the transferrin portion of the transferrin fusion protein), can be determined conventionally using known computer programs.
  • a preferred method for determining the best overall match between a query sequence (a sequence of the present invention) and a subject sequence also referred to as a global sequence alignment, can be determined using the FASTDB computer program based on the algorithm of Brufiag-et al. (Comp. App. Biosci 245- (1990)).
  • polynucleotide variants of the invention may contain alterations in the coding regions, non-coding regions, or both.
  • Polynucleotide variants containing alterations which produce silent substitutions, additions, or deletions, but do not alter the properties or activities of the encoded polypeptide may be used to produce modified Tf fusion proteins.
  • Nucleotide variants produced by silent substitutions due to the degeneracy of the genetic code can be utilized.
  • polypeptide variants in which less than about 50, less than 40, less than 30, less than 20, less than 10, or 5-50, 5-25, 5-10, 1-5, or 1-2 amino acids are substituted, deleted, or added in any combination can also be utilized.
  • Polynucleotide variants can be produced for a variety of reasons, e.g., to optimize codon expression for a particular host (change codons in the human mRNA to those preferred by a host, such as, yeast or E. coli as described above).
  • the therapeutic protein moiety has conservative substitutions compared to the wild-type sequence.
  • conservative substitutions is intended swaps within groups such as replacement of the aliphatic or hydrophobic amino acids Ala, Val, Leu and Ile; replacement of the hydroxyl residues Ser and Thr; replacement of the acidic residues Asp and Glu; replacement of the amide residues Asn and Gln, replacement of the basic residues Lys, Arg, and His; replacement of the aromatic residues Phe, Tyr, and Trp, and replacement of the small-sized amino acids Ala, Ser, Thr, Met, and Gly.
  • the polypeptides of the invention comprise, or alternatively, consist of, fragments or variants of the amino acid sequence of a therapeutic protein described herein and/or serum transferrin, and/ modified transferrin protein of the invention, wherein the fragments or variants have 1-5, 5-10, 5-25, 5-50, 10-50 or 50-150 amino acid residue additions, substitutions, and/or deletions when compared to the reference amino acid sequence.
  • the amino acid substitutions are conservative. Nucleic acids encoding these polypeptides are also encompassed by the invention.
  • the modified fusion proteins of the present invention can be composed of amino-acids joined to each other by peptide bonds or modified peptide bonds and may contain amino acids other than the 20 gene-encoded amino acids.
  • the polypeptides may be modified by either natural processes, such as post-translational processing, or by chemical modification techniques which are well known in the art. Such modifications are well described in basic texts and in more detailed monographs, as well as in a voluminous research literature.
  • Modifications can occur anywhere in a polypeptide, including the peptide backbone, the amino acid side-chains and the amino or carboxy termini. It will be appreciated that the same type of modification may be present in the same or varying degrees at several sites in a given polypeptide. Also, a given polypeptide may contain many types of modifications. Polypeptides may be branched, for example, as a result of ubiquitination, and they may be cyclic, with or without branching. Cyclic, branched, and branched cyclic polypeptides may result from posttranslation natural processes or may be made by synthetic methods.
  • Modifications include acetylation, acylation, ADP-ribosylation, amidation, covalent attachment of flavin, covalent attachment of a heme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid or lipid derivative, covalent attachment of phosphotidylinositol, cross-linking, cyclization, disulfide bond formation, demethylation, formation of covalent cross-links, formation of cysteine, glycosylation, GPI anchor formation, hydroxylation, iodination, methylation, myristylation, oxidation, pegylation, proteolytic processing, phosphorylation, prenylation, racemization, sulfation, transfer-RNA mediated addition of amino acids to proteins such as arginylaltion, and ubiquitination.
  • the therapeutic proteins of the present invention include, but are not limited to polypeptide, peptide, antibody, or fragments and variants thereof.
  • the therapeutic proteins of the present invention include ⁇ -interferon ( ⁇ -IFN), glucagon-like peptide-1 (GLP-1), EPO mimetic peptide (EMP-1), T-20, and soluble toxin receptor, such as synaptotagmin I.
  • cytokines including ⁇ -IFN
  • ⁇ -IFN have relatively short circulation half-lives since they are produced in vivo to act locally and transiently.
  • the present invention provides ⁇ -IFN/transferrin fusion proteins with increased half-lives and pharmaceutical compositions comprising such fusion proteins with increased stability. Such fusion proteins can be administered to patients at lower doses, thus reducing the toxic side effects associated with ⁇ -IFN.
  • the present invention contemplates the use of the ⁇ -IFN/transferrin fusion proteins to treat various diseases and conditions associated with ⁇ -IFN, such as but not limited to multiple sclerosis, cancer including brain tumors and skin cancer, and viral infections such as hepatitis B and C.
  • the ⁇ -IFN/transferrin fusion proteins are used to treat subjects suffering from multiple sclerosis.
  • ⁇ -interferon is a glycoprotein with an apparent molecular weight (MW) of 23 kilodaltons.
  • the gene encoding ⁇ -IFN is located on chromosome 9. Its amino acid sequence containing 166 residues was determined by K. Hosoi et al. (J. Interferon Res., 8, pp 375-384 (1988)), and its glucoside sequence was reported by Y. Kagawa et al. (J. Biol. Chem., 263, pp 17508-17515 (1988)).
  • ⁇ -IFN is secreted by fibroblasts in response to a viral or bacterial infection, or exposure to foreign cells, macromolecules, or RNA.
  • ⁇ -IFN inhibits the proliferation of infected cells and stimulates the immune system.
  • the specific antiviral activity of homogeneous Hu- ⁇ -IFN is considered to be between 3 ⁇ 10 8 and 1 ⁇ 10 9 iu/mg (international units per milligram of total protein) inclusive (see U.S. Pat. No. 4,289,689 and EP-A-94 672).
  • Interferon-beta (IFN- ⁇ ) or “beta-interferon” ( ⁇ -IFN) includes native and recombinant Type I interferons exhibiting the same or similar pharmaceutical characteristics as the Type I interferons commonly known as IFN- ⁇ -1a and IFN- ⁇ -1b.
  • any ⁇ -IFN sequence may be used to prepare Tf fusion proteins of the present invention.
  • U.S. Pat. No. 4,738,931 discloses the human ⁇ -IFN gene derived from human chromosomal DNA.
  • a 1.8 Kb EcoRI fragment, containing the nucleic acid encoding the human ⁇ -IFN, introduced into Escherichia coli has been deposited with the American Type Culture Collection in U.S.A. as Escherichia coli CI4 under accession number ATCC 31905.
  • the GenBank accession number for the amino acid sequence of Human ⁇ -IFN amino acid sequence is AAA72588.
  • the ⁇ -IFN could also be a mutein as described in U.S. Pat. No.
  • ⁇ -IFN is regarded as an active principle not only in the treatment and prophylaxis of viral diseases such as herpes, influenza etc, but also in the treatment of tumoral conditions such as encephaloma and leukemia.
  • ⁇ -IFN is used to treat multiple sclerosis, brain tumor, skin cancer and hepatitis B and C.
  • ⁇ -IFN fusion proteins of the present invention may be used to treat any of these diseases.
  • Human ⁇ -IFN is also effective in treating coronary restenosis in humans by selectively inhibiting the proliferation of coronary smooth muscle cell at the site of vascular injury following a surgical procedure while having no inhibitory effect on the normal proliferation of coronary endothelial cells following the procedure.
  • U.S. Pat. No. 5,681,558 discloses a method of treating restenosis comprising administering ⁇ -IFN to the patient. Accordingly, ⁇ -IFN fusion proteins of the present invention may be used to treat restenosis.
  • ⁇ -IFN has an erythropoietic effect on the growth of progenitor cells from individuals suffering from several diseases with a very low production of red blood cells. Additionally, ⁇ -IFN increases burst formation as well as promotes a more rapid maturation toward normoblasts and even late reticulocytes.
  • U.S. Pat. No. 5,104,653 discloses a method for the stimulation of erythropoiesis in a patient suffering from a disorder characterized by lack of maturation of progenitor blood cells to red blood cells comprising administering to said patient an erythropoietic effective amount of human ⁇ -IFN. Therefore, ⁇ -IFN fusion proteins of the present invention may be used to stimulate erythropoiesis.
  • ⁇ -IFN acting via STAT1 and STAT2
  • STAT1 and STAT2 is known to upregulate and downregulate a wide variety of genes, most of which are involved in the antiviral immune response.
  • IFN responses are induced by the presence of dsRNA, both DNA and RNA viruses are sensitive to the effects of ⁇ -IFN (Biron, Seminars in Immunology, 10: 383-390 (1998)).
  • ⁇ -IFN is generally produced in response to a viral infection.
  • Interferon ⁇ -IFN exerts its biological effects by binding to specific receptors on the surface of human cells. This binding initiates a complex cascade of intracellular events that leads to the expression of numerous interferon-induced gene products and markers, for example, 2′, 5′-oligoadenylate synthetase, b 2 -microglobulin, and neopterin.
  • (2′-5′)-Oligoadenylate synthetase and dsRNA dependent protein kinase are the two best-known IFN- ⁇ -induced proteins (Biron, 1998, supra).
  • (2′-5′)-oligoadenylate synthetase polymerizes ATP in a unique 2′-5′ fashion (Janeway et al., Immunobiology: The Immune System in Health and Disease, 4th Edition, New York, Elsevier Science/Garland Publishing pp 385-386(1999)); the resultant oligomers activate RNase L, which cleaves mRNA (Biron, 1998, supra).
  • dsRNA dependent protein kinase phosphorylates and inactivates elF2, a transcriptional initiator.
  • Both (2′-5′)-oligoadenylate synthetase and dsRNA dependent protein kinase act only in the presence of dsRNA, i.e. in virally infected cells. The net result of the action of these two proteins is to inhibit protein translation, which will retard viral replication (Biron, 1998, supra).
  • TAP transporter associated with antigen processing
  • Lmp2 Lmp7 serves to increase presentation of viral peptides by MHC class I molecules in order to facilitate CD8 T cell recognition and destruction of infected cells.
  • TAP is the molecule responsible for loading peptide fragments onto MHC class I molecules in the ER; the Lmp proteins are components of the proteasome which cleave proteins specifically for MHC class I presentation (Janeway et al., 1999, supra).
  • ⁇ -IFN natural killer cells
  • NK natural killer cells
  • interferons themselves are not mitogens.
  • the proliferation of NK cells is probably caused by an intermediary cytokine which is induced by IFN- ⁇ (Biron, 1998, supra).
  • NK cells can kill cells which exhibit atypical patterns of MHC class I expression; such cells are generally virally infected (Janeway et al., 1999, supra).
  • T cells die by apoptosis as the immune system returns to a homeostatic balance, some T cells must avoid apoptosis and enter a G 0 /G 1 memory state to preserve immunological memory. These memory T cells are rescued from apoptosis by interacting with stromal cells, which secrete ⁇ -IFN and some IFN- ⁇ (Pilling et al., European Journal of Immunology 29:1041-1050 (1999)). T cell apoptosis may be induced by either cytokine deprivation or ligation of Fas on the cell surface, but ⁇ -IFN is able to block both apoptotic pathways.
  • ⁇ -IFN increased transcription of well over 100 proteins in human fibrosarcoma cells. Induced proteins ranged in function from cytochromes and cell scaffolding proteins to immunologically active proteins such as Complement components and dsRNA adenosine deaminase. These results indicate that ⁇ -IFN has truly pleiotropic effects, many of which are not fully understood.
  • MS multiple sclerosis
  • ⁇ -IFN 1b is a non-glycosylated form of IFN- ⁇ produced by E. coli (Arduini et al., Protein Science 8: 1867-1877(1999)).
  • Adverse experiences associated with ⁇ -IFN 1b therapy include: injection site reactions (inflammation, pain, hypersensitivity and necrosis), and a flu-like symptom complex (fever, chills, anxiety and confusion). These adverse side effects may be, in fact, reduced or alleviated by fusing ⁇ -IFN 1b to transferrin as described above.
  • ⁇ -IFN 1a (a eukaryotic, glycosylated form obtained from hamsters) is also available (Goodkin, 1999, supra).
  • ⁇ -IFN 1a is produced by recombinant DNA technology.
  • Interferon beta-la is a 166 amino acid glycoprotein with a predicted molecular weight of approximately 22,500 daltons. It is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human IFN- ⁇ gene has been introduced.
  • the amino acid sequence of ⁇ -IFN 1a is identical to that of natural human ⁇ -IFN and may be used to make Tf fusion proteins of the present invention.
  • ⁇ -IFN/transferrin fusion proteins treatment may also ameliorate autoimmune attacks by restoring suppressor T cell function; cotreatment with all-trans-retinoic acid seems to increase this restorative action for unknown reasons (Qu et al., 1998. All-trans retinoic acid potentiates the ability of interferon beta-lb. ⁇ http://members.tripod.com/ ⁇ ThJuland/ra-beta1b.html>).
  • ⁇ -IFN may also inhibit the induction of inducible nitric oxide synthase (INOS) expression by IL-1 and IFN- 65 .
  • IOS inducible nitric oxide synthase
  • Beta inteferon prevents nitric oxide/peroxynitrate from damaging the central nervous system. ( ⁇ http://members.tripod.com/ ⁇ ThJuland/nitric-oxide_beta.html>).
  • the present invention includes the use of ⁇ -IFN analogs that are therapeutically effective for treating various diseases associated with ⁇ -IFN for generating ⁇ -IFN/transferrin fusion proteins.
  • the present invention includes the use of the ⁇ -IFN/transferrin fusion protein in the methods described above to inhibit or stimulate various cellular processes and for the treatment and prevention of the various disease and conditions described above.
  • the ⁇ -IFN/transferrin fusion protein may be used to treat multiple sclerosis, herpes, influenza, brain tumor, and skin cancer.
  • the ⁇ -IFN/transferrin fusion protein of the present invention can be formulated into pharmaceutical compositions by well known methods. See, e.g., Remington's Pharmaceutical Sciences by E. W. Martin, hereby incorporated by reference, describes suitable formulations.
  • the pharmaceutical composition of the ⁇ -IFN/transferrin fusion protein of the present invention may be formulated in a variety of forms, including liquid, gel, lyophilized, or any other suitable form. The preferred form will depend upon the particular indication being treated and will be apparent to one of skill in the art.
  • the ⁇ -IFN/transferrin fusion protein can be administered in pure form or in an appropriate pharmaceutical composition. Administration can be carried out via any of the accepted modes. Thus, administration can be, for example, orally, nasally, parenterally, topically, transdermally, or rectally, in the form of solid, semi-solid, lyophilized powder, or liquid dosage forms, such as for example, tablets, suppositories, pills, soft elastic and hard gelatin capsules, powders, solutions, suspensions, or aerosols, or the like, preferably in unit dosage forms suitable for simple administration of precise dosages.
  • the compositions will include a conventional pharmaceutical carrier or excipient and the ⁇ -IFN/transferrin fusion protein as the active agent, and, in addition, may include other medicinal agents, pharmaceutical agents, carriers, adjuvants, etc.
  • the pharmaceutically acceptable compositions will contain about 1% to about 99% by weight of the ⁇ -IFN /transferrin fusion protein, and 99% to 1 % by weight of a suitable pharmaceutical excipient.
  • the composition could be about 5% to 75% by weight of the ⁇ -IFN/transferrin fusion protein with the rest being suitable pharmaceutical excipients.
  • the route of administration could be parenterally, using a convenient daily dosage regimen which can be adjusted according to the degree of severity of the disease, preferably multiple sclerosis, to be treated.
  • a pharmaceutically acceptable composition containing the ⁇ -IFN/transferrin fusion protein may be formed by the methods disclosed in U.S. Pat. Nos. 4,462,940, 4,588,585 and 4,992,271.
  • the ⁇ -IFN/transferrin fusion protein pharmaceutical compositions may be administered orally, intravenously, intramuscularly, intraperitoneally, intradermally or subcutaneously or in any other acceptable manner.
  • the preferred mode of administration will depend upon the particular indication being treated and will be apparent to one of skill in the art.
  • U.S. Pat. No. 6,333,032 describes effective methods of using ⁇ -IFN to treat diseases in warm-blooded vertebrates, such as multiple sclerosis.
  • Treatment of multiple sclerosis comprises administering ⁇ -IFN at a dosage of 0.01 to about 5 IU/lb per day in a dosage form adapted to promote contact of said dosage of interferon with the oral and pharyngeal mucosa of said animal.
  • the dosage of interferon could be from 0.1 to about 4.0 IU/lb per day, or from 0.5 to about 1.5 IU/lb of body weight per day.
  • the present invention contemplates administering the ⁇ -IFN in a dosage form adapted to assure maximum contact of the interferon in said dosage form with the oral and pharyngeal mucosa of the human or animal undergoing treatment.
  • Contact of interferon with the mucosa can be enhanced by maximizing residence time of the treatment solution in the oral or pharyngeal cavity.
  • best results seem to be achieved in human patients when the patient is requested to hold said solution of interferon in the mouth for a period of time.
  • Contact of interferon with the oral and pharyngeal mucosa and thereafter with the lymphatic system of the treated human or animal is unquestionably the most efficient method administering immunotherapeutic amounts of interferon.
  • the present invention contemplates the use of the ⁇ -IFN/transferrin protein for the manufacture of a medicament which is useful for the treatment of diseases associated with ⁇ -IFN.
  • the diseases contemplated by the present invention include but are not limited to those described above.
  • Glucagon-Like Peptide-1 (GLP-1) is a gastrointestinal hormone that regulates insulin secretion belonging to the so-called enteroinsular axis.
  • the enteroinsular axis designates a group of hormones, released from the gastrointestinal mucosa in response to the presence and absorption of nutrients in the gut, which promote an early and potentiated release of insulin.
  • the incretin effect which is the enhancing effect on insulin secretion is probably essential for a normal glucose tolerance.
  • GLP-1 is a physiologically important insulinotropic hormone because it is responsible for the incretin effect.
  • GLP-1 is a product of proglucagon (Bell, et al., Nature, 1983, 304: 368-371). It is synthesized in intestinal endocrine cells in two principal major molecular forms, as GLP-1(7-36)amide and GLP-1(7-37). The peptide was first identified following the cloning of cDNAs and genes for proglucagon in the early 1980s.
  • GLP-1 The amino acid sequence of GLP-1 is disclosed by Schmidt et al. (1985 Diabetologia 28 704-707).
  • Human GLP-1 is a 37 amino acid residue peptide originating from preproglucagon which is synthesized in the L-cells in the distal ileum, in the pancreas, and in the brain. Processing of preproglucagon to GLP-1(7-36)amide, GLP-1(7-37) and GLP-2 occurs mainly in the L-cells.
  • GLP-1(7-36) and GLP-1(7-37) is (SEQ ID NO: 6): His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser- Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala- Trp-Leu-Val-Lys-Gly-Arg-X wherein X is NH 2 for GLP-1 (7-36) and X is Gly for GLP-1 (7-37).
  • GLP-1 like molecules possesses anti-diabetic activity in human subjects suffering from Type II (non-insulin-dependent diabetes mellitus (NIDDM)) and, in some cases, even Type I diabetes.
  • Treatment with GLP-1 elicits activity, such as increased insulin secretion and biosynthesis, reduced glucagon secretion, delayed gastric emptying, only at elevated glucose levels, and thus provides a potentially much safer therapy than insulin or sulfonylureas.
  • Post-prandial and glucose levels in patients can be moved toward normal levels with proper GLP-1 therapy.
  • GLP-1-like molecules possess the ability to preserve and even restore pancreatic beta cell function in Type-II patients.
  • GLP-1 sequence may be used to make Tf fusion proteins of the present invention, including GLP-1(7-35), GLP-1(7-36), and GLP-1(7-37).
  • GLP-1 also has powerful actions on the gastrointestinal tract. Infused in physiological amounts, GLP-1 potently inhibits pentagastrin-induced as well as meal-induced gastric acid secretion (Schjoldager et al., Dig. Dis. Sci. 1989, 35:703-708; Wettergren et al., Dig Dis Sci 1993; 38:665-673). It also inhibits gastric emptying rate and pancreatic enzyme secretion (Wettergren et al., Dig Dis Sci 1993; 38:665-673).
  • GLP-1 seems to have an effect on food intake. Intraventricular administration of GLP-1 profoundly inhibits food intake in rats (Schick et al. in Ditschuneit et al. (eds.), Obesity in Europe, John Libbey & Company ltd, 1994; pp. 363-367; Turton et al., Nature 1996, 379: 69-72). This effect seems to be highly specific.
  • N-terminally extended GLP-1(PG 72-107) amide is inactive and appropriate doses of the GLP-1 antagonist, exendin 9-39, abolish the effects of GLP-I(Tang-Christensen et al., Am. J.
  • GLP-1 secreted from the intestinal L-cells may also act as a satiety signal.
  • GLP's insulinotropic effects and the effects of GLP-1 on the gastrointestinal tract are preserved (Willms et al, Diabetologia 1994; 37, suppl. 1: A118), which may help curtail meal-induced glucose excursions, but, more importantly, may also influence food intake.
  • Administered intravenously, continuously for one week, GLP-1 at 4 ng/kg/min has been demonstrated to dramatically improve glycaemic control in NIDDM patients without significant side effects (Larsen et al., Diabetes 1996; 45, suppl. 2: 233A.).
  • GLP-1/transferrin fusion proteins comprising at least one analog of GLP-1 and fragments thereof are useful in the treatment of Type 1 and Type 2 diabetes and obesity.
  • GLP-1 molecule means GLP-1, a GLP-1 analog, or GLP-1 derivative.
  • GLP-1 analog is defined as a molecule having one or more amino acid substitutions, deletions, inversions, or additions compared with GLP-1.
  • Many GLP-1 analogs are known in the art and include, for example, GLP-1(7-34), GLP-1(7-35), GLP-1(7-36), Val 8 -GLP-1(7-37), Gln 9 -GLP1(7-37), D-Gln 9 -GLP-1(7-37), Thr 16 -Lys 18 -GLP-1(7-37), and Lys 18 -GLP-1(7-37).
  • U.S. Pat. No. 5,118,666 discloses examples of GLP-1 analogs such as GLP-1(7-34) and GLP-1(7-35).
  • GLP-1 derivative is defined as a molecule having the amino acid sequence of GLP-1 or a GLP-1 analog, but additionally having chemical modification of one or more of its amino acid side groups, ⁇ -carbon atoms, terminal amino group, or terminal carboxylic acid group.
  • a chemical modification includes, but is not limited to, adding chemical moieties, creating new bonds, and removing chemical moieties.
  • GLP-1 related compound refers to any compound falling within the GLP-1, GLP-1 analog, or GLP-1 derivative definition.
  • WO 91/11457 discloses analogs of the active GLP-1 peptides 7-34, 7-35, 7-36, and 7-37 which can also be useful as GLP-1 moieties.
  • EP 0708179-A2 (Eli Lilly & Co.) discloses GLP-1 analogs and derivatives that include an N-terminal imidazole group and optionally an unbranched C 6 -C 10 acyl group in attached to the lysine residue in position 34.
  • EP 0699686-A2 (Eli Lilly & Co.) discloses certain N-terminal truncated fragments of GLP-1 that are reported to be biologically active.
  • U.S. Pat. No. 5,545,618 discloses GLP-1 molecules consisting essentially of GLP-1(7-34), GLP1(7-35), GLP-1(7-36), or GLP-1(7-37), or the amide forms thereof, and pharmaceutically-acceptable salts thereof, having at least one modification selected from the group consisting of: (a) substitution of glycine, serine, cysteine, threonine, asparagine, glutamine, tyrosine, alanine, valine, isoleucine, leucine, methionine, phenylalanine, arginine, or D-lysine for lysine at position 26 and/or position 34; or substitution of glycine, serine, cysteine, threonine, asparagine, glutamine, tyrosine, alanine, valine, isoleucine, leucine, methionine, phenylalanine, lysine, or a D-
  • U.S. Pat. No. 5,118,666 discloses a GLP-1 molecule having insulinotropic activity.
  • Such molecule is selected from the group consisting of a peptide having the amino acid sequence His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys (SEQ ID NO: 7) or His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly (SEQ ID NO: 8); and a derivative of said peptide and wherein said peptide is selected from the group
  • U.S. Pat. No. 6,277,819 teaches a method of reducing mortality and morbidity after myocardial infarction comprising administering GLP-1, GLP-1 analogs, and GLP-1 derivatives to the patient.
  • the GLP-1 analog being represented by the following structural formula (SEQ ID NO: 9): R 1 -X 1 -Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-X 2 -Gly-Gln-Ala-Ala-Lys- X 3 -Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-R 2 and pharmaceutically-acceptable salts thereof, wherein: R 1 is selected from the group consisting of L-histidine, D-histidine, desamino-histidine, 2-amino-histidine, .beta.-hydroxy-histidine, homohistidine, alpha-flu
  • GLP-1 treatment after acute stroke or hemorrhage can be an ideal treatment because it provides a means for optimizing insulin secretion, increasing brain anabolism, enhancing insulin effectiveness by suppressing glucagon, and maintaining euglycemia or mild hypoglycemia with no risk of severe hypoglycemia or other adverse side effects.
  • the present invention provides a method of treating the ischemic or reperfused brain with GLP-1 or its biologically active analogues after acute stroke or hemorrhage to optimize insulin secretion, to enhance insulin effectiveness by suppressing glucagon antagonism, and to maintain euglycemia or mild hypoglycemia with no risk of severe hypoglycemia.
  • U.S. Pat. No. 6,277,819 provides a method of reducing mortality and morbidity after myocardial infraction, comprising administering to a patient in need thereof, a compound selected from the group consisting of GLP-1, GLP-1 analogs, GLP-1 derivatives and pharmaceutically-acceptable salts thereof, at a dose effective to normalize blood glucose.
  • U.S. Pat. No. 6,191,102 discloses a method of reducing body weight in a subject in need of body weight reduction by administering to the subject a composition comprising a glucagon-like peptide-1 (GLP-1), a glucagon-like peptide analog (GLP-1 analog), a glucagon-like peptide derivative (GLP-1 derivative) or a pharmaceutically acceptable salt thereof in a dose sufficient to cause reduction in body weight for a period of time effective to produce weight loss, said time being at least 4 weeks.
  • GLP-1 glucagon-like peptide-1
  • GLP-1 analog glucagon-like peptide analog
  • GLP-1 derivative a glucagon-like peptide derivative
  • GLP-1 is fully active after subcutaneous administration (Ritzel et al., Diabetologia 1995; 38: 720-725), but is rapidly degraded mainly due to degradation by dipeptidyl peptidase IV-like enzymes (Deacon et al., J Clin Endocrinol Metab 1995, 80: 952-957; Deacon et al., 1995, Diabetes 44: 1126-1131).
  • GL-1 and many of its analogues have a short plasma half-life in humans (Orskov et al., Diabetes 1993; 42:658-661).
  • transferrin fusion proteins comprising GLP-1 or analogues thereof which have a protracted profile of action relative to GLP-1(7-37). It is a further object of the invention to provide derivatives of GLP-1 and analogues thereof which have a lower clearance than GLP-1(7-37). Moreover, it is an object of the invention to provide pharmaceutical compositions comprising GLP-1/transferrin fusion proteins or GLP-1 analog/transferrin fusion proteins with improved stability. Additionally, the present invention includes the use of GLP-1/transferrin fusion proteins or GLP-1 analog/transferrin fusion proteins to treat diseases associated with GLP-1 such as but not limited to those described above.
  • the pharmaceutical compositions comprising the GL-1 peptide/transferrin fusion proteins and GLP-1 analog/transferrin fusion proteins may be formulated by any of the established methods of formulating pharmaceutical compositions, e.g. as described in Remington's Pharmaceutical Sciences, 1985.
  • the composition may be in a form suited for systemic injection or infusion and may, as such, be formulated with a suitable liquid vehicle such as sterile water or an isotonic saline or glucose solution.
  • the compositions may be sterilized by conventional sterilization techniques which are well known in the art.
  • the resulting aqueous solutions may be packaged for use or filtered under aseptic conditions and lyophilized, the lyophilized preparation being combined with the sterile aqueous solution prior to administration.
  • the composition may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions, such as buffering agents, tonicity adjusting agents and the like, for instance sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, etc.
  • the GLP-1/transferrin fusion proteins and GLP-1 analog/transferrin fusion proteins of the present invention may also be adapted for nasal, transdermal, pulmonal or rectal administration.
  • the pharmaceutically acceptable carrier or diluent employed in the composition may be any conventional solid carrier. Examples of solid carriers are lactose, terra alba, sucrose, talc, gelatin, agar, pectin, acacia, magnesium stearate and stearic acid. Similarly, the carrier or diluent may include any sustained release material known in the art, such as glyceryl monostearate or glyceryl distearate, alone or mixed with a wax.
  • composition of the invention in the form of a sustained release formulation.
  • the composition may be formulated as microcapsules or microparticles containing the GLP-1/transferrin fusion protein or GLP-1 analog/transferrin fusion protein encapsulated by or dispersed in a suitable pharmaceutically acceptable biodegradable polymer such as polylactic acid, polyglycolic acid or a lactic acid/glycolic acid copolymer.
  • the preparation may contain GLP-1/transferrin fusion proteins or GLP-1 analog/transferrin fusion proteins dissolved or suspended in a liquid carrier, in particular an aqueous carrier, for aerosol application.
  • the carrier may contain additives such as solubilizing agents, e.g. propylene glycol, surfactants, absorption enhancers such as lecithin (phosphatidylcholine) or cyclodextrin, or preservatives such as parabenes.
  • the compounds of the present invention are dispensed in unit dosage form comprising 0.5-500 mg of the fusion protein together with a pharmaceutically acceptable carrier per unit dosage.
  • the present invention contemplates the use of the GLP-1/transferrin and GLP-1 analog/transferrin fusion proteins for the manufacture of a medicinal product which can be used in the treatment of diseases associated with elevated glucose level, such as but not to limited to those described above.
  • the present invention contemplates the use of GLP-1/transferrin fusion protein for the treatment of diabetes including type II diabetes, obesity, severe bums, and heart failure, including congestive heart failure and acute coronary syndrome.
  • the N-terminus of GLP-1 is normally amidated. In yeast, amidation does not occur.
  • an extra amino acid is added on the N-terminus of GLP-1.
  • the addition of an amino acid to the N-terminus of GLP-1 may prevent dipeptidyl peptidase from cleaving at the second amino acid of GLP-1 due to steric hindrance. Therefore, GLP-1 will remain functionally active. Any one of the 20 amino acids may be added to the N-terminus of GLP-1. In some instances, an uncharged or positively charged amino acid may be used and preferably, a smaller amino acid such as Glycine is added. The GLP-1 with the extra amino acid is then fused to transferrin. Accordingly, the GLP-1 with the added amino acid will be fused at the N-terminus of the GL-1/transferrin fusion protein.
  • GLP-1 activates and regulates important endocrine hormone systems in the body and plays a critical management role in the metabolism of glucose. Unlike all other diabetic treatments on the market GLP-1 has the potential to be restorative by acting as a growth factor for B-cells thus improving the ability of the pancreas to secrete insulin and also, to make the existing insulin levels act more efficiently by improving sensitivity and better stabilizing glucose levels. This reduces the burden on daily monitoring of glucose levels and potentially offers a delay in the serious long term side effects caused by fluctuations in blood glucose due to diabetes. Furthermore, GLP-1 can reduce appetite and reduce weight. Obesity is an inherent consequence of poor control of glucose metabolism and this only serves to aggravate the diabetic condition.
  • GLP-1 fusion proteins retain the activity of GLP-1 but have the long half-life (14-17 days), solubility, and biodistribution properties of transferrin (mTf). These properties could provide for a low cost, small volume, monthly s.c. (subcutaneous) injection and this type of product is absolutely needed for long term chronic use.
  • EPO Erythropoietin
  • erythrocyte precursor cells a glycoprotein hormone that is synthesized in the kidneys of mammals for stimulating mitotic cell division and differentiation of erythrocyte precursor cells. Accordingly, EPO acts to stimulate and regulate the production of erythrocytes. Because of its role in red blood cell formation, EPO is useful in both the diagnosis and the treatment of blood disorders characterized by low or defective red blood cell production.
  • EPO has been used for the treatment of the anemia of renal failure, anemia of chronic disease associated with rheumatoid arthritis, inflammatory bowel disease, AIDS, and cancer, as well as for the treatment of anemia in hematopoietic malignancies, post-bone marrow transplantation, and autologous blood donation.
  • EPO-receptor belongs to the class of growth-factor-type receptors which are activated by a ligand-induced protein dimerization.
  • Other hormones and cytokines such as human growth hormone (hGH), granulocyte colony stimulating factor (G-CSF), epidermal growth factor (EGF) and insulin can cross-link two receptors resulting in juxtaposition of two cytoplasmic tails.
  • hGH human growth hormone
  • G-CSF granulocyte colony stimulating factor
  • EGF epidermal growth factor
  • insulin can cross-link two receptors resulting in juxtaposition of two cytoplasmic tails.
  • Many of these dimerization-activated receptors have protein kinase domains within the cytoplasmic tails that phosphorylate the neighboring tail upon dimerization. While some cytoplasmic tails lack intrinsic kinase activity, these function by association with protein kinases.
  • the EPO receptor is of the latter type. In each case, phosphorylation results in the activation of
  • EPO erythropoietin receptor
  • EPO EPO mimetic peptides
  • EMP1 can act as an EPO mimetic.
  • EMP1 competes with EPO in receptor binding assays to cause cellular proliferation of cell lines engineered to be responsive to EPO (Wrighton et al., 1996, Science, 273:458-463). Both EPO and EMP1 induce a similar cascade of phosphorylation events and cell cycle progression in EPO responsive cells (Wrighton et al., 1996, Science, 273:458-463). Further, EMP1 demonstrates significant erythropoietic effects in mice as monitored by two different in vivo assays of nascent red blood cell production (Wrighton et al., 1996, Science, 273:458-463).
  • the present invention provides EMP1/transferrin fusion proteins with increased half-life and pharmaceutical compositions comprising such fusion proteins.
  • the present invention contemplates the use of the fusion protein to treat various diseases and conditions associated with EPO such as but not limited to those described above.
  • the pharmaceutical compositions comprising the EMP1/transferrin fusion protein and may be formulated by any of the established methods of formulating pharmaceutical compositions, e.g. as described in Remington's Pharmaceutical Sciences, 1985.
  • the composition may be in a form suited for systemic injection or infusion and may, as such, be formulated with a suitable liquid vehicle such as sterile water or an isotonic saline or glucose solution.
  • a suitable liquid vehicle such as sterile water or an isotonic saline or glucose solution.
  • These pharmaceutical compositions may contain buffers, salts and other excipients to stabilize the composition or assist in the delivery of the transferrin fusion proteins.
  • the present invention provides a method for treating disorders associated with EPO.
  • the method is accomplished by administering a EMP1/transferrin fusion protein provided herein for a time and under conditions sufficient to alleviate the symptoms of the disorder, i.e. sufficient to effect dimerization or biological activation of EPO receptors.
  • EPO such methodology is useful in the treatment of end-stage renal failure/dialysis; anemia, especially associated with AIDS or chronic inflammatory diseases such as rheumatoid arthritis and chronic bowel inflammation; auto-immune disease; and for boosting the red blood cell count of patient when necessary, e.g. prior to surgery or as pretreatment to transfusion.
  • the EMP1/transferrin fusion protein of the present invention which behave as EPO agonists can be used to activate megakaryocytes.
  • EPO has been shown to have a mitogenic and chemotactic effect on vascular endothelial cells as well as an effect on central cholinergic neurons (Amagnostou et al. (1990) Proc. Natl. Acad. Sci. USA 87:597805982; Konishi et al. (1993) Brain Res.
  • the compounds of this invention can also be used to treat a variety of vascular disorders, such as promoting wound healing, growth of collateral coronary blood vessels (such as those that may occur after myocardial infarction), trauma, and post vascular graft treatment, and a variety of neurological disorders, generally characterized by low absolute levels of acetyl choline or low relative levels of acetyl choline as compared to other neuroactive substances e.g., neurotransmitters.
  • vascular disorders such as promoting wound healing, growth of collateral coronary blood vessels (such as those that may occur after myocardial infarction), trauma, and post vascular graft treatment
  • neurological disorders generally characterized by low absolute levels of acetyl choline or low relative levels of acetyl choline as compared to other neuroactive substances e.g., neurotransmitters.
  • the present invention includes pharmaceutical compositions comprising, as an active ingredient, the EMP1/transferrin fusion protein of the present invention in association with a pharmaceutical carrier or diluent.
  • the EMP1/transferrin fusion protein of this invention can be administered by oral, parenteral (intramuscular, intraperitoneal, intravenous (IV) or subcutaneous injection), transdermal (either passively or using iontophoresis or electroporation) or transmucosal (nasal, vaginal, rectal, or sublingual) routes of administration in dosage forms appropriate for each route of administration.
  • Solid dosage forms for oral administration include capsules, tablets, pill, powders, and granules.
  • the active compound is admixed with at least one inert pharmaceutically acceptable carrier such as sucrose, lactose, or starch.
  • Such dosage forms can also comprise, as it normal practice, additional substances other than inert diluents, e.g., lubricating, agents such as magnesium stearate.
  • the dosage forms may also comprise buffering, agents. Tablets and pills can additionally be prepared with enteric coatings.
  • Liquid dosage forms for oral administration include pharmaceutically acceptable emulsions, solutions, suspensions, syrups, with the elixirs containing inert diluents commonly used in the art, such as water. Besides such inert diluents, compositions can also include adjuvants, such as wetting agents, emulsifying and suspending agents, and sweetening, flavoring and perfuming agents.
  • Preparations according to this invention for parenteral administration include sterile aqueous or non-aqueous solutions, suspensions, or emulsions.
  • non-aqueous solvents or vehicles are propylene glycol, polyethylene glycol, vegetable oils, such as olive oil and corn oil, gelatin, and injectable organic esters such as ethyl oleate.
  • Such dosage forms may also contain adjuvants such as preserving, wetting, emulsifying, and dispersing agents. They may be sterilized by, for example, filtration through a bacteria retaining filter, by incorporating sterilizing agents into the compositions, by irradiating the compositions, or by heating the compositions. They can also be manufactured using sterile water, or some other sterile injectable medium, immediately before use.
  • compositions for rectal or vaginal administration are preferably suppositories which may contain, in addition to the active substance, excipients such as cocoa butter or a suppository wax.
  • Compositions for nasal or sublingual administration are also prepared with standard excipients well known in the art.
  • the dosage of active ingredient in the compositions of this invention may be varied; however, it is necessary that the amount of the active ingredient shall be such that a suitable dosage form is obtained.
  • the selected dosage depends upon the desired therapeutic effect, on the route of administration, and on the duration of the treatment desired. Generally dosage levels of between 0.001 to 10 mg/kg of body weight daily are administered to mammals.
  • the present invention also contemplates the use of the transferrin fusion protein comprising EMP1 or analogs thereof for the manufacture of a medicinal product which can be used in the treatment of diseases associated with low or defective red blood cell production. Examples of such diseases are not limited to those described above.
  • HIV infection is pandemic and HIV associated diseases represent a major world health problem.
  • considerable effort is being put into the successful design of effective therapeutics, currently no curative anti-retroviral drugs against AIDS exist.
  • several stages of the HIV life cycle have been considered as targets for therapeutic intervention (Mitsuya, H. et al., 1991, FASEB J. 5:2369-2381).
  • virally encoded reverse transcriptase has been one focus of drug development.
  • a number of reverse-transcriptase-targeted drugs including 2′,3′-dideoxynucleoside analogs such as AZT, ddI, ddc, and d4T have been developed which have been shown to been active against HIV (Mitsuya, H. et al., 1991, Science 249:1533-1544). While beneficial, these nucleoside analogs are not curative, probably due to the rapid appearance of drug resistant HIV mutants (Lander, B. et al., 1989, Science 243:1731-1734). In addition, the drugs often exhibit toxic side effects, such as bone marrow suppression, vomiting, and liver function abnormalities.
  • Entry inhibitors are distinct from the existing classes of drugs that fight HIV. Other drugs work inside the infected cell. Nucleoside reverse transcriptase inhibitors such as AZT and abacavir and non-nucleoside reverse transcriptase inhibitors like nevirapine and efavirenz all act by shutting down the reverse transcriptase enzyme that HIV uses to replicate itself once it is inside the cell. Protease inhibitors shut down the viral protease enzyme HIV uses to package itself up for export. By contrast, entry inhibitors are drugs that interfere with the processes involved in the virus' initial assault on the cell's outer membrane.
  • T-20 is the most studied of all the entry inhibitors and is the first member of the fusion inhibitor class. Unlike existing AIDS drugs that work inside the cell and target viral enzymes involved in the replication of the virus, T-20 inhibits fusion of HIV with host cells before the virus enters the cell and begins its replication process. T-20 binds to one of the two helical domains of gp41. Gp41 is a spring-loaded HIV-1 protein that is activated when CD4 binds to HIV gp-120. The fusion action of gp41 is inhibited if its two helical domains cannot fold together. T-20 binds to gp41, effectively keeping the protein from functioning. It has been shown in early, single-arm clinical studies to be about as potent as a protease inhibitor by itself-giving greater than 10 fold reductions in viral load-and to be safe in combination with other antiretrovirals.
  • T-20 penentafuside, DP-178
  • T-20 achieves sufficient levels in the blood to have anti-HIV activity. It is administered by subcutaneous injection twice daily. However, patients develop skin reactions at the injection site. The most frequently reported treatment related adverse events were mild to moderate local injection site reactions. These consist of mild pain, temporary swelling and redness at the site of injection.
  • U.S. Pat. No. 6,479,055 discloses peptide analogs of the DP-178 (peptides corresponding to amino acid residues 638 to 673 of transmembrane protein gp41 of HIV-1 LA1 , which exhibit anti-membrane fusion capability, antiviral activity, such as the ability to inhibit HIV transmission to uninfected CD-4 + cells, or an ability to modulate intracellular processes involving coiled-coil peptide structures. Further, the patent relates to the use of DP-178 and DP-1 78 portions and/or analogs as antifusogenic or antiviral compounds or as inhibitors of intracellular events involving coiled-coil peptide structures. Further, the patent teaches the use of the peptides as diagnostic agents. For example, a DP178 peptide may be used as an HIV subtype-specific diagnostic.
  • T-1249 is a sister compound of T-20. Like T-20, T-1249 targets the HIV glycoprotein known as gp41 which HIV uses to bind onto CD4 cells. T-1249 has shown potent anti-HIV effects in animal and laboratory studies. Preliminary safety, dosing and efficacy studies in humans have provided support for ongoing research.
  • T-1249 is currently administered by subcutaneous (under the skin) injection once or twice daily.
  • T-1249 has completed phase I/II safety and dosing studies. Initial results indicated that higher doses produced an average viral load drop of 1.3 log.
  • the present invention provides transferrin fusion proteins comprising T-20, T-1249, or analogs thereof with increased half-life and pharmaceutical compositions comprising such fusion proteins.
  • the present invention also provides pharmaceutical compositions comprising these transferrin fusion proteins for therapeutic purposes.
  • the present invention contemplates the use of such fusion proteins as inhibitors of human and non-human retroviral, especially HIV, transmission to uninfected cells.
  • the human retroviruses whose transmission may be inhibited by the peptides of the invention include, but are not limited to all strains of HIV-1 and HIV-2 and the human T-lymphocyte viruses (HTLV-I, II, III).
  • the non-human retroviruses whose transmission may be inhibited by the peptides of the invention include, but are not limited to bovine leukosis virus, feline sarcoma and leukemia viruses, simian sarcoma and leukemia viruses, and sheep progress pneumonia viruses.
  • the transferrin fusion protein of the present invention comprising T-20, T-1249 or analogs thereof may be used as a therapeutic in the treatment of AIDS.
  • These transferrin fusion proteins may be administered using techniques well known to those in the art.
  • the pharmaceutical compositions comprising these transferrin fusion proteins are formulated and administered systemically. Techniques for formulation and administration may be found in “Remington's Pharmaceutical Sciences” 18th ed., 1990 Mack Publishing Co., Easton, Pa.
  • Suitable routes may include oral, rectal, transmucosal, or intestinal administration; parenteral delivery, including intramuscular, subcutaneous, intramedullary injections, as well as intrathecal, direct intraventricular, intravenous, intraperitoneal, intranasal, or intraocular injections, just to name a few. Most preferably, administration is intravenous.
  • the transferrin fusion proteins comprising T-20, T1249, or analogs thereof may be formulated in aqueous solutions, preferably in physiologically compatible buffers such as Hanks' solution, Ringer's solution, or physiological saline buffer.
  • penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art.
  • the transferrin fusion protein comprising T-20, T1249, or analogs thereof may be used as a prophylactic measure in previously uninfected individuals after acute exposure to an HIV virus.
  • prophylactic use of the peptides may include, but are not limited to, prevention of virus transmission from mother to infant and other settings where the likelihood of HIV transmission exists, such as, for example, accidents in health care settings wherein workers are exposed to HIV-containing blood products.
  • the transferrin fusion proteins of the present invention comprising T-20, T-1249, or analogs thereof in such cases may serve the role of a prophylactic vaccine, wherein the host raises antibodies against the fusion proteins of the invention, which then serve to neutralize HIV viruses by, for example, inhibiting further HIV infection.
  • Administration of the transferrin fusion proteins of the invention as a prophylactic vaccine would comprise administering to a host a concentration of transferrin fusion protein effective in raising an immune response which is sufficient to neutralize HIV, by, for example, inhibiting HIV ability to infect cells.
  • concentration will depend upon the specific peptide in the transferrin fusion protein to be administered, but may be determined by using standard techniques for assaying the development of an immune response which are well known to those of ordinary skill in the art.
  • the transferrin fusion protein to be used as vaccines are usually administered intramuscularly.
  • Effective dosages of the transferrin fusion proteins comprising T-20, T-1249, or analogs thereof to be administered may be determined through procedures well known to those in the art which address such parameters as biological half-life, bioavailability, and toxicity. Given the data presented below in Section 6, DP-178, for example, may prove efficacious in vivo at doses required achieve circulating levels of 10 ng per ml of peptide.
  • the present invention contemplates the use of the transferrin fusion proteins comprising T-20, T-1249, or analogs thereof for the manufacture of a medicinal product for the treatment of diseases associated with the transmission of a virus.
  • the present invention provides fusion proteins comprising soluble toxin receptor and transferrin or modified transferrin.
  • toxin refers to a poisonous substance of biological origin.
  • the fusion proteins comprising a soluble toxin receptor may be used to treat patients suffering from diseases associated with toxins. Such fusion proteins may also be used for diagnostic purposes.
  • toxins include, but are not limited to, Pseudomonas exotoxins (PE), Diphtheria toxins (DT), ricin toxin, abrin toxin, anthrax toxins, shiga toxin, botulism toxin, tetanus toxin, cholera toxin, maitotoxin, palytoxin, ciguatoxin, textilotoxin, batrachotoxin, alpha conotoxin, taipoxin, tetrodotoxin, alpha tityustoxin, saxitoxin, anatoxin, microcystin, aconitine, exfoliatin toxins A and B, enterotoxins, toxic shock syndrome toxin (TSST-1), Y.
  • PE Pseudomonas exotoxins
  • DT Diphtheria toxins
  • ricin toxin abrin toxin
  • anthrax toxins shiga toxin
  • the present invention contemplates the use of soluble toxin receptors as anti-toxins for treatment and prevention of diseases associated with various toxins.
  • Toxin receptors are molecules that bind to a specific toxin.
  • a soluble toxin receptor is one that is capable of being dissolved.
  • peptides or fragments of a receptor are soluble.
  • the present invention is directed to soluble peptides or fragments of a toxin receptor that bind a specific toxin.
  • the present invention provides fusion proteins comprising a soluble peptide of a toxin receptor fused to a transferrin or modified transferrin molecule.
  • the resulting fusion protein has an increased half-life as compared to the soluble toxin receptor peptide.
  • the fusion protein is also easy to produce in large quantities by recombinant means. Since the binding properties of the soluble peptide has not been altered, it will bind the toxin in circulation and prevent the toxin from binding to the target receptor, thus inactivating the toxin. Accordingly, the fusion protein is a potent anti-toxin.
  • the present invention provides pharmaceutical composition comprising soluble toxin receptor fused to transferrin or modified transferrin and a pharmaceutically acceptable carrier.
  • the present invention provides the use of transferrin fusion protein comprising soluble toxin receptor for the manufacture of a medicament for the treatment or prevention of diseases or conditions associated with a toxin.
  • the present transferrin/anti-toxin fusion protein is highly potent and less costly to manufacture. Additionally, immunization is not expected to maintain the antibody titers required to protect in instances of mass exposure following an act of bioterrorism. It is unrealistic for the population to be immunized on a mass scale in anticipation of an exposure.
  • Anthrax toxin is a well-known agent of biological warfare derived from Bacillus anthracis. Bacillus anthracis produces three proteins which when combined appropriately form two potent toxins, collectively designated anthrax toxin.
  • Protective antigen (PA, 82,684 Da (Dalton)) and edema factor (EF, 89,840 Da) combine to form edema toxin (ET), while PA and lethal factor (LF, 90,237 Da) combine to form lethal toxin (LT) (Leppla, S. H. Alouf, J. E. and Freer, J. H., eds. Academic Press, London 277-302, 1991).
  • ET and LT each conform to the AB toxin model, with PA providing the target cell binding (B) function and EF or LF acting as the effector or catalytic (A) moieties.
  • B target cell binding
  • EF EF
  • LF effector or catalytic
  • LF Lethal factor
  • PA is capable of binding to the surface of many types of cells. After PA binds to a specific receptor (Leppla, supra, 1991) on the surface of susceptible cells, it is cleaved at a single site by a cell surface protease, probably furin, to produce an amino-terminal 19-kDa fragment that is released from the receptor/PA complex (Singh et al., J. Biol. Chem. 264:19103-19107, 1989). Removal of this fragment from PA exposes a high-affinity binding site for LF and EF on the receptor-bound 63-kDa carboxyl-terminal fragment (PA63). The complex of PA63 and LF or EF enters cells and probably passes through acidified endosomes to reach the cytosol.
  • a specific receptor Leppla, supra, 1991
  • a cell surface protease probably furin
  • PA the non-toxic, cell-binding component of the toxin
  • the vaccine is usually produced from batch cultures of the Sterne strain of B. anthracis , which although avirulent, is still required to be handled as a Class III pathogen.
  • the vaccine contains small amounts of the anthrax toxin moieties, edema factor and lethal factor, and a range of culture derived proteins. All these factors contribute to the recorded reactogenicity of the vaccine in some individuals.
  • the vaccine is expensive and requires a six month course of four vaccinations. Futhermore, present evidence suggests that this vaccine may not be effective against inhalation challenge with certain strains (M. G. Broster et al., Proceedings of the International Workshop on Anthrax, Apr. 11-13, 1989, Winchester UK. Salisbury med Bull Suppl No 68, (1990) 91-92).
  • ATR anthrax toxin receptor
  • the receptor, ATR is a type I membrane protein consisting of 368 amino acids.
  • the protein has a predicted signal peptide of 27 amino acids, an extracellular domain of 293 amino acids containing three putative N-linked glycosylation sites, a putative transmembrane region of 23 amino acids and a short cytoplasmic tail of 25 amino acids.
  • a notable feature of ATR is that the extracellular domain consists of a von willebrand factor type A (VWA) domain which is known to be important in protein-protein interactions. This VWA domain is located at amino acids 44 to 216.
  • VWA von willebrand factor type A
  • a soluble version of ATR comprising amino acids 41-227 was shown to bind the anthrax toxin. Accordingly, the VWA domain of ATR binds directly to PA.
  • the present invention provides an anthrax antitoxin comprising the extracellular domain of ATR fused to transferrin or modified transferrin molecule.
  • the present invention also contemplates fusion proteins comprising fragments thereof of the extracellular domain of ATR that binds PA fused to transferrin or modified transferrin molecule.
  • the present invention contemplates fusion proteins comprising small molecule mimetics of the extracellular domain of ATR that binds PA fused to transferrin or modified transferrin molecule.
  • the present invention provides amino acids 41-227 of ATR fused to transferrin or modified transferrin molecule.
  • the clostridial neurotoxins are the most poisonous substance. Humans are exposed to the neurotoxin produced by Clostridium tetani (tetanus toxin) as a result of wounds. Although the tetanus toxin remains a serious public health problem in developing countries around the world, nearly everyone in the western world is protected from tetanus toxin as a consequence of childhood immunizations. Humans usually come into contact with the neurotoxin produced by Clostridium botulinum (botulinum toxin) through food poisoning. However, there are rare incidents of wound botulism and colonizing infection of neonates known as infant botulism.
  • botulinum poisoning is rare, immunization of the general population is not warranted on the basis of cost and the expected rates of adverse reaction to the vaccine. Therefore, humans are not protected from botulinum toxins. Additionally, these toxins are relatively to produce. Consequently, botulinum toxins are likely biological warfare agents.
  • Clostridium botulinum produces the most poisonous biological neurotoxin known with a lethal human dose in the nanogram range.
  • the effect of the toxin ranges from diarrheal diseases that can cause destruction of the colon, to paralytic effects that can cause death.
  • the spores of Clostridium botulinum are found in soil and can grow in improperly sterilized and sealed food containers of home based canneries, which are the cause of many of the cases of botulism.
  • the symptoms of botulism typically appear 18 to 36 hours after eating the foodstuffs infected with a Clostridium botulinum culture or spores.
  • botulinum toxin can apparently pass unattenuated through the lining of the gut and attack peripheral motor neurons. Symptoms of botulinum toxin intoxication can progress from difficulty walking, swallowing, and speaking to paralysis of the respiratory muscles and death.
  • Botulism disease may be grouped into four types, based on the method of introduction of toxin into the bloodstream.
  • Food-borne botulism results from ingesting improperly preserved and inadequately heated food that contains botulinal toxin (i.e., the toxin is pre-formed prior to ingestion).
  • Wound-induced botulism results from C. botulinum penetrating traumatized tissue and producing toxin that is absorbed into the bloodstream. Since 1950, thirty cases of wound botulism have been reported (Swartz, “Anaerobic Spore-Forming Bacilli: The Clostridia,” pp. 633-646, in Davis et al., (eds.), Microbiology, 4th edition, J.B.
  • Inhalation botulism results when the toxin is inhaled. Inhalation botulism has been reported as the result of accidental exposure in the laboratory (Holzer, Med. Klin., 41:1735 [1962]) and is a potential danger if the toxin is used as an agent of biological warfare (Franz et al., in Botulinum and Tetanus Neurotoxins, DasGupta (ed.), Plenum Press, New York [1993], pp. 473-476). Infectious infant botulism results from C. botulinum colonization of the infant intestine with production of toxin and its absorption into the bloodstream.
  • Clostridium botulinum each produce antigenically distinct toxin designated by the letters A-G.
  • Serotype A toxin has been implicated in 26% of the cases of food botulism; types B, E, and F have also been implicated in a smaller percentage of the food botulism cases (Sugiyama, Microbiol. Rev., 44:419 (1980)).
  • Wound botulism has been reportedly caused by only types A or B toxins (Sugiyama, supra).
  • Type C toxin affects waterfowl, cattle, horses and mink.
  • Type D toxin affects cattle, and type E toxin affects both humans and birds.
  • Clostridium botulinum neurotoxin acts on nerve endings to block acetylcholine release. Binding of the neurotoxin to a membrane receptor through its heavy chain is the first essential step in its mode of toxin action.
  • Li et al. J Nat Toxins 1998, 7(3):215-26 purified Type E botulinum neurotoxin (BoNT/E) or type A botulinum neurotoxin (BoNT/A) from rat brain synaptosomes employing a neurotoxin affinity column chromatography.
  • the protein fraction eluted from the affinity column with 0.5 M NaCl contained a 57 kDa protein as a major eluant.
  • Synaptotagmin I is a broad acting receptor of Clostridium botulinum neurotoxin serotypes A, B, and E and possibly C, D, F, and G. It is located on the motor neuronal cell.
  • the N-terminal fragment of synaptotagmin I amino acids 1-53 (SEQ ID NO: 4), is responsible for binding to the various neurotoxin serotypes. The binding mediates translocation of the neurotoxin into the cell and blocks neurotransmitter release which results in paralysis and in extreme cases fatality.
  • the N-terminal fragment may be produced by recombinant means and used to bind neurotoxins in circulation. The binding of the fragment to the neurotoxin prevents the neurotoxin from binding its target receptor which results in neutralization of the toxin.
  • the goal of the present invention is to provide an anti-toxin of Clostridium botulinum with significantly increased half-life as compared to the recombinantly produced 53 amino acid fragment, so that the anti-toxin has sufficient time to find and bind the neurotoxins as they enter the circulation.
  • the present invention provides a fusion protein comprising the N-terminal 53 amino acid fragment of synaptotagmin I fused to transferrin or modified transferrin, thereby increasing the half-life of the fragment without altering the binding properties of the fragment.
  • the fragment could be chemically pegylated to prolong circulating life. The longer half-life of the anti-toxin will make a given dose more effective.
  • the present anti-toxin fusion protein is broad acting and bind to several neurotoxin serotypes, specifically neurotoxin A, B, and E.
  • the fusion protein is produced in a highly efficient microbial production system which can provide large quantities of the anti-toxin at a reasonable cost to treat the population following mass exposure in acts of bioterrorism.
  • This fusion protein can also be used in a prophylactic mode prior to exposure
  • the present invention also contemplates anti-toxins comprising peptide fragments of amino acids 1-53 of synaptotagmin I or small molecule mimetics of amino acids 1-53 of snynaptotagmin I fused to transferrin or modified transferrin molecule.
  • the fusion protein can also be used to block botulism spread through food or air contamination among the civilian population.
  • the anti-toxin fusion protein is used to treat wound botulism resulting from drug use and accidental overdose of botulinum neurotoxin following the treatment of various diseases such as migraine dystonia, and hyperhidrosis.
  • the anti-toxin fusion protein is used to treat botulism from food poisoning.
  • Diphtheria is caused by a bacterium, Corynebacterium diphtheriae , which typically infects mucous membranes: the nose and throat are favorite places for the infection to take hold, but mucous membranes of the eyes or genitalia can be infected also.
  • the bacteria produce a toxin which causes damage to tissue both at the site of the original infection and in other parts of the body once the toxin is spread via the bloodstream.
  • the most serious effects of diphtheria toxin are on the heart (muscle damage leading to loss of pumping ability), kidneys, and the nervous system.
  • Diphtheria can be treated by giving penicillin or other antibiotics to kill the bacteria, and antitoxin to clear free toxin in the body. However the antitoxin will not clear toxin that has already bound to cells and started to damage them.
  • the better approach is to give toxoid to stimulate immunity to the toxin, thus enabling the body to clear toxin as soon as it appears.
  • Immunity to a bacterial toxin such as diphtheria toxin (DT) may be acquired naturally during the course of an infection, or artificially by injection of a detoxified form of the toxin (i.e., a toxoid) (Germanier, ed., Bacterial Vaccines, Academic Press, Orlando, Fla., 1984).
  • Toxoids have traditionally been prepared by chemical modification of native toxins (e.g., with formalin or formaldehyde (Lingood et al., Brit. J. Exp. Path. 44:177, 1963)), rendering them nontoxic while retaining an antigenicity that protects the vaccinated animal against subsequent challenges by the natural toxin:
  • an example of a chemically-inactivated DT is that described by Michel and Dirkx (Biochem. Biophys. Acta 491:286-295, 1977), in which Trp-153 of Fragment A is the modified residue.
  • the toxoid is given initially at ages 2, 4, and 6 months, again at ages 18 months and 5 years, and regularly every 10 years after that.
  • diphtheria was no longer a major public health threat.
  • equine antitoxin which neutralizes unbound toxin
  • surviving patients have often developed serum sickness, an immune complex-type disease.
  • serum sickness an immune complex-type disease.
  • the DT molecule is produced as a single polypeptide of 535 amino acids that is readily spliced to form two subunits linked by a disulfide bond, Fragment A (N-terminal of about 21 Kda) and Fragment B (C-terminal of about 37 Kda), as a result of cleavage at residue 190, 192, or 193 (Moskaug, et al., Biol Chem 264:15709-15713, 1989; Collier et al., Biol Chem, 246:1496-1503, 1971).
  • Fragment A is the catalytically active portion of DT.
  • Fragment A consists of the diphtheria toxin C domain. Fragment A is linked to the diphtheria toxin Fragment B by a polypeptide loop. Fragment B of DT possesses a receptor-binding domain (the R domain) which recognizes and binds the toxin molecule to a particular receptor structure found on the surfaces of many types of mammalian cells.
  • a second functional region on Fragment B acts to translocate DT across the membrane of the endocytic vesicle, releasing catalytically active Fragment A into the cytosol of the cell.
  • a single molecule of Fragment A is sufficient to inactivate the protein synthesis machinery in a given cell.
  • proHB-EGF a significant amount of proHB-EGF remains on the cell surface and functions as a juxtacrine growth factor (Hagashiyama et al., Science, 251: 929-938) and as a DT receptor (Iwamoto et al., EMBO J., 1994, 13:2322-2330; Naglich et al., Cell, 1992, 69: 1051-1061).
  • the present invention provides anti-toxin fusion protein comprising truncated (I117A/L148A) HB-EGF protein fused to transferrin or modified transferrin.
  • the present invention also provides transferrin/anti-toxin fusion proteins comprising fragments thereof of truncated (I117A/L148A) HB-EGF protein that bind DT and has minimal mitogenic activity.
  • the invention provides transferrin/anti-toxin fusion proteins comprising analogs of truncated HB-EGF protein that bind DT and has minimal mitogenic activity.
  • Bacterium Bacillus thuringiensis produces bacteriocidal proteins that are toxic to a limited range of insects, mostly in the orders Lepidoptera, Coleoptera and Diptera.
  • Bt toxins have been used to control pests, by applying Bacillus thuringiensis to plants or transforming plants themselves so that they generate the toxins by virtue of their transgenic character.
  • the toxins themselves are glycoprotein products of the cry gene as described by Hofte, H. et al. Microbiol Rev (1989) 53:242.
  • U.S. Pat. No. 5,693,491 discloses the cDNA encoding a glycoprotein receptor from the tobacco hornworm that binds a Bacillus thuringiensis toxin.
  • this cDNA permits the retrieval of DNAs encoding homologous receptors in other insects and organisms as well as the design of assays for the cytotoxicity and binding affinity of potential pesticides and the development of methods to manipulate natural and/or introduced homologous receptors and, thus, to destroy target cells, tissues and/or organisms.
  • cholerae cholerae , and which contribute to the residual diarrhea, was discovered (Fasano et al., Proc. Nat. Acad. Sci., USA, 8:5242-5246 (1991)).
  • the zot gene is located immediately adjacent to the ctx genes.
  • the high percent concurrence of the zot gene with the ctx genes among V. cholerae strains (Johnson et al., J. Clin. Microb., 31/3:732-733 (1993); and Karasawa et al, FEBS Microbiology Letters, 106:143-146 (1993)) suggests a possible synergistic role of ZOT in the causation of acute dehydrating diarrhea typical of cholera.
  • Diarrhea can be caused by small, heat stable peptide toxins (ST) produced by various pathogenic bacteria (Thompson, M. R., 1987, Pathol. Immunopathol. Res. 6, 103-116). In developing countries, such toxins may be responsible for 50% to 80% of the reported cases of diarrhea (Giannella, R. A., 1981, Ann. Rev. Med. 32, 341-357). ST are also a major cause of diarrhea in laboratory and domestic animals (Burgess et al., 1978, Infect. Immun. 21, 526-531).
  • the ST receptor is a distinctly different protein than quanylyl cyclase based on partial chromatographic separation of a detergent-solubilized ST-binding protein from guanylyl cyclase activity (Kuno et al., 1986, J. Biol. Chem. 261, 1470-1476; Waldman, et al., 1986, Infect. Immun. 51, 320-326).
  • U.S. Pat. No. 5,237,051 discloses cloning of the nucleic acid encoding the intestinal receptor which recognizes heat stable enterotoxins and has guanylyl cylase activity. Data shows that the receptor binds enterotoxin and signals normally through the cyclic GMP second messenger system.
  • Sepsis is most commonly caused by infection or trauma induced by a toxin.
  • the initial symptoms of sepsis typically include chills, profuse sweat, irregularly remittent fever, prostration and the like, followed by persistent fever, hypotension leading to shock, neutropenia, leukopenia, disseminated intravascular coagulation, adult respiratory distress syndrome and multiple organ failure.
  • Sepsis-inducing toxins have been found associated with pathogenic bacteria, viruses, plants and venoms.
  • bacterial toxins are the endotoxins or lipopolysaccharides(LPS) of the gram-negative bacteria. These molecules are glycolipids that are ubiquitous in the outer membrane of all gram-negative bacteria.
  • the anti-toxin fusion proteins of the present invention will be packaged in a single piston syringe with two contiguous chambers.
  • the first chamber will contain diluent and the second will contain the lyophilized anti-toxin fusion protein.
  • the diluent can contain an anti-freeze such glycerol to act in freezing conditions.
  • the lyophilized product will remain stable in tropical conditions.
  • the present invention contemplates delivering the antitoxin fusion proteins of the present invention in this manner to soldiers entering into a combat situation where the risk of exposure to toxins is high.
  • the anti-toxin fusion protein can be used for immediate treatment on the battlefield and as a prophylactic before going on the battlefield.
  • the present invention also provides nucleic acid molecules encoding transferrin fusion proteins comprising a transferrin protein or a portion of a transferrin protein covalently linked or joined to a therapeutic protein, preferably a therapeutic protein.
  • a therapeutic protein preferably a therapeutic protein.
  • the fusion protein may further comprise a linker region, for instance a linker less than about 50, 40, 30, 20, or 10 amino acid residues.
  • the linker can be covalently linked to and between the transferrin protein or portion thereof and the therapeutic protein, preferably the therapeutic protein.
  • Nucleic acid molecules of the invention may be purified or not.
  • Host cells and vectors for replicating the nucleic acid molecules and for expressing the encoded fusion proteins are also provided. Any vectors or host cells may be used, whether prokaryotic or eukaryotic, but eukaryotic expression systems, in particular yeast expression systems, may be preferred. Many vectors and host cells are known in the art for such purposes. It is well within the skill of the art to select an appropriate set for the desired application.
  • DNA sequences encoding transferrin, portions of transferrin and therapeutic proteins of interest may be cloned from a variety of genomic or cDNA libraries known in the art.
  • the techniques for isolating such DNA sequences using probe-based methods are conventional techniques and are well known to those skilled in the art.
  • Probes for isolating such DNA sequences may be based on published DNA or protein sequences (see, for example, Baldwin, G. S. (1993) Comparison of Transferrin Sequences from Different Species. Comp. Biochem. Physiol. 106B/1 :203-218 and all references cited therein, which are hereby incorporated by reference in their entirety).
  • the polymerase chain reaction (PCR) method disclosed by Mullis et al. (U.S. Pat. No. 4,683,195) and Mullis (U.S. Pat. No. 4,683,202), incorporated herein by reference may be used.
  • the choice of library and selection of probes for the isolation of such DNA sequences is within the level of ordinary skill
  • similarity between two polynucleotides or polypeptides is determined by comparing the nucleotide or amino acid sequence and its conserved nucleotide or amino acid substitutes of one polynucleotide or polypeptide to the sequence of a second polynucleotide or polypeptide.
  • identity also known in the art is “identity” which means the degree of sequence relatedness between two polypeptide or two polynucleotide sequences as determined by the identity of the match between two strings of such sequences. Both identity and similarity can be readily calculated (Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D.
  • identity and similarity are well known to skilled artisans (Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M Stockton Press, New York, 1991; and Carillo, H., and Lipman, D., SIAM J. Applied Math., 48: 1073 (1988). Methods commonly employed to determine identity or similarity between two sequences include, but are not limited to those disclosed in Guide to Huge Computers, Martin J. Bishop, ed., Academic Press, San Diego, 1994, and Carillo, H., and Lipman, D., SIAM J. Applied Math. 48:1073 (1988).
  • Preferred methods to determine identity are designed to give the largest match between the two sequences tested. Methods to determine identity and similarity are codified in computer programs. Preferred computer program methods to determine identity and similarity between two sequences include, but are not limited to, GCG program package (Devereux, et al., Nucleic Acids Research 12(1):387 (1984)), BLASTP, BLASTN, FASTA (Atschul, et al., J. Molec. Biol. 215:403 (1990)). The degree of similarity or identity referred to above is determined as the degree of identity between the two sequences indicating a derivation of the first sequence from the second.
  • the degree of identity between two nucleic acid sequences may be determined by means of computer programs known in the art such as GAP provided in the GCG program package (Needleman and Wunsch (1970) Journal of Molecular Biology 48:443-453).
  • GAP is used with the following settings: GAP creation penalty of 5.0 and GAP extension penalty of 0.3.
  • the degeneracy of the genetic code permits variations of the nucleotide sequence of a transferrin protein and/or therapeutic protein of interest, while still producing a polypeptide having the identical amino acid sequence as the polypeptide encoded by the native DNA sequence.
  • the procedure known as “codon optimization” (described in U.S. Pat. No. 5,547,871 which is incorporated herein by reference in its entirety) provides one with a means of designing such an altered DNA sequence.
  • the design of codon optimized genes should take into account a variety of factors, including the frequency of codon usage in an organism, nearest neighbor frequencies, RNA stability, the potential for secondary structure formation, the route of synthesis and the intended future DNA manipulations of that gene. In particular, available methods may be used to alter the codons encoding a given fusion protein with those most readily recognized by yeast when yeast expression systems are used.
  • the degeneracy of the genetic code permits the same amino acid sequence to be encoded and translated in many different ways.
  • leucine, serine and arginine are each encoded by six different codons
  • valine, proline, threonine, alanine and glycine are each encoded by four different codons.
  • the frequency of use of such synonymous codons varies from genome to genome among eukaryotes and prokaryotes.
  • synonymous codon-choice patterns among mammals are very similar, while evolutionarily distant organisms such as yeast ( S. cerevisiae ), bacteria (such as E. coli ) and insects (such as D.
  • the preferred codon usage frequencies for a synthetic gene should reflect the codon usages of nuclear genes derived from the exact (or as closely related as possible) genome of the cell/organism that is intended to be used for recombinant protein expression, particularly that of yeast species.
  • the human Tf sequence is codon optimized, before or after modification as herein described for yeast expression as may be the nucleotide sequence of the therapeutic protein.
  • Expression units for use in the present invention will generally comprise the following elements, operably linked in a 5′ to 3′ orientation: a transcriptional promoter, a secretory signal sequence, a DNA sequence encoding a modified Tf fusion protein comprising transferrin protein or a portion of a transferrin protein joined to a DNA sequence encoding a therapeutic protein or peptide of interest, preferably a therapeutic protein, and a transcriptional terminator.
  • a transcriptional promoter a transcriptional promoter
  • a secretory signal sequence a DNA sequence encoding a modified Tf fusion protein comprising transferrin protein or a portion of a transferrin protein joined to a DNA sequence encoding a therapeutic protein or peptide of interest, preferably a therapeutic protein, and a transcriptional terminator.
  • a transcriptional promoter any arrangement of the therapeutic protein or peptide fused to or within the Tf portion may be used in the vectors of the invention.
  • suitable promoters, signal sequences and terminators will be determined
  • Suitable yeast vectors for use in the present invention are described in U.S. Pat. No. 6,291,212 and include YRp7 (Struhl et al., Proc. Natl. Acad. Sci. USA 76: 1035-1039, 1978), YEp13 (Broach et al., Gene 8: 121-133, 1979), pJDB249 and pJDB219 (Beggs, Nature 275:104-108, 1978), pPPC0005, pSeCHSA, pScNHSA, pC4 and derivatives thereof.
  • Useful yeast plasmid vectors also include pRS403-406, pRS413-416 and the Pichia vectors available from Stratagene Cloning Systems, La Jolla, Calif. 92037, USA.
  • Plasmids pRS403, pRS404, pRS405 and pRS406 are Yeast Integrating plasmids (YIps) and incorporate the yeast selectable markers HIS3, 7RPI, LEU2 and URA3.
  • Plasmids pRS413 ⁇ 41.6 are Yeast Centromere plasmids (Ycps).
  • Such vectors will generally include a selectable marker, which may be one of any number of genes that exhibit a dominant phenotype for which a phenotypic assay exists to enable transformants to be selected.
  • selectable markers are those that complement host cell auxotrophy, provide antibiotic resistance or enable a cell to utilize specific carbon sources, and include LEU2 (Broach et al. ibid.), URA3 (Botstein et al., Gene 8: 17, 1979), HIS3(Struhl et al., ibid.) or POT1 (Kawasaki and Bell, EP 171,142).
  • Other suitable selectable markers include the CAT gene, which confers chloramphenicol resistance on yeast cells.
  • promoters for use in yeast include promoters from yeast glycolytic genes (Hitzeman et al., J. Biol. Chem. 225: 12073-12080, 1980; Alber and Kawasaki, J. Mol. Appl. Genet. 1: 419-434, 1982; Kawasaki, U.S. Pat. No. 4,599,311) or alcohol dehydrogenase genes (Young et al., in Genetic Engineering of Microorganisms for Chemicals, Hollaender et al., (eds.), p. 355, Plenum, N.Y., 1982; Ammerer, Meth. Enzymol. 101: 192-201, 1983).
  • particularly preferred promoters are the TPI1 promoter (Kawasaki, U.S. Pat. No. 4,599,311) and the ADH2-4 C (see U.S. Pat. No. 6,291,212) promoter (Russell et al., Nature 304: 652-654, 1983).
  • the expression units may also include a transcriptional terminator.
  • a preferred transcriptional terminator is the TPI1 terminator (Alber and Kawasaki, ibid.).
  • modified fusion proteins of the present invention can be expressed in filamentous fungi, for example, strains of the fungi Aspergillus.
  • useful promoters include those derived from Aspergillus nidulans glycolytic genes, such as the ADH3 promoter (McKnight et al., EMBO J. 4: 2093-2099, 1985) and the tpiA promoter.
  • An example of a suitable terminator is the ADH3 terminator (McKnight et al., ibid.).
  • the expression units utilizing such components may be cloned into vectors that are capable of insertion into the chromosomal DNA of Aspergillus , for example.
  • Mammalian expression vectors for use in carrying out the present invention will include a promoter capable of directing the transcription of the modified Tf fusion protein, preferably a transferrin fusion protein comprising a modified Tf.
  • Preferred promoters include viral promoters and cellular promoters.
  • Preferred viral promoters include the major late promoter from adenovirus 2 (Kaufman and Sharp, Mol. Cell. Biol. 2: 1304-13199, 1982) and the SV40 promoter (Subramani et al., Mol. Cell. Biol. 1: 854-864, 1981).
  • Preferred cellular promoters include the mouse metallothionein-1 promoter (Palmiter et al., Science 222: 809-814, 1983) and a mouse V6 (see U.S. Pat. No. 6,291,212) promoter (Grant et al., Nuc. Acids Res. 15: 5496, 1987).
  • a particularly preferred promoter is a mouse V H (see U.S. Pat. No. 6,291,212) promoter.
  • Such expression vectors may also contain a set of RNA splice sites located downstream from the promoter and upstream from the DNA sequence encoding the transferrin fusion protein. Preferred RNA splice sites may be obtained from adenovirus and/or immunoglobulin genes.
  • polyadenylation signal located downstream of the coding sequence of interest.
  • Polyadenylation signals include the early or late polyadenylation signals from SV40 (Kaufman and Sharp, ibid.), the polyadenylation signal from the adenovirus 5 E1B region and the human growth hormone gene terminator (DeNoto et al., Nuc. Acids Res. 9: 3719-3730, 1981).
  • a particularly preferred polyadenylation signal is the V H (see U.S. Pat. No. 6,291,212) gene terminator.
  • the expression vectors may include a noncoding viral leader sequence, such as the adenovirus 2 tripartite leader, located between the promoter and the RNA splice sites.
  • Preferred vectors may also include enhancer sequences, such as the SV40 enhancer and the mouse: (see U.S. Pat. No. 6,291,212) enhancer (Gillies, Cell 33: 717-728, 1983).
  • Expression vectors may also include sequences encoding the adenovirus VA RNAs.
  • Cloned DNA sequences comprising modified Tf fusion proteins of the invention may be introduced into cultured mammalian cells by, for example, calcium phosphate-mediated transfection (Wigler et al., Cell 14: 725, 1978; Corsaro and Pearson, Somatic Cell Genetics 7: 603, 1981; Graham and Van der Eb, Virology 52: 456, 1973.)
  • Other techniques for introducing cloned DNA sequences into mammalian cells such as electroporation (Neumann et al., EMBO J. 1: 841-845, 1982), or lipofection may also be used.
  • a selectable marker is generally introduced into the cells along with the gene or cDNA of interest.
  • Preferred selectable markers for use in cultured mammalian cells include genes that confer resistance to drugs, such as neomycin, hygromycin, and methotrexate.
  • the selectable marker may be an amplifiable selectable marker.
  • a preferred amplifiable selectable marker is the DHFR gene.
  • a particularly preferred amplifiable marker is the DHFR r (see U.S. Pat. No. 6,291,212) cDNA (Simonsen and Levinson, Proc. Natl. Acad. Sci. USA 80: 2495-2499, 1983).
  • Selectable markers are reviewed by Thilly (Mammalian Cell Technology, Butterworth Publishers, Stoneham, Mass.) and the choice of selectable markers is well within the level of ordinary skill in the art.
  • the present invention also includes a cell, preferably a yeast cell transformed to express a modified transferrin fusion protein of the invention.
  • a cell preferably a yeast cell transformed to express a modified transferrin fusion protein of the invention.
  • the present invention also includes a culture of those cells, preferably a monoclonal (clonally homogeneous) culture, or a culture derived from a monoclonal culture, in a nutrient medium. If the polypeptide is secreted, the medium will contain the polypeptide, with the cells, or without the cells if they have been filtered or centrifuged away.
  • Host cells for use in practicing the present invention include eukaryotic cells, and in some cases prokaryotic cells, capable of being transformed or transfected with exogenous DNA and grown in culture, such as cultured mammalian, insect, fungal, plant and bacterial cells.
  • Fungal cells including species of yeast (e.g., Saccharomyces spp., Schizosaccharomyces spp., Pichia spp.) may be used as host cells within the present invention.
  • Exemplary genera of yeast contemplated to be useful in the practice, of the present invention as hosts for expressing the transferrin fusion protein, preferably the transferrin fusion protein, of the inventions are Pichia (formerly classified as Hansenula ), Saccharomyces, Kluyveromyces, Aspergillus, Candida, Torulopsis, Torulaspora, Schizosaccharomyces, Citeromyces, Pachysolen, Zygosaecharomyces, Debaromyces, Trichoderma, Cephalosporium, Humicola, Mucor, Neurospora, Yarrowia, Metschunikowia, Rhodosporidium, Leucosporidium, Botryoascus, Sporidiobolus, Endomycopy
  • Saccharomyces spp. are S. cerevisiae, S. italicus and S. rouxii .
  • Examples of KIuyveromyces spp. are K ftagilis, K. lactis and K. marxianus .
  • a suitable Tórulasppra species is T. delbrueckii .
  • Examples of Pichia (Hansenula) spp. are P. angusta (formerly H. polymorpha ), P. anomala (formerly H. anomala ) and P. pastoris.
  • Particularly useful host cells to produce the Tf fusion proteins of the invention are the methanoltrophic Pichia pastoris (Steinlein et al. (1995) Protein Express. Purif 6:619-624).
  • Pichia pastoris has been developed to be an outstanding host for the production of foreign proteins since its alcohol oxidase promoter was isolated and cloned; its transformation was first reported in 1985.
  • P. pastoris can utilize methanol as a carbon source in the absence of glucose.
  • the P. pastoris expression system can use the methanol-induced alcohol oxidase (AOX1) promoter, which controls the gene that codes for the expression of alcohol oxidase, the enzyme which catalyzes the first step in the metabolism of methanol.
  • AOX1 methanol-induced alcohol oxidase
  • This promoter has been characterized and incorporated into a series of P. pastoris expression vectors. Since the proteins produced in P. pastoris are typically folded correctly and secreted into the medium, the fermentation of genetically engineered P. pastoris provides an excellent alternative to E. coli expression systems. A number of proteins have been produced using this system, including tetanus toxin fragment, Bordatella pertussis pertactin, human serum albumin and lysozyme.
  • F. oxysporum may, for instance, be carried out as described by Malardier et al. (1989) Gene 78:147-156.
  • yeast Saccharomyces cerevisiae are another preferred host.
  • a yeast cell or more specifically, a Saccharomyces cerevisiae host cell that contains a genetic deficiency in a gene required for asparagine-linked glycosylation of glycoproteins is used.
  • S. cerevisiae host cells having such defects may be prepared using standard techniques of mutation and selection, although many available yeast strains have been modified to prevent or reduce glycosylation or hypermannosylation. Ballou et al. (J. Biol. Chem. 255: 5986-5991, 1980) have described the isolation of mannoprotein biosynthesis mutants that are defective in genes which affect asparagine-linked glycosylation.
  • the host strain carries a mutation, such as the S. cerevisiae pep4 mutation (Jones, Genetics 85: 23-33, 1977), which results in reduced proteolytic activity.
  • Host strains containing mutations in other protease encoding regions are particularly useful to produce large quantities of the Tf fusion proteins of the invention.
  • Host cells containing DNA constructs of the present invention are grown in an appropriate growth medium.
  • appropriate growth medium means a medium containing nutrients required for the growth of cells.
  • Nutrients required for cell growth may include a carbon source, a nitrogen source, essential amino acids, vitamins, minerals and growth factors.
  • the growth medium will generally select for cells containing the DNA construct by, for example, drug selection or deficiency in an essential nutrient which are complemented by the selectable marker on the DNA construct or co-transfected with the DNA construct.
  • Yeast cells for example, are preferably grown in a chemically defined medium, comprising a non-amino acid nitrogen source, inorganic salts, vitamins and essential amino acid supplements.
  • the pH of the medium is preferably maintained at a pH greater than 2 and less than 8, preferably at pH 6.5.
  • Methods for maintaining a stable pH include buffering and constant pH control, preferably through the addition of sodium hydroxide.
  • Preferred buffering agents include succinic acid and Bis-Tris (Sigma Chemical Co., St. Louis, Mo.).
  • Yeast cells having a defect in a gene required for asparagine-linked glycosylation are preferably grown in a medium containing an osmotic stabilizer.
  • a preferred osmotic stabilizer is sorbitol supplemented into the medium at a concentration between 0.1 M and 1.5 M., preferably at 0.5 M or 1.0 M.
  • Cultured mammalian cells are generally grown in commercially available serum-containing or serum-free media. Selection of a medium appropriate for the particular cell line used is within the level of ordinary skill in the art. Transfected mammalian cells are allowed to grow for a period of time, typically 1-2 days, to begin expressing the DNA sequence(s) of interest. Drug selection is then applied to select for growth of cells that are expressing the selectable marker in a stable fashion. For cells that have been transfected with an amplifiable selectable marker the drug concentration may be increased in a stepwise manner to select for increased copy number of the cloned sequences, thereby increasing expression levels.
  • Baculovirus/insect cell expression systems may also be used to produce the modified Tf fusion proteins of the invention.
  • the BacPAKTM Baculovirus Expression System (BD Biosciences (Clontech) expresses recombinant proteins at high levels in insect host cells.
  • the target gene is inserted into a transfer vector, which is cotransfected into insect host cells with the linearized BacPAK6 viral DNA.
  • the BacPAK6 DNA is missing an essential portion of the baculovirus genome.
  • the DNA recombines with the vector, the essential element is restored and the target gene is transferred to the baculovirus genome.
  • a few viral plaques are picked and purified, and the recombinant phenotype is verified.
  • the newly isolated recombinant virus can then be amplified and used to infect insect cell cultures to produce large amounts of the desired protein.
  • secretory signal sequence or “signal sequence” or “secretion leader sequence” are used interchangeably and are described, for example in U.S. Pat. No. 6,291,212 and U.S. Pat. No. 5,547,871, both of which are herein incorporated by reference in their entirety.
  • Secretory signal sequences or signal sequences or secretion leader sequences encode secretory peptides.
  • a secretory peptide is an amino acid sequence that acts to direct the secretion of a mature polypeptide or protein from a cell.
  • Secretory peptides are generally characterized by a core of hydrophobic amino acids and are typically (but not exclusively) found at the amino termini of newly synthesized proteins.
  • Secretory peptides may contain processing sites that allow cleavage of the signal peptide from the mature protein as it passes through the secretory pathway. Processing sites may be encoded within the signal peptide or may be added to the signal peptide by, for example, in vitro mutagenesis.
  • Secretory peptides may be used to direct the secretion of modified Tf fusion proteins of the invention.
  • One such secretory peptide that may be used in combination with other secretory peptides is the third domain of the yeast Barrier protein.
  • Secretory signal sequences or signal sequences or secretion leader sequences are required for a complex series of post-translational processing steps which result in secretion of a protein. If an intact signal sequence is present, the protein being expressed enters the lumen of the rough endoplasmic reticulum and is then transported through the Golgi apparatus to secretory vesicles and is finally transported out of the cell.
  • the signal sequence immediately follows the initiation codon and encodes a signal peptide at the amino-terminal end of the protein to be secreted. In most cases, the signal sequence is cleaved off by a specific protease, called a signal peptidase. Preferred signal sequences improve the processing and export efficiency of recombinant protein expression using viral, mammalian or yeast expression vectors. In some cases, the native Tf signal sequence may be used to express and secrete fusion proteins of the invention.
  • Linkers may be used to express and secrete fusion proteins of the invention.
  • the Tf moiety and the therapeutic protein of the modified transferrin fusion proteins of the invention can be fused directly or using a linker peptide of various lengths to provide greater physical separation and allow more spatial mobility between the fused proteins and thus maximize the accessibility of the therapeutic protein, for instance, for binding to its cognate receptor.
  • the linker peptide may consist of amino acids that are flexible or more rigid.
  • a linker such as but not limited to a poly-glycine stretch.
  • the linker can be less than about 50, 40, 30, 20, or 10 amino acid residues.
  • the linker can be covalently linked to and between the transferrin protein or portion thereof and the therapeutic protein.
  • Assays for detection of biologically active modified transferrin-fusion protein may include Western transfer, protein blot or colony filter as well as activity based assays that detect the fusion protein comprising transferrin and therapeutic protein.
  • a Western transfer filter may be prepared using the method described by Towbin et al. (Proc. Natl. Acad. Sci. USA 76: 4350-4354, 1979). Briefly, samples are electrophoresed in a sodium dodecylsulfate polyacrylamide gel. The proteins in the gel are electrophoretically transferred to nitrocellulose paper. Protein blot filters may be prepared by filtering supernatant samples or concentrates through nitrocellulose filters using, for example, a Minifold (Schleicher & Schuell, Keene, N.
  • Colony filters may be prepared by growing colonies on a nitrocellulose filter that has been laid across an appropriate growth medium. In this method, a solid medium is preferred. The cells are allowed to grow on the filters for at least 12 hours. The cells are removed from the filters by washing with an appropriate buffer that does not remove the proteins bound to the filters.
  • a preferred buffer comprises 25 mM Tris-base, 19 mM glycine, pH 8.3, 20% methanol.
  • Transferrin fusion proteins of the present invention may be labeled with a radioisotope or other imaging agent and used for in vivo diagnostic purposes.
  • Preferred radioisotope imaging agents include iodine-125 and technetium-99, with technetium-99 being particularly preferred.
  • Methods for producing protein-isotope conjugates are well known in the art, and are described by, for example, Eckelman et al. (U.S. Pat. No. 4,652,440), Parker et al. (WO 87/05030) and Wilber et al. (EP 203,764).
  • the transferrin fusion proteins may be bound to spin label enhancers and used for magnetic resonance (MR) imaging.
  • MR magnetic resonance
  • Suitable spin label enhancers include stable, sterically hindered, free radical compounds such as nitroxides. Methods for labeling ligands for MR imaging are disclosed by, for example, Coffman et al. (U.S. Pat. No. 4,656,026).
  • Detection of a transferrin fusion protein of the present invention can be facilitated by coupling (i.e., physically linking) the therapeutic protein to a detectable substance.
  • detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, and radioactive materials.
  • suitable enzymes include horseradish peroxidase, alkaline phosphatase, ⁇ -galactosidase, or acetylcholinesterase;
  • suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin;
  • suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin;
  • an example of a luminescent material includes luminol;
  • examples of bioluminescent materials include luciferase, luciferin, and aequorin, and examples of suitable radioactive material include 125 I, 131 I, 35 S or 3 H.
  • various immunoassays known in the art can be used, including but not limited to, competitive and non-competitive assay systems using techniques such as radioimmunoassays, ELISA (enzyme linked immunosorbent assay), sandwich immunoassays, immunoradiometric assays, gel diffusion precipitation reactions, immunodiffusion assays, in situ immunoassays (using colloidal gold, enzyme or radioisotope labels, for example), western blots, precipitation reactions, agglutination assays (e.g., gel agglutination assays), complement fixation assays, immunofluorescence assays, protein A assays, and immunoelectrophoresis assays, etc.
  • competitive and non-competitive assay systems using techniques such as radioimmunoassays, ELISA (enzyme linked immunosorbent assay), sandwich immunoassays, immunoradiometric assays, gel diffusion precipitation reactions, immunodiffusion assays, in situ immuno
  • the binding of the transferrin fusion protein is detected by detecting a label on the transferrin fusion protein.
  • the transferrin fusion protein is detected by detecting binding of a secondary antibody or reagent that interacts with the transferrin fusion protein.
  • the secondary antibody or reagent is labeled. Many means are known in the art for detecting binding in an immunoassay and are within the scope of the present invention.
  • Fusion proteins of the invention may also be detected by assaying for the activity of the therapeutic protein moiety. Specifically, transferrin fusion proteins of the invention may be assayed for functional activity (e.g., biological activity or therapeutic activity) using assays known to one of ordinary skill in the art. Additionally, one of skill in the art may routinely assay fragments of a therapeutic protein corresponding to a therapeutic protein portion of a fusion protein of the invention, for activity using well-known assays. Further, one of skill in the art may routinely assay fragments of a modified transferrin protein for activity using assays known in the art.
  • functional activity e.g., biological activity or therapeutic activity
  • various immunoassays known in the art can be used, including but not limited to, competitive and non-competitive assay systems using techniques such as radioimmunoassays, ELISA (enzyme linked immunosorbent assay), sandwich immunoassays, immunoradiometric assays, gel diffusion precipitation reactions, immunodiffusion assays, in situ immunoassays (using colloidal gold, enzyme or radioisotope labels, for example), western blots, precipitation reactions, agglutination assays (e.g., gel agglutination assays), complement fixation assays, immunofluorescence assays, protein A assays, and immunoelectrophoresis assays, etc.
  • competitive and non-competitive assay systems using techniques such as radioimmunoassays, ELISA (enzyme linked immunosorbent assay), sandwich immunoassays, immunoradiometric assays, gel diffusion precipitation reactions, immunodiffusion assays, in situ immuno
  • antibody binding is detected by detecting a label on the primary antibody.
  • the primary antibody is detected by detecting binding of a secondary antibody or reagent to the primary antibody.
  • the secondary antibody is labeled. Many means are known in the art for detecting binding in an immunoassay and are within the scope of the present invention.
  • binding partner e.g., a receptor or a ligand
  • binding to that binding partner by a transferrin fusion protein containing that therapeutic protein as the therapeutic protein portion of the fusion can be assayed, e.g., by means well-known in the art, such as, for example, reducing and non-reducing gel chromatography, protein affinity chromatography, and affinity blotting. Other methods will be known to the skilled artisan and are within the scope of the invention.
  • the present invention further provides methods for producing a modified fusion protein of the invention using nucleic acid molecules herein described.
  • the production of a recombinant form of a protein typically involves the following steps.
  • a nucleic acid molecule is first obtained that encodes a transferrin fusion protein of the invention.
  • the nucleic acid molecule is then preferably placed in operable linkage with suitable control sequences, as described above, to form an expression unit containing the protein open reading frame.
  • the expression unit is used to transform a suitable host and the transformed host is cultured under conditions that allow the production of the recombinant protein.
  • the recombinant protein is isolated from the medium or from the cells; recovery and purification of the protein may not be necessary in some instances where some impurities may be tolerated.
  • each of the foregoing steps can be accomplished in a variety of ways.
  • the construction of expression vectors that are operable in a variety of hosts is accomplished using appropriate replicons and control sequences, as set forth above.
  • the control sequences, expression vectors, and transformation methods are dependent on the type of host cell used to express the gene and were discussed in detail earlier and are otherwise known to persons skilled in the art.
  • Suitable restriction sites can, if not normally available, be added to the ends of the coding sequence so as to provide an excisable gene to insert into these vectors.
  • a skilled artisan can readily adapt any host/expression system known in the art for use with the nucleic acid molecules of the invention to produce a desired recombinant protein.
  • any expression system may be used, including yeast, bacterial, animal, plant, eukaryotic and prokaryotic systems.
  • yeast, mammalian cell culture and transgenic animal or plant production systems are preferred.
  • yeast systems that have been modified to reduce native yeast glycosylation, hyper-glycosylation or proteolytic activity may be used.
  • Secreted, biologically active, modified transferrin fusion proteins may be isolated from the medium of host cells grown under conditions that allow the secretion of the biologically active fusion proteins.
  • the cell material is removed from the culture medium, and the biologically active fusion proteins are isolated using isolation techniques known in the art. Suitable isolation techniques include precipitation and fractionation by a variety of chromatographic methods, including gel filtration, ion exchange chromatography and affinity chromatography.
  • a particularly preferred purification method is affinity chromatography on an iron binding or metal chelating column or an immunoaffinity chromatography using an antigen directed against the transferrin or therapeutic protein of the polypeptide fusion.
  • the antigen is preferably immobilized or attached to a solid support or substrate.
  • a particularly preferred substrate is CNBr-activated Sepharose (Pharmacia LKB Technologies, Inc., Piscataway, N.J.).
  • Particularly useful methods of elution include changes in pH, wherein the immobilized antigen has a high affinity for the transferrin fusion protein at a first pH and a reduced affinity at a second (higher or lower) pH; changes in concentration of certain chaotropic agents; or through the use of detergents.
  • BBB Blood Brain Barrier
  • the modified transferrin fusion proteins may be used as a carrier to deliver a molecule or small molecule therapeutic complexed to the ferric ion of transferrin to the inside of a cell or across the blood brain barrier.
  • the transferrin will typically be engineered or modified to inhibit, prevent or remove glycosylation to extend the serum half-life of the transferrin fusion protein and/or therapeutic protein.
  • the addition of a targeting peptide is specifically contemplated to further target the transferrin fusion protein to a particular cell type, e.g., a cancer cell.
  • the iron-containing, anti-anemic drug, ferric-sorbitol-citrate complex is loaded onto a modified Tf fusion protein of the invention.
  • Ferric-sorbitol-citrate (FSC) has been shown to inhibit proliferation of various murine cancer cells in vitro and cause tumor regression in vivo, while not having any effect on proliferation of non-malignant cells (Poljak-Blazi et al. (June 2000) Cancer Biotherapy and Radiopharmaceuticals (United States), 15/3:285-293).
  • the antineoplastic drug adriamycin (Doxorubicin) and/or the chemotherapeutic drug bleomycin, both of which are known to form complexes with ferric ion is loaded onto a transferrin fusion protein of the invention.
  • a salt of a drug for instance, a citrate or carbonate salt, may be prepared and complexed with the ferric iron that is then bound to Tf.
  • transferrin modified to carry at least one anti-tumor agent may provide a means of increasing agent exposure or load to the tumor cells.
  • modified fusion proteins comprising a modified transferrin of the invention may be administered to a patient in need thereof using standard administration protocols.
  • the modified Tf fusion proteins of the present invention can be provided alone, or in combination, or in sequential combination with other agents that modulate a particular pathological process.
  • two agents are said to be administered in combination when the two agents are administered simultaneously or are administered independently in a fashion such that the agents will act at the same or near the same time.
  • the fusion proteins of the present invention can be administered via parenteral, subcutaneous, intravenous, intramuscular, intraperitoneal, transdermal and buccal routes.
  • an agent may be administered locally to a site of injury via microinfusion.
  • administration may be noninvasive by either the oral, inhalation, nasal, or pulmonary route.
  • the dosage administered will be dependent upon the age, health, and weight of the recipient, kind of concurrent treatment, if any, frequency of treatment, and the nature of the effect desired.
  • the present invention further provides compositions containing one or more fusion proteins of the invention. While individual needs vary, determination of optimal ranges of effective amounts of each component is within the skill of the art. Typical dosages comprise about 1 pg/kg to about 100 mg/kg body weight. The preferred dosages for systemic administration comprise about 100 ng/kg to about 100 mg/kg body weight or about 100-200 mg of protein/dose. The preferred dosages for direct administration to a site via microinfusion comprise about 1 ng/kg to about 1 mg/kg body weight. When administered via direct injection or microinfusion, modified fusion proteins of the invention may be engineered to exhibit reduced or no binding of iron to prevent, in part, localized iron toxicity.
  • compositions of the present invention may contain suitable pharmaceutically acceptable carriers comprising excipients and auxiliaries that facilitate processing of the active compounds into preparations which can be used pharmaceutically for delivery to the site of action.
  • suitable formulations for parenteral administration include aqueous solutions of the active compounds in water-soluble form, for example, water-soluble salts.
  • suspensions of the active compounds as appropriate oily injection suspensions may be administered.
  • Suitable lipophilic solvents or vehicles include fatty oils, for example, sesame oil, or synthetic fatty acid esters, for example, ethyl oleate or triglycerides.
  • Aqueous injection suspensions may contain substances which increase the viscosity of the suspension include, for example, sodium carboxymethyl cellulose, sorbitol and dextran.
  • the suspension may also contain stabilizers. Liposomes can also be used to encapsulate the agent for delivery into the cell.
  • the pharmaceutical formulation for systemic administration according to the invention may be formulated for enteral, parenteral or topical administration. Indeed, all three types of formulations may be used simultaneously to achieve systemic administration of the active ingredient.
  • Suitable formulations for oral administration include hard or soft gelatin capsules, pills, tablets, including coated tablets, elixirs, suspensions, syrups or inhalations and controlled release forms thereof.
  • the pharmaceutical composition of the present invention can be in unit dosage form, e.g. as tablets or capsules.
  • the composition is sub-divided in unit dose containing appropriate quantities of the active ingredient;
  • the unit dosage forms can be packaged compositions, for example, packeted powders, vials, ampoules, prefilled syringes or sachets containing liquids.
  • the unit dosage form can be, for example, a capsule or tablet itself, or it can be the appropriate number of any such compositions in package form.
  • the dosage to be used in the treatment must be subjectively determined by the physician.
  • the fusion proteins of this invention may be used alone or in combination, or in combination with other therapeutic or diagnostic agents.
  • the compounds of this invention may be co-administered along with other compounds typically prescribed for these conditions according to generally accepted medical practice.
  • the compounds of this invention can be utilized in vivo, ordinarily in mammals, such as humans, sheep, horses, cattle, pigs, dogs, cats, rats and mice, or in vitro.
  • transgenic non-human animals that contain a modified transferrin fusion construct with increased serum half-life increased serum stability or increased bioavailability of the instant invention is contemplated in one embodiment of the present invention.
  • lactoferrin may be used as the Tf portion of the fusion protein so that the fusion protein is produced and secreted in milk.
  • mice such as domesticated mammals including cows, pigs, goats, horses, cattle, and sheep
  • animals which express large quantities of exogenous proteins in an easily harvested form (e.g., expression into the milk or blood)
  • animals with increased weight gain, feed efficiency, carcass composition, milk production or content, disease resistance and resistance to infection by specific microorganisms and the production of animals having enhanced growth rates or reproductive performance.
  • Animals which contain exogenous DNA sequences in their genome are referred to as transgenic animals.
  • transgenic animals The most widely used method for the production of transgenic animals is the microinjection of DNA into the pronuclei of fertilized embryos (Wall et al., J. Cell. Biochem. 49:113 [1992]).
  • Other methods for the production of transgenic animals include the infection of embryos with retroviruses or with retroviral vectors. Infection of both pre- and post-implantation mouse embryos with either wild-type or recombinant retroviruses has been reported (Janenich, Proc. Natl. Acad. Sci. USA 73:1260 [1976]; Janenich et al., Cell 24:519 [1981]; Guatemalamann et al., Proc. Natl. Acad. Sci.
  • PCT International Application WO 90/08832 [1990]; and Haskell and Bowen, Mol. Reprod. Dev., 40:386 [1995].
  • PCT International Application WO 90/08832 describes the injection of wild-type feline leukemia virus B into the perivitelline space of sheep embryos at the 2 to 8 cell stage. Fetuses derived from injected embryos were shown to contain multiple sites of integration.
  • U.S. Pat. No. 6,291,740 (issued Sep. 18, 2001) describes the production of transgenic animals by the introduction of exogenous DNA into pre-maturation oocytes and mature, unfertilized oocytes (i.e., pre-fertilization oocytes) using retroviral vectors which transduce dividing cells (e.g., vectors derived from murine leukemia virus [MLV]).
  • retroviral vectors which transduce dividing cells (e.g., vectors derived from murine leukemia virus [MLV]).
  • MMV murine leukemia virus
  • U.S. Pat. No. 6,281,408 (issued Aug. 28, 2001) describes methods for producing transgenic animals using embryonic stem cells. Briefly, the embryonic stem cells are used in a mixed cell co-culture with a morula to generate transgenic animals. Foreign genetic material is introduced into the embryonic stem cells prior to co-culturing by, for example, electroporation, microinjection or retroviral delivery. ES cells transfected in this manner are selected for integrations of the gene via a selection marker such as neomycin.
  • a selection marker such as neomycin.
  • U.S. Pat. No. 6,271,436 (issued Aug. 7, 2001) describes the production of transgenic animals using methods including isolation of primordial germ cells, culturing these cells to produce primordial germ cell-derived cell lines, transforming both the primordial germ cells and the cultured cell lines, and using these transformed cells and cell lines to generate transgenic animals.
  • the efficiency at which transgenic animals are generated is greatly increased, thereby allowing the use of homologous recombination in producing transgenic non-rodent animal species.
  • modified transferrin fusion constructs for gene therapy wherein a modified transferrin protein or transferrin domain is joined to a therapeutic protein or peptide is contemplated in one embodiment of this invention.
  • the modified transferrin fusion constructs with increased serum half-life or serum stability of the instant invention are ideally suited to gene therapy treatments.
  • gene therapy via injection of an adenovirus vector containing a gene encoding a soluble fusion protein consisting of cytotoxic lymphocyte antigen 4 (CTLA4) and the Fc portion of human immunoglubulin G1 was recently shown in Ijima et al. (Jun. 10, 2001) Human Gene Therapy (United States) 12/9:1063-77.
  • CTL4 cytotoxic lymphocyte antigen 4
  • a murine model of type II collagen-induced arthritis was successfully treated via intraarticular injection of the vector.
  • U.S. Pat. No. 6,225,290 provides methods and constructs whereby intestinal epithelial cells of a mammalian subject are genetically altered to operatively incorporate a gene which expresses a protein which has a desired therapeutic effect.
  • Intestinal cell transformation is accomplished by administration of a formulation composed primarily of naked DNA, and the DNA may be administered orally.
  • Oral or other intragastrointestinal routes of administration provide a simple method of administration, while the use of naked nucleic acid avoids the complications associated with use of viral vectors to accomplish gene therapy.
  • the expressed protein is secreted directly into the gastrointestinal tract and/or blood stream to obtain therapeutic blood levels of the protein thereby treating the patient in need of the protein.
  • the transformed intestinal epithelial cells provide short or long term therapeutic cures for diseases associated with a deficiency in a particular protein or which are amenable to treatment by overexpression of a protein.
  • U.S. Pat. No. 6,187,305 provides methods of gene or DNA targeting in cells of vertebrate, particularly mammalian, origin. Briefly, DNA is introduced into primary or secondary cells of vertebrate origin through homologous recombination or targeting of the DNA, which is introduced into genomic DNA of the primary or secondary cells at a preselected site.
  • U.S. Pat. No. 6,140,111 (issued Oct. 31, 2000) describes retroviral gene therapy vectors.
  • the disclosed retroviral vectors include an insertion site for genes of interest and are capable of expressing high levels of the protein derived from the genes of interest in a wide variety of transfected cell types.
  • retroviral vectors lacking a selectable marker, thus rendering them suitable for human gene therapy in the treatment of a variety of disease states without the co-expression of a marker product, such as an antibiotic.
  • These retroviral vectors are especially suited for use in certain packaging cell lines.
  • the ability of retroviral vectors to insert into the genome of mammalian cells have made them particularly promising candidates for use in the genetic therapy of genetic diseases in humans and animals.
  • Genetic therapy typically involves (1) adding new genetic material to patient cells in vivo, or (2) removing patient cells from the body, adding new genetic material to the cells and reintroducing them into the body, i.e., in vitro gene therapy.
  • Discussions of how to perform gene therapy in a variety of cells using retroviral vectors can be found, for example, in U.S. Pat. No. 4,868,116, issued Sep. 19, 1989, and 4,980,286, issued Dec. 25, 1990 (epithelial cells), WO89/07136 published Aug. 10, 1989 (hepatocyte cells), EP 378,576 published Jul. 25, 1990 (fibroblast cells), and WO89/05345 published Jun. 15, 1989 and WO/90/06997, published Jun. 28, 1990 (endothelial cells), the disclosures of which are incorporated herein by reference.
  • kits containing transferrin fusion proteins which can be used, for instance, for the therapeutic or non-therapeutic applications.
  • the kit comprises a container with a label. Suitable containers include, for example, bottles, vials, and test tubes. The containers may be formed from a variety of materials such as glass or plastic.
  • the container holds a composition which includes a transferrin fusion protein that is effective for therapeutic or non-therapeutic applications, such as described above.
  • the active agent in the composition is the therapeutic protein.
  • the label on the container indicates that the composition is used for a specific therapy or non-therapeutic application, and may also indicate directions for either in vivo or in vitro use, such as those described above.
  • the kit of the invention will typically comprise the container described above and one or more other containers comprising materials desirable from a commercial and user standpoint, including buffers, diluents, filters, needles, syringes, and package inserts with instructions for use.
  • T-20 is a HIV fusogenic inhibitor peptide with the following amino acid sequence: YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF (SEQ ID NO: 17).
  • the present invention provides fusion proteins comprising T-20 peptide and modified transferrin (mTf) with increased half-life and pharmaceutical compositions of such fusion proteins for the treatment of diseases associated with the transmission of a virus.
  • mTf modified transferrin
  • the example described below may also be used to generate transferrin fusion proteins with analogs of the T-20 peptides.
  • the transferrin fusion protein with anti-HIV activity of the present invention was produced by fusing T-20 to modified transferrin (mTf) using Saccharomyces cerevisiae . Accordingly, in the first step, SEQ ID NO: 17 was back translated into DNA codon optimized for Saccharomyces cerevisiae and used to produce fusion constructs of T-20 at the N- or C-terminus of mTf .
  • T-20 is fused to the 5′ end of mTf using overlapping primers with restriction site overhangs at each end, such as XbaI and KpnI sites for ligation into an appropriate vector.
  • overlapping primers with other restriction site overhangs could be generated or the primers could be annealed to adapters with appropriate restriction site overhangs for ligation into a specifically designed vector.
  • a vector is specifically designed with restriction sites such as XbaI and KpnI sites to allow fusion of therapeutic molecules into the N-terminus of mTf.
  • the primers are annealed and cloned into this vector using the XbaI and KpnI sites or other appropriate restriction sites at the 5′ end of the modified transferrin (mTf) vector.
  • the cassette encoding the T-20/mTf fusion protein is then removed from the vector and cloned into a yeast vector for protein expression
  • he overlapping primers have the following sequences: P0038: (SEQ ID NO: 18) CTAGAGAAAAGGTACACTAGCTTAATACAC P0039: (SEQ ID NO: 19) TGCGATTCTTCAATTAAGGAGTGTATTAAGCTAGTGTACCTTTTCT P0040: (SEQ ID NO: 20) TCCTTAATTGAAGAATCGCAAAACCAGCAAGAAAAGAATG P0041: (SEQ ID NO: 21) TAATTCCAATAATTCTTGTTCATTCTTTTCTTGCTGGTTT P0042: (SEQ ID NO: 22) AACAAGAATTATTGGAATTAGATAAATGGGCAAGTTTGTGGAATTGGTTT GTAC P0043: (SEQ ID NO: 23) AAACCAATTCCACAAACTTGCCCATTTATC
  • the primers are annealed at 65° C. and ligated into the specifically designed vector pREX5004, cut with XbaI and KpnI to create pREX5016.
  • the correct clone is bulked up and digested with another pair of appropriate restriction enzymes such as Psil and Agel to remove the cassette encoding the T-20/mTf fusion protein out of pREX5016.
  • the cassette is ligated into a yeast vector, such as pSAC3, cut with PsiI and AgeI.
  • pSAC3 containing the T-20/mTf N-terminus fusion protein is then electroporated into yeast for protein production.
  • T-20 fusion is fused to the 3′ end of T-20 using overlapping primers with restriction site overhangs, such as SalI and HindIII or other restriction enzymes, at each end.
  • restriction site overhangs such as SalI and HindIII or other restriction enzymes
  • this fragment is cloned into a specifically designed vector, pREX5001, using restriction sites such as SalI and HindIII sites.
  • the plasmid is cut with SalI and HindIII and the fragment is sub-cloned into pREX5004 which is specifically designed to with unique SalI and HindIII sites to allow fusion of therapeutic protein to the C-terminus of mTf.
  • the resulting plasmid is pREX5017.
  • pREX5017 is then cut with appropriate enzymes such as Psil and Agel to remove the T-20/mTf cassette out of the vector.
  • the T-20/m-Tf cassette is sub-cloned into a yeast vector, such as pSAC3, for expression in yeast.
  • the following overlapping primers with restriction overhangs are designed for producing the T-20 fusion to the C-terminus of mTf:
  • the overlapping primers have the following sequences: P0044: (SEQ ID NO: 24) TCGACCTTACACTAGCTTAATACAC P0045: (SEQ ID NO: 25) TGCGATTCTTCAATTAAGGAGTGTATTAAGCTAGTGTAAGG P0040: (SEQ ID NO: 26) TCCTTAATTGAAGAATCGCAAAACCAGCAAGAAAAGAATG P0041: (SEQ ID NO: 27) TAATTCCAATAATTCTTGTTCATTCTTTTCTTGCTGGTTT P0046: (SEQ ID NO: 28) AACAAGAATTATTGGAATTAGATAAATGGGCAAGTTTGTGGAATTGGTTT TAATA P0047: (SEQ ID NO: 29) AGCTTATTAAAACCAATTCCACAAACTTGCCCATTTATC
  • the primers are annealed at 65° C. and ligated into the specifically designed vector cut with SalI and HindIII. Following identification of a correct clone by sequencing, the correct clone is bulked up and digested with another pair of appropriate restriction enzymes such as Psil and Agel to remove the cassette encoding the T-20/mTf C-terminus fusion protein out of the vector.
  • This cassette is ligated into a yeast vector, such as pSAC3, cut with Psil and Agel.
  • pSAC3 containing the T-20/mTf fusion protein is then electroporated into yeast for protein production.
  • Modifications are made at the 3′ end of mTf to determine if they would effect an increase in fusion expression levels, T-20 fusion activity, and/or improve mobility of the peptide at the C terminus of mTf.
  • proline at the 3′ end of mTf is removed.
  • the adjoining two arginine residues are removed since they may present a potential Kex2p protease cleavage site.
  • the deleted sequence is shown in the alignment below of unmodified 3′ T-20 mTf fusion insert (pREX5017, SEQ ID NO: 31) and 3′ T-20 mTf fusion insert with RRP deletion (pREX5032, SEQ ID NO: 30):
  • the RRP sequence is deleted using primers homologous to adjoining regions of the sequence.
  • the primers used for generating the deletion are: P0060: (SEQ ID NO: 32) TCATCACTCCTGGAAGCCTGCACTTTCTACACTAGCTTAATACACTCCTT P0061: (SEQ ID NO: 33) AAGGAGTGTATTAAGCTAGTGTAGAAAGTGCAGGCTTCCAGGAGTGATGA
  • a mutagenic PCR reaction is performed using the external primers and pREX5017 as the template to generate a product missing the 9 bases coding for RRP.
  • This product is then cut with SphI/HindIII and cloned into SphI/HindIII cut pREX5017 to make pREX5032.
  • pREX5032 was then cut with AgeI/Psil, sub-cloned into a yeast vector such as pSAC3 and transformed into yeast for protein expression.
  • the disulfide bond that stretches between Cys402 and Cys674 in the mTF molecule is removed. This is accomplished by mutating both cysteine residues to glycine residues.
  • Cys402 is mutated to Gly.
  • the mutagenic primers are: P0064: (SEQ ID NO: 34) TTGTCTACATAGCGGGCAAGGGTGGTCTGGTGCCTGTCTTG P0065: (SEQ ID NO: 35) CAAGACAGGCACCAGACCACCCTTGCCCGCTATGTAGACAA
  • a PCR reaction is performed using the external primers and pREX5017 as the template to generate the product with the desired mutation. This product is then cut with HpaI/PstI and cloned back into pREX5017 making a Gly402 intermediate, pREX5039.
  • Cys674 is mutated into Gly674 following the same procedure and using pREX5004 as a template and the following primers:
  • P0069 (SEQ ID NO: 37) CTTATTAAGGTCGACGGAAAGTACCGGCTTCCAGGAGTGATGAGGTGG
  • the resulting product is cut with SphI/HindIII and sub-cloned into the new Gly402 intermediate, pREX5039, making pREX5038.
  • This plasmid does not contain the T-20 peptide making it useful in the future for other mTf fusions.
  • the SalI/Agel fragment of pREX5017 is cloned to form pREX5034.
  • pREX5034 was then cut with AgeI/PsiI.
  • the cassette is sub-cloned into a yeast vector, such as pSAC3, and transformed into yeast for protein expression.
  • RRP deletion and the C402-C674 disulfide deletion are combined.
  • an intermediate plasmid, pREX5041 is made in the manner as pREX5032 with the exception that the Cys674 mutation was present in the primers.
  • the following primers are used: P0066: (SEQ ID NO: 42) TCCACCTCATCACTCCTGGAAGCCGGCACTTTCTACACTAGCTTAATA P0067: (SEQ ID NO: 43) GTGTATTAAGCTAGTGTAGAAAGTACCGGCTTCCAGGAGTGATGAGGT
  • pREX5041 is then cut with SphI/HindIII and sub-cloned into pREX5039 to create pREX5033.
  • pREX5033 is then cut with AgeI/PsiI.
  • the cassette is sub-cloned into a yeast vector, such as pSAC3, and then transformed into yeast for protein expression.
  • the following alignment of the mTf 3′ T-20 fusion of pREX5033 with pREX5017 shows the mutations of the resulting product.
  • EMP1 (SEQ ID NO: 11) has been shown to mimic EPO activity by causing dimerization of the EPO receptor.
  • the peptide which is cyclic, has no homology to EPO.
  • the peptide has to act in concert with another peptide, i.e. as a dimer, such that two copies of the receptor are brought in close enough proximity to form an active complex.
  • the peptide dimer suffers from short half life and would benefit from the longevity that fusion to transferrin would give.
  • the present invention provides fusion protein with EPO mimetic activity.
  • the fusion protein of the present invention comprises EMP1 peptide (SEQ ID NO: 11) and modified transferrin (mTf) with increased half-life.
  • EMP1 peptide SEQ ID NO: 11
  • mTf modified transferrin
  • the present invention also provides pharmaceutical compositions of such fusion proteins for the treatment of diseases associated with low or defective red blood cell production.
  • the initial fusions to mTf comprises fusions to the N-, C-, and N- and C-termini of mTf.
  • the individual fusions will bind the receptor but not cause activation of the receptor.
  • the dual fusion one of which must be a different codon composition than the other to prevent recombination, will enable binding to the receptor and cause activation.
  • N 1 His289 286-292
  • N 2 Asp166 162-170
  • the equivalent insertion sites on the C domain may also be used to make the molecule multivalent. This is done using a variety of the potential insert sites indicated above either on just the N or C domain or by a combination of sites on both domains.
  • EMP1 peptides (SEQ ID NO: 11) are engineered into the transferrin scaffold using the encoding nucleic acids of the peptides and mTf.
  • a EMP1 peptide is engineered into mTf between His289 and Gly290.
  • two overlapping mutagenic primers are synthesized (see below).
  • a vector containing the nucleic acid encoding mTf, such as pREX5010 as a template, reactions are performed with each mutagenic primer and an external primer from the 5′ or 3′ of the Tf cDNA. The products from these two reactions were then mixed and a further reaction performed with the external primers to join the two products together.
  • the His289-Gly290 insert PCR product is digested with XbaI and HpaI for ligation into XbaI/HpaI digested pREX50 10.
  • the cassette containing the EMP1/mTF fusion protein is cut out of the vector with appropriate restriction enzymes and ligated into a yeast vector, such as pSAC3.
  • pSAC3 is transformed into yeast for protein expression.
  • GLP-1 is a peptide that regulates insulin secretion. It possesses anti-diabetic activity in human subjects suffering diabetes, especially type II diabetes. Like other peptides, GLP-1 has a short plasma half-life in humans.
  • the present invention provides fusion proteins with GLP-1 fused to mTf with increased half-life and pharmaceutical compositions of such fusion proteins for the treatment of diseases associated with abnormal glucose levels.
  • GLP-1(7-36) and GLP-1(7-37) may be used.
  • SEQ ID NO: 48 haegtftsdvssylegqaakefiawlvkgr
  • SEQ ID NO: 66 haegtftsdvssylegqaakefiawlvkgrg
  • the peptide sequence of GLP-1(7-36) is back translated into DNA and codon optimized for yeast: catgctgaaggtacttttacttctgatgtttcttcttatttggaaggtcaagctgctaaagaa h a e q t f t s d v s s y l e g q a a k e tttattgcttggttggtttaaaggtaga (SEQ ID NO: 49) f i a w l v k r (SEQ ID NO: 48)
  • the primers used are specifically designed to form a 5′ XbaI and 3′ KpnI sticky ends after annealing and be directly ligated into XbaI/KpnI cut pREX5004, just 5′ of the end of the mating factor V leader sequence and at the N-terminus of mTf.
  • other sticky ends may be engineered for ligations into other vectors.
  • This vector is designated pREX5028.
  • the cassette is cut out of pREX5028 with PsiI/Agel and sub-cloned into PsiI/Agel cut yeast vector, such as PSAC3, to make the pREX5030.
  • pREX5030 is transformed into SMD1168 (his, pep4) and mut + and mut S clones selected. Stocks were made at 100D/mL:
  • ⁇ -IFN is effective in the treatment of various diseases such as but not limited to multiple sclerosis, brain tumor, skin cancer, and hepatitis B and C. Like most cytokines, ⁇ -IFN has a short circulation half-life.
  • the present invention provides fusion proteins comprising ⁇ -IFN fused to mTf with increased half-life and efficacy in patients. This example describes the steps in generating ⁇ -IFN/mTf fusion protein.
  • IFN ⁇ -1 is fused to modified transferrin at both the N- and C-termini.
  • the IFN ⁇ -1 clone is obtained from ATCC (no. 39517).
  • Specifically designed primers are used to confirm the DNA sequence of the IFN ⁇ -1 clone. These primers are external to the IFN ⁇ -1 DNA sequence and designed to read in from the vector such that the full sequence of the clone were obtained.
  • the primers used are: P0070 (SEQ ID NO: 54) GCTATGACCAACAAGTGTCTC P0071 (SEQ ID NO: 55) CGCACCTGTGGCGCCGGTGATG N-Terminal Fusion
  • primers are designed for fusion of IFN ⁇ -1 to mTf.
  • the N-terminal fusion is a two step process. A straight fusion using primers with XbaI and KpnI sites would destroy the KpnI site and clip the beginning of mTf.
  • a linker primers P0082 (nucleotides 18-48 of SEQ ID NO: 56) and P0083 (nucleotides 17-39 SEQ ID NO: 57), is designed to create an internal KpnI site in the 3′ of IFN ⁇ -1, by a single silent mutation of bp 486 from T to G (bold), and with a 5′ XbaI overhang and 3′ GTAC which would anneal with a KpnI site. The overhang destroys the existing KpnI site in pREX5004.
  • linkers are annealed and ligated into pREX5004 cut with XbaI/KpnI creating an intermediate vector with mTf untouched and a KpnI site that could be used to fuse the IFN ⁇ -L gene at the N-terminus of mTf.
  • a second set of primers, P0084 (SEQ ID NO: 61) and P0085 (SEQ ID NO: 62), are designed to tailor the ends of the IFN ⁇ -L gene by mutagenic PCR for subsequent insertion into the intermediate vector via the XbaI and KpnI sites.
  • a XbaI/KpnI digest of this tailored gene removes the last 5 amino acids of IFN ⁇ -1; however, these are already engineered into the intermediate vector.
  • the resulting construct, pREX5048 is created by ligating the IFN ⁇ -L gene cut with XbaI/KpnI into the XbaI/KpnI cut intermediate vector.
  • the pREX5048 construct was created, it was sequenced to confirm correct insertion.
  • the expression cassette, as a PsiI/AgeI fragment, was then sub-cloned into PsiI/AgeI cut yeast vector, pSAC3, to make the pREX5050.
  • P0086 SEQ ID NO: 63
  • P0087 SEQ ID NO: 64
  • the newly tailored product is ligated into SalI/HindIII cut pREX5004 to create pREX5049.
  • the pREX5049 construct is created, it is sequenced to confirm correct insertion.
  • the expression cassette as a PsiI/Agel fragment, is then sub-cloned into PsiI/Agel cut yeast vector, such as pSAC3, to make pREX5051.
  • ⁇ -IFN-1 (GenBank Acc. 002176) is made more stable and soluble by mutating Cys17 into Ser.
  • the mutation of Cys17 into Ser can be performed by routine mutagenic reactions such as a mutagenic PCR reaction using specifically designed primers and the nucleic acid encoding ⁇ -IFN-1 as the template.
  • the ⁇ -IFN-1 is modified to prevent glycosylation by modifying the N-linked glycosylation site, NXS/T.
  • N could be mutagenized to Q and S/T could be mutagenized to Ala or other amino acid acids.
  • Such mutagenesis could be performed with mutagenic PCR reaction using specifically designed primers and the nucleic acid encoding ⁇ -IFN-1 as the template.
  • Clostridial neurotoxins are poisonous substance.
  • Synaptotagmin I is a broad acting receptor of Clostridium botulinum neurotoxin serotypes.
  • Amino acids 1-53 (SEQ ID NO: 4) of synaptotagmin I is responsible for binding to various neurotoxin serotypes.
  • a soluble toxin receptor such as amino acids 1-53, has a short half-life.
  • the present invention provides fusion protein comprising amino acids 1-53 fused mTf with increased half-life as compared to the soluble toxin receptor having SEQ ID NO: 1-53.
  • fusion proteins with anti-toxin activity and increased half-life.
  • a fusion protein comprising modified Tf and a peptide consisting of amino acids 1-53 (SEQ ID NO: 4) of synaptotagmin I, is produced by fusing one or more copies of the nucleotide sequence encoding the peptide to the nucleotide sequence of Tf to produce a fusion protein with a peptide fused to the N- or C-terminus of Tf.
  • the vector pREX5010 with the modified transferrin cDNA is digested with the restriction enzymes XbaI/KpnI for insertion at the 5′ end and SalI/Hind III for insertion at the 3′ end.
  • oligos For the 5′ insertion, two overlapping oligos that form an XbaI overhang at the 5′ end and a KpnI overhang at the 3′ end of the nucleic acid encoding SEQ ID NO: 4 are synthesized. These oligos are then annealed together and ligated into the XbaI/KpnI digested pREX5010 vector.
  • Transformation, selection, and expression are then performed in yeast.

Abstract

Modified fusion proteins of transferrin and therapeutic proteins or peptides including soluble toxin receptors, with increased serum half-life or serum stability are disclosed. Preferred fusion proteins include those modified so that the transferrin moiety exhibits no or reduced glycosylation, binding to iron and/or binding to the transferrin receptor.

Description

    RELATED APPLICATIONS
  • This application is a Divisional Application of U.S. patent application Ser. No. 10/378,094, filed Mar. 4, 2003, which is a Continuation-In-Part Application of 10/231,494, filed Aug. 30, 2002, which claims the benefit of U.S. Provisional Application 60/315,745, filed Aug. 30, 2001 and U.S. Provisional Application 60/334,059, filed Nov. 30, 2001, all of which are herein incorporated by reference in their entirety. This application also claims the benefit of U.S. Provisional Application 60/406,977, filed Aug. 30, 2002, which is herein incorporated by reference in its entirety.
  • FIELD OF THE INVENTION
  • The present invention relates to therapeutic proteins or peptides and soluble toxin receptor fragments with extended serum stability or serum half-life fused to or inserted in a transferrin molecule modified to reduce or inhibit glycosylation, iron binding and/or transferrin receptor binding. Specifically, the present invention includes IFN-β, GLP-1, EMP1, and T-20 fused to or inserted in a transferrin molecule or a modified transferrin molecule. The present invention also includes an anti-toxin fusion protein comprising a fragment of synaptotagmin 1 fused to or inserted in a transferrin molecule or a modified transferrin molecule.
  • BACKGROUND OF THE INVENTION
  • Therapeutic proteins or peptides in their native state or when recombinantly produced are typically labile molecules exhibiting short periods of serum stability or short serum half-lives. In addition, these molecules are often extremely labile when formulated, particularly when formulated in aqueous solutions for diagnostic and therapeutic purposes.
  • Few practical solutions exist to extend or promote the stability in vivo or in vitro of proteinaceous therapeutic molecules. Polyethylene glycol (PEG) is a substance that can attach to a protein, resulting in longer-acting, sustained activity of the protein. If the activity of a protein is prolonged by the attachment to PEG, the frequency that the protein needs to be administered is decreased. PEG attachment, however, often decreases or destroys the protein's therapeutic activity.
  • Therapeutic proteins or peptides have also been stabilized by fusion to a heterologous protein capable of extending the serum half-life of the therapeutic protein. For instance, therapeutic proteins fused to albumin and antibody fragments may exhibit extended serum half-live when compared to the therapeutic protein in the unfused state. See U.S. Pat. Nos. 5,876,969 and 5,766,88.
  • Another serum protein, glycosylated human transferrin (Tf) has also been used to make fusions with therapeutic proteins to target delivery intracellularly or to carry heterologous agents across the blood-brain barrier. These fusion proteins comprising glycosylated human Tf have been used to target nerve growth factor (NGF) or ciliary neurotrophic factor (CNTF) across the blood-brain barrier by fusing full-length Tf to the either agent. See U.S. Pat. Nos. 5,672,683 and 5977,307. In these fusion proteins, the Tf portion of the molecule is glycosylated and binds to two atoms of iron, which is required for Tf binding to its receptor on a cell and, according to the inventors of these patents, to target delivery of the NGF or CNTF moiety across the blood-brain barrier. Transferrin fusion proteins have also been produced by inserting an HIV-1 protease sequence into surface exposed loops of glycosylated transferrin to investigate the ability to produce another form of Tf fusion for targeted delivery to the inside of a cell via the Tf receptor (Ali et al. (1999) J. Biol. Chem. 274(34):24066-24073).
  • Serum transferrin (Tf) is a monomeric glycoprotein with a molecular weight of 80,000 daltons that binds iron in the circulation and transports it to various tissues via the transferrin receptor (TfR) (Aisen et al. (1980) Ann. Rev. Biochem. 49: 357-393; MacGillivray et al. (1981) J. Biol. Chem. 258: 3543-3553, U.S. Pat. No. 5,026,651). Tf is one of the most common serum molecules, comprising up to about 5-10% of total serum proteins. Carbohydrate deficient transferrin occurs in elevated levels in the blood of alcoholics and exhibits a longer half life (approximately 14-17 days) than that of glycosylated transferrin (approximately 7-10 days). See van Eijk et al. (1983) Clin. Chim. Acta 132:167-171, Stibler (1991) Clin. Chem. 37:2029-2037 (1991), Arndt (2001) Clin. Chem. 47(1):13-27 and Stibler et al. in “Carbohydrate-deficient consumption”, Advances in the Biosciences, (Ed Nordmann et al.), Pergamon, 1988, Vol. 71, pages 353-357).
  • The structure of Tf has been well characterized and the mechanism of receptor binding, iron binding and release and carbonate ion binding have been elucidated (U.S. Pat. Nos. 5,026,651, 5,986,067 and MacGillivray et al. (1983) J. Biol. Chem. 258(6):3543-3546).
  • Transferrin and antibodies that bind the transferrin receptor have also been used to deliver or carry toxic agents to tumor cells as cancer therapy (Baselga and Mendelsohn, 1994), and transferrin has been used as a non-viral gene therapy vector to vehicle to deliver DNA to cells (Frank et al., 1994; Wagner et al., 1992). The ability to deliver proteins to the central nervous system (CNS) using the transferrin receptor as the entry point has been demonstrated with several proteins and peptides including CD4 (Walus et al., 1996), brain derived neurotrophic factor (Pardridge et al., 1994), glial derived neurotrophic factor (Albeck et al.), a vasointestinal peptide analogue (Bickel et al., 1993), a betaamyloid peptide (Saito et al., 1995), and an antisense oligonucleotide (Pardridge et al., 1995).
  • Transferrin fusion proteins have not, however, been modified or engineered to extend the serum half-life of a therapeutic protein or peptide or to increase bioavailability by reducing or inhibiting glycosylation of the Tf moiety or to reduce or prevent iron and/or Tf receptor binding.
  • SUMMARY OF THE INVENTION
  • As described in more detail below, the present invention includes modified Tf fusion proteins comprising at least one therapeutic protein, polypeptide or peptide entity, wherein the Tf portion is engineered to extend the serum half-life or bioavailability of the molecule. The invention also includes pharmaceutical formulations and compositions comprising the fusion proteins, methods of extending the serum stability, serum half-life and bioavailability of a therapeutic protein by fusion to modified transferrin, nucleic acid molecules encoding the modified Tf fusion proteins, and the like. Another aspect of the present invention relates to methods of treating a patient with a modified Tf fusion protein.
  • Preferably, the modified Tf fusion proteins comprise a human transferrin Tf moiety that has been modified to reduce or prevent glycosylation and/or iron and receptor binding.
  • The present invention provides fusion proteins comprising therapeutic proteins fused to or inserted into the transferrin or modified transferrin molecules. Preferably, the therapeutic proteins of the present invention include β-interferon (β-IFN), glucagon-like peptide (GLP-1), EPO (erythropoietin) mimetic peptide (EMP1), and T-20.
  • The present invention also provides fusion proteins comprising a soluble toxin receptor fragment that bins a toxin fused to or inserted into the transferrin or modified transferrin molecules. The soluble toxin receptor may be synaptotagmin 1 and the soluble fragment is amino acids 1-53.
  • BRIEF DESCRIPTION OF THE DRAWINGS
  • FIG. 1 shows an alignment of the N and C Domains of Human (Hu) transferrin (Tf) with similarities and identities highlighted.
  • FIGS. 2A-2B show an alignment of transferrin sequences from different species. Light shading: Similarity; Dark shading: Identity
  • FIG. 3 shows the location of a number of Tf surface exposed insertion sites for therapeutic proteins, polypeptides or peptides.
  • DETAILED DESCRIPTION
  • General Description
  • The present invention is based in part on the finding by the inventors that therapeutic proteins can be stabilized to extend their serum half-life and/or activity in vivo by genetically fusing the therapeutic proteins to transferrin, modified transferrin, or a portion of transferrin or modified transferrin sufficient to extend the half-life of the therapeutic protein in serum. The modified transferrin fusion proteins include a transferrin protein or domain covalently linked to a therapeutic protein or peptide, wherein the transferrin portion is modified to contain one or more amino acid substitutions, insertions or deletions compared to a wild-type transferrin sequence. In one embodiment, Tf fusion proteins are engineered to reduce or prevent glycosylation within the Tf or a Tf domain. In other embodiments, the Tf protein or Tf domain(s) is modified to exhibit reduced or no binding to iron or carbonate ion, or to have a reduced affinity or not bind to a Tf receptor (TfR).
  • The therapeutic proteins contemplated by the present invention include, but are not limited to polypeptides, antibodies, peptides, or fragments or variants thereof. Preferably, the therapeutic proteins of the present invention include β- interferon, glucagon-like peptide-1 (GLP-1), EPO mimetic peptide (EMP1), and T-20.
  • The present invention also contemplates anti-toxin fusion proteins comprising a soluble toxin receptor fragment fused or inserted into transferrin or modified transferrin. Preferably, the soluble toxin receptor fragment binds a specific toxin. In one embodiment, the soluble toxin receptor fragment is amino acids 1-53 (SEQ ID NO: 4) of synaptotagmin 1.
  • The present invention therefore includes transferrin fusion proteins, therapeutic compositions comprising the fusion proteins, and methods of treating, preventing, or ameliorating diseases or disorders by administering the fusion proteins. A transferrin fusion protein of the invention includes at least a fragment or variant of a therapeutic protein and at least a fragment or variant of modified transferrin, which are associated with one another, preferably by genetic fusion (i.e., the transferrin fusion protein is generated by translation of a nucleic acid in which a polynucleotide encoding all or a portion of a therapeutic protein is joined in-frame with a polynucleotide encoding all or a portion of modified transferrin) or chemical conjugation to one another. The therapeutic protein and transferrin protein, once part of the transferrin fusion protein, may be referred to as a “portion”, “region” or “moiety” of the transferrin fusion protein (e.g., a “therapeutic protein portion” or a “transferrin protein portion”).
  • In one embodiment, the invention provides a transferrin fusion protein comprising, or alternatively consisting of, a therapeutic protein and a modified serum transferrin protein. In other embodiments, the invention provides a transferrin fusion protein comprising, or alternatively consisting of, a biologically active and/or therapeutically active fragment of a therapeutic protein and a modified transferrin protein. In other embodiments, the invention provides a transferrin fusion protein comprising, or alternatively consisting of, a biologically active and/or therapeutically active variant of a therapeutic protein and modified transferrin protein. In further embodiments, the invention provides a transferrin fusion protein comprising a therapeutic protein, and a biologically active and/or therapeutically active fragment of modified transferrin. In another embodiment, the therapeutic protein portion of the transferrin fusion protein is the active form of the therapeutic protein.
  • Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, the preferred methods and materials are described.
  • Definitions
  • As used herein, the term “biological activity” refers to a function or set of activities performed by a therapeutic molecule, protein or peptide in a biological context (i.e., in an organism or an in vitro facsimile thereof). Biological activities may include but are not limited to the functions of the therapeutic molecule portion of the claimed fusion proteins, such as, but not limited to, the induction of extracellular matrix secretion from responsive cell lines, the induction of hormone secretion, the induction of chemotaxis, the induction of mitogenesis, the induction of differentiation, or the inhibition of cell division of responsive cells. A fusion protein or peptide of the invention is considered to be biologically active if it exhibits one or more biological activities of its therapeutic protein's native counterpart.
  • As used herein, an “amino acid corresponding to” or an “equivalent amino acid” in a transferrin sequence is identified by alignment to maximize the identity or similarity between a first transferrin sequence and at least a second transferrin sequence. The number used to identify an equivalent amino acid in a second transferrin sequence is based on the number used to identify the corresponding amino acid in the first transferrin sequence. In certain cases, these phrases may be used to describe the amino acid residues in human transferrin compared to certain residues in rabbit serum transferrin.
  • As used herein, the terms “fragment of a Tf protein” or “Tf protein,” or “portion of a Tf protein” refer to an amino acid sequence comprising at least about 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% of a naturally occurring Tf protein or mutant thereof.
  • As used herein, the term “gene” refers to any segment of DNA associated with a biological function. Thus, genes include, but are not limited to, coding sequences and/or the regulatory sequences required for their expression. Genes can also include nonexpressed DNA segments that, for example, form recognition sequences for other proteins. Genes can be obtained from a variety of sources, including cloning from a source of interest or synthesizing from known or predicted sequence information, and may include sequences designed to have desired parameters.
  • As used herein, a “heterologous polynucleotide” or a “heterologous nucleic acid” or a “heterologous gene” or a “heterologous sequence” or an “exogenous DNA segment” refers to a polynucleotide, nucleic acid or DNA segment that originates from a source foreign to the particular host cell, or, if from the same source, is modified from its original form. A heterologous gene in a host cell includes a gene that is endogenous to the particular host cell, but has been modified. Thus, the terms refer to a DNA segment which is foreign or heterologous to the cell, or homologous to the cell but in a position within the host cell nucleic acid in which the element is not ordinarily found. As an example, a signal sequence native to a yeast cell but attached to a human Tf sequence is heterologous.
  • As used herein, an “isolated” nucleic acid sequence refers to a nucleic acid sequence which is essentially free of other nucleic acid sequences, e.g., at least about 20% pure, preferably at least about 40% pure, more preferably about 60% pure, even more preferably about 80% pure, most preferably about 90% pure, and even most preferably about 95% pure, as determined by agarose gel electrophoresis. For example, an isolated nucleic acid sequence can be obtained by standard cloning procedures used in genetic engineering to relocate the nucleic acid sequence from its natural location to a different site where it will be reproduced. The cloning procedures may involve excision and isolation of a desired nucleic acid fragment comprising the nucleic acid sequence encoding the polypeptide, insertion of the fragment into a vector molecule, and incorporation of the recombinant vector into a host cell where multiple copies or clones of the nucleic acid sequence will be replicated. The nucleic acid sequence may be of genomic, cDNA, RNA, semisynthetic, synthetic origin, or any combinations thereof.
  • As used herein, two or more DNA coding sequences are said to be “joined” or “fused” when, as a result of in-frame fusions between the DNA coding sequences, the DNA coding sequences are translated into a polypeptide fusion. The term “fusion” in reference to Tf fusions includes, but is not limited to, attachment of at least one therapeutic protein, polypeptide or peptide to the N-terminal end of Tf, attachment to the C-terminal end of Tf, and/or insertion between any two amino acids within Tf.
  • As used herein, the term “modified transferrin” as used herein refers to a transferrin molecule that exhibits at least one modification of its amino acid sequence, compared to wildtype transferrin.
  • As used herein, the term “modified transferrin fusion protein” as used herein refers to a protein formed by the fusion of at least one molecule of modified transferrin (or a fragment or variant thereof) to at least one molecule of a therapeutic protein (or fragment or variant thereof), preferably an antibody variable region.
  • As used herein, the terms “nucleic acid” or “polynucleotide” refer to deoxyribonucleotides or ribonucleotides and polymers thereof in either single- or double-stranded form. Unless specifically limited, the terms encompass nucleic acids containing analogues of natural nucleotides that have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g. degenerate codon substitutions) and complementary sequences as well as the sequence explicitly indicated. Specifically, degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al. (1991) Nucleic Acid Res. 19:5081; Ohtsuka et al. (1985) J. Biol. Chem. 260:2605-2608; Cassol et al. (1992); Rossolini et al. (1994) Mol. Cell. Probes 8:91-98). The term nucleic acid is used interchangeably with gene, cDNA, and mRNA encoded by a gene.
  • As used herein, a DNA segment is referred to as “operably linked” when it is placed into a functional relationship with another DNA segment. For example, DNA for a signal sequence is operably linked to DNA encoding a fusion protein of the invention if it is expressed as a preprotein that participates in the secretion of the fusion protein; a promoter or enhancer is operably linked to a coding sequence if it stimulates the transcription of the sequence. Generally, DNA sequences that are operably linked are contiguous, and in the case of a signal sequence or fusion protein both contiguous and in reading phase. However, enhancers need not be contiguous with the coding sequences whose transcription they control. Linking, in this context, is accomplished by ligation at convenient restriction sites or at adapters or linkers inserted in lieu thereof.
  • As used herein, the term “promoter” refers to a region of DNA involved in binding RNA polymerase to initiate transcription.
  • As used herein, the term “subject” can be a human, a mammal, or an animal. The subject being treated is a patient in need of treatment.
  • As used herein, the term “recombinant” refers to a cell, tissue or organism that has undergone transformation with recombinant DNA.
  • As used herein, a targeting entity, protein, polypeptide or peptide refers to such molecules that binds specifically to a particular cell type (normal e.g., lymphocytes or abnormal e.g., cancer cell) and therefore may be used to target a transferrin fusion protein or compound (drug, or cytotoxic agent) to that cell type specifically.
  • As used herein, “therapeutic protein” refers to proteins, polypeptides, antibodies, peptides fragments or variants thereof, having one or more therapeutic and/or biological activities. Therapeutic proteins encompassed by the invention include but are not limited to proteins, polypeptides, peptides, antibodies and biologics. The terms peptides, proteins, and polypeptides are used interchangeably herein and include soluble toxin receptors. Additionally, the term “therapeutic protein” may refer to the endogenous or naturally occurring correlate of a therapeutic protein. By a polypeptide displaying a “therapeutic activity” or a protein that is “therapeutically active” is meant a polypeptide that possesses one or more known biological and/or therapeutic activities associated with a therapeutic protein such as one or more of the therapeutic proteins described herein or otherwise known in the art. As a non-limiting example, a “therapeutic protein” is a protein that is useful to treat, prevent or ameliorate a disease, condition or disorder. Such a disease, condition or disorder may be in humans or in a non-human animal, e.g., veterinary use.
  • As used herein, “therapeutically effective amount” refers to that amount of the transferrin fusion protein comprising a therapeutic molecule which, when administered to a subject in need thereof, is sufficient to effect treatment. The amount of transferrin fusion protein which constitutes a “therapeutically effective amount” will vary depending on the therapeutic protein used, the severity of the condition or disease, and the age and body weight of the subject to be treated, but can be determined routinely by one of ordinary skill in the art having regard to his/her own knowledge and to this disclosure.
  • As used herein, the term “toxin” refers to a poisonous substance of biological origin.
  • As used herein, the term “transformation” refers to the transfer of nucleic acid (i.e., a nucleotide polymer) into a cell. As used herein, the term “genetic transformation” refers to the transfer and incorporation of DNA, especially recombinant DNA, into a cell.
  • As used herein, the term “transformant” refers to a cell, tissue or organism that has undergone transformation.
  • As used herein, the term “transgene” refers to a nucleic acid that is inserted into an organism, host cell or vector in a manner that ensures its function.
  • As used herein, the term “transgenic” refers to cells, cell cultures, organisms, bacteria, fungi, animals, plants, and progeny of any of the preceding, which have received a foreign or modified gene and in particular a gene encoding a modified Tf fusion protein by one of the various methods of transformation, wherein the foreign or modified gene is from the same or different species than the species of the organism receiving the foreign or modified gene.
  • “Variants or variant” refers to a polynucleotide or nucleic acid differing from a reference nucleic acid or polypeptide, but retaining essential properties thereof. Generally, variants are overall closely similar, and, in many regions, identical to the reference nucleic acid or polypeptide. As used herein, “variant”, refers to a therapeutic protein portion of a transferrin fusion protein of the invention, differing in sequence from a native therapeutic protein but retaining at least one functional and/or therapeutic property thereof as described elsewhere herein or otherwise known in the art.
  • As used herein, the term “vector” refers broadly to any plasmid, phagemid or virus encoding an exogenous nucleic acid. The term is also to be construed to include non-plasmid, non-phagemid and non-viral compounds which facilitate the transfer of nucleic acid into virions or cells, such as, for example, polylysine compounds and the like. The vector may be a viral vector that is suitable as a delivery vehicle for delivery of the nucleic acid, or mutant thereof, to a cell, or the vector may be a non-viral vector which is suitable for the same purpose. Examples of viral and non-viral vectors for delivery of DNA to cells and tissues are well known in the art and are described, for example, in Ma et al. (1997, Proc. Natl. Acad. Sci. U.S.A. 94:12744-12746). Examples of viral vectors include, but are not limited to, a recombinant vaccinia virus, a recombinant adenovirus, a recombinant retrovirus, a recombinant adeno-associated virus, a recombinant avian pox virus, and the like (Cranage et al., 1986, EMBO J. 5:3057-3063; International Patent Application No. WO94/17810, published Aug. 18, 1994; International Patent Application No. WO94/23744, published Oct. 27, 1994). Examples of non-viral vectors include, but are not limited to, liposomes, polyamine derivatives of DNA, and the like.
  • As used herein, the term “wild type” refers to a polynucleotide or polypeptide sequence that is naturally occurring.
  • Transferrin and Transferrin Modifications
  • The present invention provides fusion proteins comprising therapeutic protein or soluble toxin receptor fragment and transferrin or modified transferrin. Preferably, the therapeutic proteins provided by the present invention include β-IFN, GLP-1, EMP1, and T-20. Preferably, the soluble toxin receptor fragment is amino acids 1-53 (SEQ ID NO: 4) of synaptotagmin 1. Any transferrin may be used to make modified Tf fusion proteins of the invention.
  • Wild-type human Tf (Tf) is a 679 amino acid protein, of approximately 75 kDa (not accounting for glycosylation), with two main domains, N (about 330 amino acids) and C (about 340 amino acids), which appear to originate from a gene duplication. See GenBank accession numbers NM001063, XM002793, M12530, XM039845, XM 039847 and S95936 (www.ncbi.n1m.nih.gov), all of which are herein incorporated by reference in their entirety, as well as SEQ ID NOS: 1, 2 and 3. The two domains have diverged over time but retain a large degree of identity/similarity (FIG. 1).
  • Each of the N and C domains is further divided into two subdomains, N1 and N2, C1 and C2. The function of Tf is to transport iron to the cells of the body. This process is mediated by the Tf receptor (TfR), which is expressed on all cells, particularly actively growing cells. TfR recognizes the iron bound form of Tf (two of which are bound per receptor), endocytosis then occurs whereby the TfR/Tf complex is transported to the endosome, at which point the localized drop in pH results in release of bound iron and the recycling of the TfR/Tf complex to the cell surface and release of Tf (known as apoTf in its un-iron bound form). Receptor binding is through the C domain of Tf. The two glycosylation sites in the C domain do not appear to be involved in receptor binding as unglycosylated iron bound Tf does bind the receptor.
  • Each Tf molecule can carry two iron atoms. These are complexed in the space between the N1 and N2, C1 and C2 subdomains resulting in a conformational change in the molecule. Tf crosses the blood brain barrier (BBB) via the Tf receptor.
  • In human transferrin, the iron binding sites comprise at least of amino acids Asp 63 (Asp 82 of SEQ ID NO: 2 which comprises the native Tf signal sequence); Asp 392 (Asp 411 of SEQ ID NO: 2); Tyr 95 (Tyr 114 of SEQ ID NO: 2); Tyr 426 (Tyr 445 of SEQ ID NO: 2); Tyr 188 (Tyr 207 of SEQ ID NO: 2); Tyr 514 or 517 (Tyr 533 or Tyr 536 SEQ ID NO:2); His 249 (His 268 of SEQ ID NO: 2); His 585 (His 604 of SEQ ID NO: 2), the hinge regions comprise at least N domain amino acid residues 94-96, 245-247 and/or 316-318 as well as C domain amino acid residues 425-427, 581-582 and/or 652-658, the carbonate binding sites comprise at least of amino acids Thr 120 (Thr 139 of SEQ ID NO: 2); Thr 452 (Thr 471 of SEQ ID NO: 2); Arg 124 (Arg 143 of SEQ ID NO: 2); Arg 456 (Arg 475 of SEQ ID NO: 2); Ala 126 (Ala 145 of SEQ ID NO: 2); Ala 458 (Ala 477 of SEQ ID NO: 2); Gly 127 (Gly 146 of SEQ ID NO: 2); Gly 459 (Gly 478 of SEQ ID NO: 2).
  • In one embodiment of the invention, the transferrin fusion protein includes a modified human transferrin, although any animal Tf molecule may be used to produce the fusion proteins of the invention, including human Tf variants, cow, pig, sheep, dog, rabbit, rat, mouse, hamster, echnida, platypus, chicken, frog, hornworm, monkey, as well as other bovine, canine and avian species (see FIG. 2 for a representative set of Tf sequences). All of these Tf sequences are readily available in GenBank and other public databases. The human Tf nucleotide sequence is available (see SEQ ID NOS: 1, 2 and 3 and the accession numbers described above and available at www.ncbi.n1m.nih.gov/) and can be used to make genetic fusions between Tf or a domain of Tf and the therapeutic molecule of choice. Fusions may also be made from related molecules such as lacto transferrin (lactoferrin) GenBank Acc: NM002343) and melanotransferrin (GenBank Acc. NM013900, murine melanotransferrin).
  • Lactoferrin (Lf), a natural defense iron-binding protein, has been found to possess antibacterial, antimycotic, antiviral, antineoplastic and anti-inflammatory activity. The protein is present in exocrine secretions that are commonly exposed to normal flora: milk, tears, nasal exudate, saliva, bronchial mucus, gastrointestinal fluids, cervico-vaginal mucus and seminal fluid. Additionally, Lf is a major constituent of the secondary specific granules of circulating polymorphonuclear neutrophils (PMNs). The apoprotein is released on degranulation of the PMNs in septic areas. A principal function of Lf is that of scavenging free iron in fluids and inflamed areas so as to suppress free radical-mediated damage and decrease the availability of the metal to invading microbial and neoplastic cells. In a study that examined the turnover rate of 125I Lf in adults, it was shown that LF is rapidly taken up by the liver and spleen, and the radioactivity persisted for several weeks in the liver and spleen (Bennett et al. (1979), Clin. Sci. (Lond.) 57: 453-460).
  • Melanotransferrin is a glycosylated protein found at high levels in malignant melanoma cells and was originally named human melanoma antigen p97 (Brown et al., 1982, Nature, 296: 171-173). It possesses high sequence homology with human serum transferrin, human lactoferrin, and chicken transferrin (Brown et al., 1982, Nature, 296: 171-173; Rose et al., Proc. Natl. Acad. Sci., 1986, 83: 1261-1265). However, unlike these receptors, no cellular receptor has been identified for melanotransferrin. Melanotransferrin reversibly binds iron and it exists in two forms, one of which is bound to cell membranes by a glycosyl phosphatidylinositol anchor while the other form is both soluble and actively secreted (Baker et al., 1992, FEBS Lett, 298: 215-218; Alemany et al., 1993, J. Cell Sci., 104: 1155-1162; Food et al., 1994, J. Biol. Chem. 274: 7011-7017).
  • In another embodiment, the transferrin portion of the transferrin fusion protein of the invention includes a transferrin splice variant. In one example, a transferrin splice variant can be a splice variant of human transferrin. In one specific embodiment, the human transferrin splice variant can be that of Genbank Accession AAA61140.
  • In another embodiment, the transferrin portion of the transferrin fusion protein of the invention includes a lactoferrin splice variant. In one example, a human serum lactoferrin splice variant can be a novel splice variant of a neutrophil lactoferrin. In one specific embodiment, the neutrophil lactoferrin splice variant can be that of Genbank Accession AAA59479. In another specific embodiment, the neutrophil lactoferrin splice variant can comprise the following amino acid sequence EDCIALKGEADA (SEQ ID NO: 5), which includes the novel region of splice-variance.
  • Modified Tf fusions may be made with any Tf protein, fragment, domain, or engineered domain. For instance, fusion proteins may be produced using the full-length Tf sequence, with or without the native Tf signal sequence. Transferrin fusion proteins may also be made using a single Tf domain, such as an individual N or C domain. In some embodiments, the use of a single or double N domain is advantageous as the Tf glycosylation sites reside in the C domain and the N domain, on its own, does not bind iron or the Tf receptor. In other embodiments, fusions of a therapeutic protein to a single or double C domain may be produced, wherein the C domain is altered to reduce, inhibit or prevent glycosylation, iron binding and/or Tf receptor binding. See U.S. Provisional Application 60/406,977, which is herein incorporated by reference in its entirety.
  • As used herein, a C terminal domain or lobe modified to function as an N-like domain is modified to exhibit glycosylation patterns or iron binding properties substantially like that of a native or wild-type N domain or lobe. In a preferred embodiment, the C domain or lobe is modified so that it is not glycosylated and does not bind iron by substitution of the relevant C domain regions or amino acids to those present in the corresponding regions or sites of a native or wild-type N domain.
  • As used herein, a Tf moiety comprising “two N domains or lobes” includes a Tf molecule that is modified to replace the native C domain or lobe with a native or wild-type N domain or lobe or a modified N domain or lobe or contains a C domain that has been modified to function substantially like a wild-type or modified N domain.
  • Analysis of the two domains by overlay of the two domains (Swiss PDB Viewer 3.7b2, Iterative Magic Fit) and by direct amino acid alignment (ClustalW multiple alignment) reveals that the two domains have diverged over time. Amino acid alignment shows 42% identity and 59% similarity between the two domains. However, approximately 80% of the N domain matches the C domain for structural equivalence. The C domain also has several extra disulfide bonds compared to the N domain.
  • Alignment of molecular models for the N and C domain reveals the following structural equivalents:
    N  4-24 36-72  94-136 138-139 149-164 168-173 178-198
    domain 75-88 200-214
    (1-330)
    C 340-361 365-415 425-437 470-471 475-490 492-497 507-542
    domain 439-468
    (340-679)
    N 219-255 259-260 263-268 271-275 279-280 283-288 309-327
    domain 290-304
    (1-330)
    C 555-591 593-594 597-602 605-609 614-615 620-640 645-663
    domain
    (340-679)
  • The disulfide bonds for the two domains align as follows:
    N C
    C339-C596
    C9-C48 C345-C377
    C19-C39 C355-C368
    C402-C674
    C418-C637
    C118-C194 C450-C523
    C137-C331
    C474-C665
    C158-C174 C484-C498
    C161-C179
    C171-C177 C495-C506
    C227-C241 C563-C577
    C615-C620

    Bold

    Italics
  • In one embodiment, the transferrin portion of the transferrin fusion protein includes at least two N terminal lobes of transferrin. In further embodiments, the transferrin portion of the transferrin fusion protein includes at least two N terminal lobes of transferrin derived from human serum transferrin.
  • In another embodiment, the transferrin portion of the transferrin fusion protein includes, comprises, or consists of at least two N terminal lobes of transferrin having a mutation in at least one amino acid residue selected from the group consisting of Asp63, Gly65, Tyr95, Tyr188, and His249 of SEQ ID NO: 3.
  • In another embodiment, the transferrin portion of the modified transferrin fusion protein includes a recombinant human serum transferrin N-terminal lobe mutant having a mutation at Lys206 or His207 of SEQ ID NO: 3.
  • In another embodiment, the transferrin portion of the transferrin fusion protein includes, comprises, or consists of at least two C terminal lobes of transferrin. In further embodiments, the transferrin portion of the transferrin fusion protein includes at least two C terminal lobes of transferrin derived from human serum transferrin.
  • In a further embodiment, the C terminal lobe mutant further includes a mutation of at least one of Asn413 and Asn611 of SEQ ID NO: 3 which does not allow glycosylation.
  • In another embodiment, the transferrin portion of the transferrin fusion protein includes at least two C terminal lobes of transferrin having a mutation in at least one amino acid residue selected from the group consisting of Asp392, Tyr426, Tyr514, Tyr517 and His585 of SEQ ID NO: 3, wherein the mutant retains the ability to bind metal. In an alternate embodiment, the transferrin portion of the transferrin fusion protein includes at least two C terminal lobes of transferrin having a mutation in at least one amino acid residue selected from the group consisting of Tyr426, Tyr514, Tyr517 and His585 of SEQ ID NO: 3, wherein the mutant has a reduced ability to bind metal. In another embodiment, the transferrin portion of the transferrin fusion protein includes at least two C terminal lobes of transferrin having a mutation in at least one amino acid residue selected from the group consisting of Asp392, Tyr426, Tyr517 and His585 of SEQ ID NO:3, wherein the mutant does not retain the ability to bind metal and functions substantially like an N domain.
  • In some embodiments, the Tf or Tf portion will be of sufficient length to increase the serum stability, in vitro solution stability or bioavailability of the therapeutic protein or peptide or soluble toxin receptor compared to the serum stability (half-life), in vitro stability or bioavailability of therapeutic protein or peptide or soluble toxin receptor in an unfused state. Such an increase in stability, serum half-life or bioavailability may be about a 30%, 50%, 70%, 80%, 90% or more increase over the unfused therapeutic protein or peptide or soluble toxin receptor. In some cases, the transferrin fusion proteins comprising modified transferrin exhibit a serum half-life of about 10-20 or more days, about 12-18 days or about 14-17 days.
  • When the C domain of Tf is part of the transferrin fusion protein, the two N-linked glycosylation sites, amino acid residues corresponding to N413 and N611 of SEQ ID NO:3 may be mutated for expression in a yeast system to prevent glycosylation or hypermannosylationn and extend the serum half-life of the fusion protein and/or therapeutic protein or peptide or soluble toxin receptor (to produce asialo-, or in some instances, monosialo-Tf or disialo-Tf). In addition to Tf amino acids corresponding to N413 and N611, mutations may be to the adjacent residues within the N-X-S/T glycosylation site to prevent or substantially reduce glycosylation. See U.S. Pat. No. 5,986,067 of Funk et al. It has also been reported that the N domain of Tf expressed in Pichia pastoris becomes O-linked glycosylated with a single hexose at S32 which also may be mutated or modified to prevent such glycosylation.
  • Accordingly, in one embodiment of the invention, the transferrin fusion protein includes a modified transferrin molecule wherein the transferrin exhibits reduced glycosylation, including but not limited to asialo- monosialo- and disialo-forms of Tf. In another embodiment, the transferrin portion of the transferrin fusion protein includes a recombinant transferrin mutant that is mutated to prevent glycosylation. In another embodiment, the transferrin portion of the transferrin fusion protein includes a recombinant transferrin mutant that is fully glycosylated. In a further embodiment, the transferrin portion of the transferrin fusion protein includes a recombinant human serum transferrin mutant that is mutated to prevent glycosylation, wherein at least one of Asn413 and Asn61 1 of SEQ ID NO:3 are mutated to an amino acid which does not allow glycosylation. In another embodiment, the transferrin portion of the transferrin fusion protein includes a recombinant human serum transferrin mutant that is mutated to prevent or substantially reduce glycosylation, wherein mutations may be to the adjacent residues within the N-X-S/T glycosylation site.
  • As discussed below in more detail, modified Tf fusion proteins of the invention may also be engineered to not bind iron and/or not bind the Tf receptor. In other embodiments of the invention, the iron binding is retained and the iron binding ability of Tf may be used in two ways, one to deliver a therapeutic protein or peptide(s) to the inside of a cell and/or across the BBB. These embodiments that bind iron and/or the Tf receptor will often be engineered to reduce or prevent glycosylation to extend the serum half-life of the therapeutic protein. The N domain alone will not bind to TfR when loaded with iron, and the iron bound C domain will bind TfR but not with the same affinity as the whole molecule.
  • In another embodiment, the transferrin portion of the transferrin fusion protein includes a recombinant transferrin mutant having a mutation wherein the mutant does not retain the ability to bind metal. In an alternate embodiment, the transferrin portion of the transferrin fusion protein includes a recombinant transferrin mutant having a mutation wherein the mutant has a weaker binding avidity for metal than wild-type serum transferrin. In an alternate embodiment, the transferrin portion of the transferrin fusion protein includes a recombinant transferrin mutant having a mutation wherein the mutant has a stronger binding avidity for metal than wild-type serum transferrin.
  • In another embodiment, the transferrin portion of the transferrin fusion protein, includes a recombinant transferrin mutant having a mutation wherein the mutant does not retain the ability to bind to the transferrin receptor. In an alternate embodiment, the transferrin portion of the transferrin fusion protein includes a recombinant transferrin mutant having a mutation wherein the mutant has a weaker binding avidity for the transferrin receptor than wild-type serum transferrin. In an alternate embodiment, the transferrin portion of the transferrin fusion protein includes a recombinant transferrin mutant having a mutation wherein the mutant has a stronger binding avidity for the transferrin receptor than wild-type serum transferrin.
  • In another embodiment, the transferrin portion of the transferrin fusion protein includes a recombinant transferrin mutant having a mutation wherein the mutant does not retain the ability to bind to carbonate. In an alternate embodiment, the transferrin portion of the transferrin fusion protein includes a recombinant transferrin mutant having a mutation wherein the mutant has a weaker binding avidity for carbonate than wild-type serum transferrin. In an alternate embodiment, the transferrin portion of the transferrin fusion protein includes a recombinant transferrin mutant having a mutation wherein the mutant has a stronger binding avidity for carbonate than wild-type serum transferrin.
  • In another embodiment, the transferrin portion of the transferrin fusion protein includes a recombinant human serum transferrin mutant having a mutation in at least one amino acid residue selected from the group consisting of Asp63, Gly65, Tyr95, Tyr188, His249, Asp392, Tyr426, Tyr514, Tyr517 and His585 of SEQ ID NO: 3, wherein the mutant retains the ability to bind metal. In an alternate embodiment, a recombinant human serum transferrin mutant having a mutation in at least one amino acid residue selected from the group consisting of Asp63, Gly65, Tyr95, Tyr188, His249, Asp392, Tyr426, Tyr514, Tyr517 and His585 of SEQ ID NO: 3, wherein the mutant has a reduced ability to bind metal. In another embodiment, a recombinant human serum transferrin mutant having a mutation in at least one amino acid residue selected from the group consisting of Asp63, Gly65, Tyr95, Tyr188, His249, Asp392, Tyr426, Tyr517 and His585 of SEQ ID NO: 3, wherein the mutant does not retain the ability to bind metal.
  • In another embodiment, the transferrin portion of the transferrin fusion protein includes a recombinant human serum transferrin mutant having a mutation at Lys206 or His207 of SEQ ID NO: 3, wherein the mutant has a stronger binding avidity for metal than wild-type human serum transferrin (see U.S. Pat. No. 5,986,067, which is herein incorporated by reference in its entirety). In an alternate embodiment, the transferrin portion of the transferrin fusion protein includes a recombinant human serum transferrin mutant having a mutation at Lys206 or His207 of SEQ ID NO: 3, wherein the mutant has a weaker binding avidity for metal than wild-type human serum transferrin. In a further embodiment, the transferrin portion of the transferrin fusion protein includes a recombinant human serum transferrin mutant having a mutation at Lys206 or His207 of SEQ ID NO:3, wherein the mutant does not bind metal.
  • Any available technique may be used to produce the transferrin fusion proteins of the invention, including but not limited to molecular techniques commonly available, for instance, those disclosed in Sambrook et al. Molecular Cloning: A Laboratory Manual, 2nd Ed., Cold Spring Harbor Laboratory Press, 1989. When carrying out nucleotide substitutions using techniques for accomplishing site-specific mutagenesis that are well known in the art, the encoded amino acid changes are preferably of a minor nature, that is, conservative amino acid substitutions, although other, non-conservative, substitutions are contemplated as well, particularly when producing a modified transferrin portion of a Tf fusion protein, e.g., a modified Tf protein exhibiting reduced glycosylation, reduced iron binding and the like. Specifically contemplated are amino acid substitutions, small deletions or insertions, typically of one to about 30 amino acids; insertions between transferrin domains; small amino- or carboxyl-terminal extensions, such as an amino-terminal methionine residue, or small linker peptides of less than 50, 40, 30, 20 or 10 residues between transferrin domains or linking a transferrin protein and therapeutic protein or peptide or soluble toxin receptor or a small extension that facilitates purification, such as a poly-histidine tract, an antigenic epitope or a binding domain.
  • Examples of conservative amino acid substitutions are substitutions made within the same group such as within the group of basic amino acids (such as arginine, lysine, histidine), acidic amino acids (such as glutamic acid and aspartic acid), polar amino acids (such as glutamine and asparagine), hydrophobic amino acids (such as leucine, isoleucine, valine), aromatic amino acids (such as phenylalanine, tryptophan, tyrosine) and small amino acids (such as glycine, alanine, serine, threonine, methionine).
  • Non-conservative substitutions encompass substitutions of amino acids in one group by amino acids in another group. For example, a non-conservative substitution would include the substitution of a polar amino acid for a hydrophobic amino acid. For a general description of nucleotide substitution, see e.g. Ford et al (1991), Prot. Exp. Pur. 2: 95-107. Non-conservative substitutions, deletions and insertions are particularly useful to produce Tf fusion proteins of the invention that exhibit no or reduced binding of iron, no or reduced binding of the fusion protein to the Tf receptor and/or no or reduced glycosylation.
  • Iron binding and/or receptor binding may be reduced or disrupted by mutation, including deletion, substitution or insertion into, amino acid residues corresponding to one or more of Tf N domain residues Asp63, Tyr95, Tyr188, His249 and/or C domain residues Asp 392, Tyr 426, Tyr 514 and/or His 585. Iron binding may also be affected by mutation to amino acids Lys206, Hys207 or Arg632. Carbonate binding may be reduced or disrupted by mutation, including deletion, substitution or insertion into, amino acid residues corresponding to one or more of Tf N domain residues Thr120, Arg124, Ala126, Gly 127 and/or C domain residues Thr 452, Arg 456, Ala 458 and/or Gly 459. A reduction or disruption of carbonate binding may adversely affect iron and/or receptor binding.
  • Binding to the Tf receptor may be reduced or disrupted by mutation, including deletion, substitution or insertion into, amino acid residues corresponding to one or more of Tf N domain residues described above for iron binding.
  • As discussed above, glycosylation may be reduced or prevented by mutation, including deletion, substitution or insertion into, amino acid residues corresponding to one or more of Tf C domain residues around the N-X-S/T sites corresponding to C domain residues N413 and/or N611 (See U.S. Pat. No. 5,986,067). For instance, the N413 and/or N611 may be mutated to Glu residues.
  • In instances where the Tf fusion proteins of the invention are not modified to prevent glycosylation, iron binding, carbonate binding and/or receptor binding, glycosylation, iron and/or carbonate ions may be stripped from or cleaved off of the fusion protein. For instance, available de-glycosylases may be used to cleave glycosylation residues from the fusion protein, in particular the sugar residues attached to the Tf portion, yeast deficient in glycosylation enzymes may be used to prevent glycosylation and/or recombinant cells may be grown in the presence of an agent that prevents glycosylation, e.g., tunicamycin.
  • Additional mutations may be made with Tf to alter the three dimensional structure of Tf, such as modifications to the hinge region to prevent Tf folding needed for iron biding and Tf receptor recognition. For instance, mutations may be made in or around N domain amino acid residues 94-96, 245-247 and/or 316-318 as well as C domain amino acid residues 425-427, 581-582 and/or 652-658. In addition, mutations may be made in to or around the flanking regions of these sites to alter Tf structure and function.
  • In one aspect of the invention, the transferrin fusion protein can function as a carrier protein to extend the half life or bioavailability of the therapeutic protein as well as in some instances, delivering the therapeutic protein inside a cell and/or across the blood brain barrier. In an alternate embodiment, the transferrin fusion protein includes a modified transferrin molecule wherein the transferrin does not retain the ability to cross the blood brain barrier.
  • In another embodiment, the transferrin fusion protein includes a modified transferrin molecule wherein the transferrin molecule retains the ability to bind to the transferrin receptor and transport the therapeutic protein or peptide or soluble toxin receptor inside cells. In an alternate embodiment, the transferrin fusion protein includes a modified transferrin molecule wherein the transferrin molecule does not retain the ability to bind to the transferrin receptor and transport the therapeutic protein inside cells.
  • In further embodiments, the transferrin fusion protein includes a modified transferrin molecule wherein the transferrin molecule retains the ability to bind to the transferrin receptor and transport the therapeutic protein inside cells, but does not retain the ability to cross the blood brain barrier. In an alternate embodiment, the transferrin fusion protein includes a modified transferrin molecule wherein the transferrin molecule retains the ability to cross the blood brain barrier, but does not retain the ability to bind to the transferrin receptor and transport the therapeutic protein inside cells.
  • Modified Transferrin Fusion Proteins
  • The fusion of proteins of the invention may contain one or more copies of the therapeutic proteins or peptides or soluble toxin receptor attached to the N-terminus and/or the C-terminus of the Tf protein. In some embodiments, the therapeutic protein is attached to both the N- and C-terminus of the Tf protein and the fusion protein may contain one or more equivalents of the therapeutic protein on either or both ends of Tf. In other embodiments, the therapeutic protein is inserted into known domains of the Tf protein, for instance, into one or more of the loops of Tf (see Ali et al. (1999) J. Biolog. Chem. 274(34):24066-24073). In fact, the therapeutic protein may be inserted into all five loops of transferrin to create a pentavalent molecule with increased avidity for the antigen, receptor, or targeting molecule, which the therapeutic protein binds. In other embodiments, the therapeutic protein is inserted between the N and C domains of Tf. Alternatively, the therapeutic protein is inserted anywhere in the transferrin molecule.
  • Generally, the transferrin fusion protein of the invention may have one modified transferrin-derived region and one therapeutic protein region. Multiple regions of each protein, however, may be used to make a transferrin fusion protein of the invention. Similarly, more than one therapeutic protein may be used to make a transferrin fusion protein of the invention of the invention, thereby producing a multi-functional modified Tf fusion protein.
  • In one embodiment, the transferrin fusion protein of the invention contains a therapeutic protein or portion thereof or a soluble toxin receptor fused to a transferrin molecule or portion thereof. In another embodiment, the transferrin fusion protein of the inventions contains a therapeutic protein fused to the N terminus of a transferrin molecule. In an alternate embodiment, the transferrin fusion protein of the invention contains a therapeutic protein fused to the C terminus of a transferrin molecule. In a further embodiment, the transferrin fusion protein of the invention contains a transferrin molecule fused to the N terminus of a therapeutic protein. In an alternate embodiment, the transferrin fusion protein of the invention contains a transferrin molecule fused to the C terminus of a therapeutic protein.
  • In further embodiments, the modified transferrin molecule contains the N terminus of a transferrin molecule fused to what would be the N terminus of a therapeutic protein. In an alternate embodiment, the modified transferrin molecule contains the N terminus of a transferrin molecule fused to the C terminus of a therapeutic protein. In a further alternate embodiment, the modified transferrin molecule contains the C terminus of a transferrin molecule fused to what would be the C terminus of a therapeutic protein. In an alternate embodiment, the modified transferrin molecule contains the C terminus of a transferrin molecule fused to the N terminus of a therapeutic protein.
  • In other embodiments, the transferrin fusion protein of the inventions contains a therapeutic protein fused to both the N-terminus and the C-terminus of modified transferrin. In another embodiment, the therapeutic proteins fused at the N- and C-termini bind the same therapeutic proteins. In an alternate embodiment, the therapeutic proteins fused at the N- and C-termini are different therapeutic proteins. In another alternate embodiment, the therapeutic proteins fused to the N- and C-termini bind different therapeutic proteins which may be used to treat or prevent the same disease, disorder, or condition. In another embodiment, the therapeutic proteins fused at the N- and C-termini are different therapeutic proteins which may be used to treat or prevent diseases or disorders which are known in the art to commonly occur in patients simultaneously.
  • In addition to modified transferrin fusion protein of the invention in which the modified transferrin portion is fused to the N terminal and/or C-terminal of the therapeutic protein portion, transferrin fusion protein of the invention may also be produced by inserting the therapeutic protein or peptide of interest (e.g., a therapeutic protein or peptide as disclosed herein, or a fragment or variant thereof) into an internal region of the modified transferrin. Internal regions of modified transferrin include, but are not limited to, the iron binding sites, the hinge regions, the bicarbonate binding sites, or the receptor binding domain.
  • Within the protein sequence of the modified transferrin molecule a number of loops or turns exist, which are stabilized by disulfide bonds. These loops are useful for the insertion, or internal fusion, of therapeutically active peptides particularly those requiring a secondary structure to be functional, or therapeutic proteins to essentially generate a modified transferrin molecule with specific biological activity. When therapeutic proteins are inserted into or replace at least one loop of a Tf molecule, insertions may be made within any of the surface exposed loop regions, in addition to other areas of Tf. For instance, insertions may be made within the loops comprising Tf amino acids 32-33, 74-75, 256-257, 279-280 and 288-289 (Ali et al., supra) (See FIG. 3). As previously described, insertions may also be made within other regions of Tf such as the sites for iron and bicarbonate binding, hinge regions, and the receptor binding domain as described in more detail below. The loops in the Tf protein sequence that are amenable to modification/replacement for the insertion of proteins or peptides may also be used for the development of a screenable library of random peptide inserts. Any procedures may be used to produce nucleic acid inserts for the generation of peptide libraries, including available phage and bacterial display systems, prior to cloning into a Tf domain and/or fusion to the ends of Tf.
  • The N-terminus of Tf is free and points away from the body of the molecule. Fusions of proteins or peptides on the N-terminus may therefore be a preferred embodiment. Such fusions may include a linker region, such as but not limited to a poly-glycine stretch, to separate the therapeutic protein from Tf. Attention to the junction between the leader sequence, the choice of leader sequence, and the structure of the mRNA by codon manipulation/optimization (no major stem loops to inhibit ribosome progress) will increase secretion and can be readily accomplished using standard recombinant protein techniques.
  • The C-terminus of Tf appears to be more buried and secured by a disulfide bond 6 amino acids from the C-terminus. In human Tf, the C-terminal amino acid is a proline which, depending on the way that it is orientated, will either point a fusion away or into the body of the molecule. A linker or spacer moiety at the C-terminus may be used in some embodiments of the invention.
  • In yet other embodiments, small molecule therapeutics may be complexed with iron and loaded on a modified transferrin fusion protein for delivery to the inside of cells and across the BBB. The addition of a targeting peptide or, for example, a SCA will target the payload to a particular cell type, e.g., a cancer cell.
  • Therapeutic Proteins and Peptides
  • Any therapeutic molecule may be used as the fusion partner to Tf according to the methods and compositions of the present invention. As used herein, a therapeutic molecule is typically a protein or peptide capable of exerting a beneficial biological effect in vitro or in vivo and includes proteins or peptides that exert a beneficial effect in relation to normal homeostasis, physiology or a disease state. Therapeutic molecules do not include, fusion partners commonly used as markers or protein purification aids, such as galactosidases (see for example, U.S. Pat. No. 5, 986, 067 and Aldred et al. (1984) Biochem. Biophys. Res. Commun. 122: 960-965). For instance, a beneficial effect as related to a disease state includes any effect that is advantageous to the treated subject, including disease prevention, disease stabilization, the lessening or alleviation of disease symptoms or a modulation, alleviation or cure of the underlying defect to produce an effect beneficial to the treated subject.
  • A modified transferrin fusion protein of the invention includes at least a fragment or variant of a therapeutic protein and at least a fragment or variant of modified serum transferrin, which are associated with one another, preferably by genetic fusion or chemical conjugation.
  • In one embodiment, the transferrin fusion protein includes a modified transferrin molecule linked to a neuropharmaceutical agent. In another embodiment, the modified transferrin fusion protein includes transferrin at the carboxyl terminus linked to a neuropharmaceutical agent at the amino terminus. In an alternate embodiment, the modified transferrin fusion protein includes transferrin at the amino terminus linked to a neuropharmaceutical agent at the carboxy terminus. In specific embodiments, the neuropharmaceutical agent is either nerve growth factor or ciliary neurotrophic factor.
  • In further embodiments, a modified transferrin fusion protein of the invention may contain at least a fragment or variant of a therapeutic protein. In a further embodiment, the transferrin fusion proteins can contain peptide fragments or peptide variants of proteins or antibodies wherein the variant or fragment retains at least one biological or therapeutic activity. The transferrin fusion proteins can contain therapeutic proteins that can be peptide fragments or peptide variants at least about 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 20, at least 25, at least 30, at least 35, or at least about 40, at least about 50, at least about 55, at least about 60 or at least about 70 or more amino acids in length fused to the N and/or C termini, inserted within, or inserted into a loop of a modified transferrin.
  • The modified transferrin fusion proteins of the present invention may contain one or more peptides. Increasing the number of peptides enhances the function of the peptides fused to transferrin and the function of the entire transferrin fusion protein. The peptides may be used to make a bi- or multi-functional fusion protein by including peptide or protein domains with multiple functions. For instance, a multi-functional fusion protein can be made with a therapeutic protein and a second protein to target the fusion protein to a specific target. Other peptides may be used to induce the immune response of a cellular system, or induce an antiviral, antibacterial, or anti-pathogenic response.
  • In another embodiment, the modified transferrin fusion molecules contain a therapeutic protein portion that can be fragments of a therapeutic protein that include the full length protein as well as polypeptides having one or more residues deleted from the amino terminus of the amino acid sequence.
  • In another embodiment, the modified transferrin fusion molecules contain a therapeutic protein portion that can be fragments of a therapeutic protein that include the full length protein as well as polypeptides having one or more residues deleted from the carboxy terminus of the amino acid sequence.
  • In another embodiment, the modified transferrin fusion molecules contain a therapeutic protein portion that can have one or more amino acids deleted from both the amino and the carboxy termini.
  • In another embodiment, the modified transferrin fusion molecules contain a therapeutic protein portion that is at least about 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to a reference therapeutic protein set forth herein, or fragments thereof. In further embodiments, the transferrin fusion molecules contain a therapeutic protein portion that is at least about 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to reference polypeptides having the amino acid sequence of N- and C-terminal deletions as described above.
  • In another embodiment, the modified transferrin fusion molecules contain the therapeutic protein portion that is at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100%, identical to, for example, the native or wild-type amino acid sequence of a therapeutic protein. Fragments, of these polypeptides are also provided.
  • The therapeutic proteins corresponding to a therapeutic protein portion of a modified transferrin fusion protein of the invention, such as cell surface and secretory proteins, can be modified by the attachment, of one or more oligosaccharide groups. The modification referred to as glycosylation, can significantly affect the physical properties of proteins and can be important in protein stability, secretion, and localization. Glycosylation occurs at specific locations along the polypeptide backbone. There are usually two major types of glycosylation: glycosylation characterized by O-linked oligosaccharides, which are attached to serine or threonine residues; and glycosylation characterized by N-linked oligosaccharides, which are attached to asparagine residues in an Asn-X-Ser/Thr sequence, where X can be an amino add except proline. Variables such as protein structure and cell type influence the number and nature of the carbohydrate units within the chains at different glycosylation sites. Glycosylation isomers are also common at the same site within a given cell type. For example, several types of human interferon are glycosylated.
  • Therapeutic proteins corresponding to a therapeutic protein portion of a transferrin fusion protein of the invention, as well as analogs and variants thereof, may be modified so that glycosylation at one or more sites is altered as a result of manipulation(s) of their nucleic acid sequence by the host cell in which they are expressed, or due to other conditions of their expression. For example, glycosylation isomers may be produced by abolishing or introducing glycosylation sites, e.g., by substitution or deletion of amino acid residues, such as substitution of glutamine for asparagine, or unglycosylated recombinant proteins may be produced by expressing the proteins in host cells that will not glycosylate them, e.g. in glycosylation-deficient yeast. These approaches are known in the art.
  • Therapeutic proteins and their nucleic acid sequences are well known in the art and available in public databases such as Chemical Abstracts Services Databases (e.g., the CAS Registry), GenBank, and GenSeq. The Accession Numbers and sequences referred to below are herein incorporated by reference in their entirety.
  • In other embodiments, the transferrin fusion proteins of the invention are capable of a therapeutic activity and/or biologic activity, corresponding to the therapeutic activity and/or biologic activity of the therapeutic protein described elsewhere in this application. In further embodiments, the therapeutically active protein portions of the transferrin fusion proteins of the invention are fragments or variants of the reference sequences cited herein.
  • The present invention is further directed to modified Tf fusion proteins comprising fragments of the therapeutic proteins herein described. Even if deletion of one or more amino acids from the N-terminus of a protein results in modification or loss of one or more biological functions of the therapeutic protein portion, other therapeutic activities and/or functional activities (e.g., biological activities, ability to multimerize, ability to bind a ligand) may still be retained. For example, the ability of polypeptides with N-terminal deletions to induce and/or bind to antibodies which recognize the complete or mature forms of the polypeptides generally will be retained with less than the majority of the residues of the complete polypeptide removed from the N-terminus. Whether a particular polypeptide lacking N-terminal residues of a complete polypeptide retains such immunologic activities can be assayed by routine methods described herein and otherwise known in the art. It is not unlikely that a mutant with a large number of deleted N-terminal amino acid residues may retain some biological or immunogenic activities. In fact, peptides composed of as few as six amino acid residues may often evoke an immune response.
  • Also as mentioned above, even if deletion of one or more amino acids from the N-terminus or C-terminus of a therapeutic protein results in modification or loss of one or more biological functions of the protein, other functional activities (e.g., biological activities, ability to multimerize, ability to bind a ligand) and/or therapeutic activities may still be retained. For example the ability of polypeptides with C-terminal deletions to induce and/or bind to antibodies which recognize the complete or mature forms of the polypeptide generally will be retained when less than the majority of the residues of the complete or mature polypeptide are removed from the C-terminus. Whether a particular polypeptide lacking the N-terminal and/or, C-terminal residues of a reference polypeptide retains therapeutic activity can readily be determined by routine methods described herein and/or otherwise known in the art.
  • Peptide fragments of the therapeutic proteins can be fragments comprising, or alternatively, consisting of, an amino acid sequence that displays a therapeutic activity and/or functional activity (e.g. biological activity) of the polypeptide sequence of the therapeutic protein of which the amino acid sequence is a fragment.
  • Other polypeptide fragments are biologically active fragments. Biologically active fragments are those exhibiting activity similar, but not necessarily identical, to an activity of a therapeutic protein used in the present invention. The biological activity of the fragments may include an improved desired activity, or a decreased undesirable activity.
  • Generally, variants of proteins are overall very similar, and, in many regions, identical to the amino acid sequence of the therapeutic protein corresponding to a therapeutic protein portion of a transferrin fusion protein of the invention. Nucleic acids encoding these variants are also encompassed by the invention.
  • Further therapeutic polypeptides that may be used in the invention are polypeptides encoded by polynucleotides which hybridize to the complement of a nucleic acid molecule encoding an amino acid sequence of a therapeutic protein under stringent hybridization conditions which are known to those of skill in the art. (see, for example, Ausubel, F. M. et al., eds., 1989 Current protocol in Molecular Biology, Green Publishing Associates, Inc., and John Wiley & Sons Inc., New. York). Polynucleotides encoding these polypeptides are also encompassed by the invention.
  • By a polypeptide-having an amino acid sequence at least, for example, 95% “identical” to a query amino acid sequence of the present invention, it is intended that the amino acid sequence of the subject polypeptide is identical to the query sequence except that the subject polypeptide sequence may include up to five amino acid alterations per each 100 amino acids of the query amino acid sequence. In other words, to obtain a polypeptide having an amino acid sequence at least 95% identical to a query amino acid sequence, up to 5% of the amino acid residues in the subject sequence may be inserted, deleted, or substituted with another amino acid. These alterations of the reference sequence may occur at the amino- or carboxy-terminal positions of the reference amino acid sequence or anywhere between those terminal positions, interspersed either individually among residues in the reference sequence, or in one or more contiguous groups within the reference sequence.
  • As a practical matter, whether any particular polypeptide is at least about 80%, 85%, 90%,95%, 96%, 97%, 98% or 99% identical to, for instance, the amino acid sequence of a transferrin fusion protein of the invention or a fragment thereof (such, as the therapeutic protein portion of the transferrin fusion protein or the transferrin portion of the transferrin fusion protein), can be determined conventionally using known computer programs. A preferred method for determining the best overall match between a query sequence (a sequence of the present invention) and a subject sequence, also referred to as a global sequence alignment, can be determined using the FASTDB computer program based on the algorithm of Brufiag-et al. (Comp. App. Biosci 245- (1990)).
  • The polynucleotide variants of the invention may contain alterations in the coding regions, non-coding regions, or both. Polynucleotide variants containing alterations which produce silent substitutions, additions, or deletions, but do not alter the properties or activities of the encoded polypeptide may be used to produce modified Tf fusion proteins. Nucleotide variants produced by silent substitutions due to the degeneracy of the genetic code can be utilized. Moreover, polypeptide variants in which less than about 50, less than 40, less than 30, less than 20, less than 10, or 5-50, 5-25, 5-10, 1-5, or 1-2 amino acids are substituted, deleted, or added in any combination can also be utilized. Polynucleotide variants can be produced for a variety of reasons, e.g., to optimize codon expression for a particular host (change codons in the human mRNA to those preferred by a host, such as, yeast or E. coli as described above).
  • In other embodiments, the therapeutic protein moiety has conservative substitutions compared to the wild-type sequence. By “conservative substitutions” is intended swaps within groups such as replacement of the aliphatic or hydrophobic amino acids Ala, Val, Leu and Ile; replacement of the hydroxyl residues Ser and Thr; replacement of the acidic residues Asp and Glu; replacement of the amide residues Asn and Gln, replacement of the basic residues Lys, Arg, and His; replacement of the aromatic residues Phe, Tyr, and Trp, and replacement of the small-sized amino acids Ala, Ser, Thr, Met, and Gly. Guidance concerning how to make phenotypically silent amino acid substitutions is provided, for example, in Bowie et al., “Deciphering the Message in Protein Sequences: Tolerance to Amino Acid Substitutions,” Science 247:1306-1310 (1990). In specific embodiments, the polypeptides of the invention comprise, or alternatively, consist of, fragments or variants of the amino acid sequence of a therapeutic protein described herein and/or serum transferrin, and/ modified transferrin protein of the invention, wherein the fragments or variants have 1-5, 5-10, 5-25, 5-50, 10-50 or 50-150 amino acid residue additions, substitutions, and/or deletions when compared to the reference amino acid sequence. In further embodiments, the amino acid substitutions are conservative. Nucleic acids encoding these polypeptides are also encompassed by the invention.
  • The modified fusion proteins of the present invention can be composed of amino-acids joined to each other by peptide bonds or modified peptide bonds and may contain amino acids other than the 20 gene-encoded amino acids. The polypeptides may be modified by either natural processes, such as post-translational processing, or by chemical modification techniques which are well known in the art. Such modifications are well described in basic texts and in more detailed monographs, as well as in a voluminous research literature.
  • Modifications can occur anywhere in a polypeptide, including the peptide backbone, the amino acid side-chains and the amino or carboxy termini. It will be appreciated that the same type of modification may be present in the same or varying degrees at several sites in a given polypeptide. Also, a given polypeptide may contain many types of modifications. Polypeptides may be branched, for example, as a result of ubiquitination, and they may be cyclic, with or without branching. Cyclic, branched, and branched cyclic polypeptides may result from posttranslation natural processes or may be made by synthetic methods. Modifications include acetylation, acylation, ADP-ribosylation, amidation, covalent attachment of flavin, covalent attachment of a heme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid or lipid derivative, covalent attachment of phosphotidylinositol, cross-linking, cyclization, disulfide bond formation, demethylation, formation of covalent cross-links, formation of cysteine, glycosylation, GPI anchor formation, hydroxylation, iodination, methylation, myristylation, oxidation, pegylation, proteolytic processing, phosphorylation, prenylation, racemization, sulfation, transfer-RNA mediated addition of amino acids to proteins such as arginylaltion, and ubiquitination. (See, for instance, PROTEINS—STRUCTURE AND MOLECULAR PROPERTIES, 2nd Ed., T. E. Creighton, W.H. Freeman and Company, New York(1993); POST-TRANSLATIONAL COVALENT MODIFICATION OF PROTEINS, B. C. Johnson, Ed., Academic Press, New York, pgs. 1-12 (1983); Seifter et al. (1990) Meth. Enzymol. 182:626-646; Rattan et al., Ann. N.Y. Acad. Sci. 663:48-62.
  • The therapeutic proteins of the present invention include, but are not limited to polypeptide, peptide, antibody, or fragments and variants thereof. Preferably, the therapeutic proteins of the present invention include β-interferon (β-IFN), glucagon-like peptide-1 (GLP-1), EPO mimetic peptide (EMP-1), T-20, and soluble toxin receptor, such as synaptotagmin I.
  • β-Interferon
  • Most cytokines, including β-IFN, have relatively short circulation half-lives since they are produced in vivo to act locally and transiently. To use β-IFN as an effective systemic therapeutic, one needs relatively large doses and frequent administrations. Such frequent parenteral administrations are inconvenient and painful. Further, toxic side effects are associated with β-IFN administration which are so severe that some multiple sclerosis patients cannot tolerate the treatment. These side effects are probably associated with administration of a high dosage.
  • The present invention provides β-IFN/transferrin fusion proteins with increased half-lives and pharmaceutical compositions comprising such fusion proteins with increased stability. Such fusion proteins can be administered to patients at lower doses, thus reducing the toxic side effects associated with β-IFN. The present invention contemplates the use of the β-IFN/transferrin fusion proteins to treat various diseases and conditions associated with β-IFN, such as but not limited to multiple sclerosis, cancer including brain tumors and skin cancer, and viral infections such as hepatitis B and C. Preferably, the β-IFN/transferrin fusion proteins are used to treat subjects suffering from multiple sclerosis.
  • β-interferon (β-IFN) is a glycoprotein with an apparent molecular weight (MW) of 23 kilodaltons. The gene encoding β-IFN is located on chromosome 9. Its amino acid sequence containing 166 residues was determined by K. Hosoi et al. (J. Interferon Res., 8, pp 375-384 (1988)), and its glucoside sequence was reported by Y. Kagawa et al. (J. Biol. Chem., 263, pp 17508-17515 (1988)).
  • β-IFN is secreted by fibroblasts in response to a viral or bacterial infection, or exposure to foreign cells, macromolecules, or RNA. In particular, β-IFN inhibits the proliferation of infected cells and stimulates the immune system. The specific antiviral activity of homogeneous Hu-β-IFN is considered to be between 3×108 and 1×109 iu/mg (international units per milligram of total protein) inclusive (see U.S. Pat. No. 4,289,689 and EP-A-94 672).
  • “Interferon-beta” (IFN-β) or “beta-interferon” (β-IFN) includes native and recombinant Type I interferons exhibiting the same or similar pharmaceutical characteristics as the Type I interferons commonly known as IFN-β-1a and IFN-β-1b.
  • Any β-IFN sequence may be used to prepare Tf fusion proteins of the present invention. For instance, U.S. Pat. No. 4,738,931 discloses the human β-IFN gene derived from human chromosomal DNA. A 1.8 Kb EcoRI fragment, containing the nucleic acid encoding the human β-IFN, introduced into Escherichia coli has been deposited with the American Type Culture Collection in U.S.A. as Escherichia coli CI4 under accession number ATCC 31905. The GenBank accession number for the amino acid sequence of Human β-IFN amino acid sequence is AAA72588. The β-IFN could also be a mutein as described in U.S. Pat. No. 4,588,585, in which the cysteine (Cys) normally occurring at position 17 of the wild-type or native molecule has been replaced by a neutral amino acid, such as serine or alanine. Mark et al. (Proc. Natl. Acad. Sci. 81: 5662-5666 (1984)) showed that when Cys 17 was changed for serine, the IFN exhibited the same spectrum of biological activities as β-IFN, such as anticellular and antiproliferative activity, activation of NK cells and neutralization of anti-human IFN antibodies. The mutein also exhibited greater stability than natural human (Hu) β-IFN when incubated at 70° C.
  • Because of its activity, β-IFN is regarded as an active principle not only in the treatment and prophylaxis of viral diseases such as herpes, influenza etc, but also in the treatment of tumoral conditions such as encephaloma and leukemia. β-IFN is used to treat multiple sclerosis, brain tumor, skin cancer and hepatitis B and C. β-IFN fusion proteins of the present invention may be used to treat any of these diseases.
  • Human β-IFN is also effective in treating coronary restenosis in humans by selectively inhibiting the proliferation of coronary smooth muscle cell at the site of vascular injury following a surgical procedure while having no inhibitory effect on the normal proliferation of coronary endothelial cells following the procedure. U.S. Pat. No. 5,681,558 discloses a method of treating restenosis comprising administering β-IFN to the patient. Accordingly, β-IFN fusion proteins of the present invention may be used to treat restenosis.
  • β-IFN has an erythropoietic effect on the growth of progenitor cells from individuals suffering from several diseases with a very low production of red blood cells. Additionally, β-IFN increases burst formation as well as promotes a more rapid maturation toward normoblasts and even late reticulocytes. U.S. Pat. No. 5,104,653 discloses a method for the stimulation of erythropoiesis in a patient suffering from a disorder characterized by lack of maturation of progenitor blood cells to red blood cells comprising administering to said patient an erythropoietic effective amount of human β-IFN. Therefore, β-IFN fusion proteins of the present invention may be used to stimulate erythropoiesis.
  • β-IFN, acting via STAT1 and STAT2, is known to upregulate and downregulate a wide variety of genes, most of which are involved in the antiviral immune response. Although most IFN responses are induced by the presence of dsRNA, both DNA and RNA viruses are sensitive to the effects of β-IFN (Biron, Seminars in Immunology, 10: 383-390 (1998)).
  • β-IFN is generally produced in response to a viral infection. Interferon β-IFN exerts its biological effects by binding to specific receptors on the surface of human cells. This binding initiates a complex cascade of intracellular events that leads to the expression of numerous interferon-induced gene products and markers, for example, 2′, 5′-oligoadenylate synthetase, b2-microglobulin, and neopterin.
  • (2′-5′)-Oligoadenylate synthetase and dsRNA dependent protein kinase are the two best-known IFN-β-induced proteins (Biron, 1998, supra). (2′-5′)-oligoadenylate synthetase polymerizes ATP in a unique 2′-5′ fashion (Janeway et al., Immunobiology: The Immune System in Health and Disease, 4th Edition, New York, Elsevier Science/Garland Publishing pp 385-386(1999)); the resultant oligomers activate RNase L, which cleaves mRNA (Biron, 1998, supra). dsRNA dependent protein kinase phosphorylates and inactivates elF2, a transcriptional initiator. Both (2′-5′)-oligoadenylate synthetase and dsRNA dependent protein kinase act only in the presence of dsRNA, i.e. in virally infected cells. The net result of the action of these two proteins is to inhibit protein translation, which will retard viral replication (Biron, 1998, supra).
  • β-IFN dependent upregulation of TAP (transporter associated with antigen processing), Lmp2, Lmp7 serves to increase presentation of viral peptides by MHC class I molecules in order to facilitate CD8 T cell recognition and destruction of infected cells. TAP is the molecule responsible for loading peptide fragments onto MHC class I molecules in the ER; the Lmp proteins are components of the proteasome which cleave proteins specifically for MHC class I presentation (Janeway et al., 1999, supra).
  • β-IFN is known to both activate and induce some proliferation in natural killer (NK) cells (Janeway et al, 1999, supra). However, interferons themselves are not mitogens. The proliferation of NK cells is probably caused by an intermediary cytokine which is induced by IFN-β (Biron, 1998, supra). NK cells can kill cells which exhibit atypical patterns of MHC class I expression; such cells are generally virally infected (Janeway et al., 1999, supra).
  • Although at the end of a successfully defeated infection, T cells die by apoptosis as the immune system returns to a homeostatic balance, some T cells must avoid apoptosis and enter a G0/G1 memory state to preserve immunological memory. These memory T cells are rescued from apoptosis by interacting with stromal cells, which secrete β-IFN and some IFN-α (Pilling et al., European Journal of Immunology 29:1041-1050 (1999)). T cell apoptosis may be induced by either cytokine deprivation or ligation of Fas on the cell surface, but β-IFN is able to block both apoptotic pathways. The former apoptotic pathway is blocked by β-IFN dependent upregulation of Bcl-x, an apoptotic inhibitor. Fas ligation-induced apoptosis occurs much too quickly to be blocked by upregulation of a gene, so β-IFN must block that apoptotic pathway by different means (Scheel-Toellner et al., European Journal of Immunology 29:2603-2612 (1999)). The existence of a second blocking mechanism is supported by the results of Marrack et al. (Journal of Experimental Medicine 189:521-529(1999)), who found that β-IFN prevented T cell apoptosis without increased production of Bcl-x.
  • Der et al. (Proceedings of the National Academy of Sciences, USA 95: 15623-15628 (1998)) found that β-IFN increased transcription of well over 100 proteins in human fibrosarcoma cells. Induced proteins ranged in function from cytochromes and cell scaffolding proteins to immunologically active proteins such as Complement components and dsRNA adenosine deaminase. These results indicate that β-IFN has truly pleiotropic effects, many of which are not fully understood.
  • Much clinical research on β-IFN is currently focused on its use as a treatment for multiple sclerosis (MS). MS is an autoimmune disease in which T cells mount an immune response against self myelin antigens in the glial cells of the central nervous system (Goodkin, 1999. Multiple sclerosis: Treatment options for patients with relapsing-remitting and secondary progressive multiple sclerosis. <http://www.msnews.org/goodkin199.htm>). In 1993, the FDA approved subcutaneous injections of IFN-62 1b for treatment of MS (Revelle M., 1993, FDA licenses interferon beta-lb. (<http://www.fda.gov/bbs/topics/NEWS/NEW00424.html>). β-IFN 1b is a non-glycosylated form of IFN-β produced by E. coli (Arduini et al., Protein Science 8: 1867-1877(1999)). Adverse experiences associated with β-IFN 1b therapy include: injection site reactions (inflammation, pain, hypersensitivity and necrosis), and a flu-like symptom complex (fever, chills, anxiety and confusion). These adverse side effects may be, in fact, reduced or alleviated by fusing β-IFN 1b to transferrin as described above.
  • Currently, β-IFN 1a (a eukaryotic, glycosylated form obtained from hamsters) is also available (Goodkin, 1999, supra). β-IFN 1a is produced by recombinant DNA technology. Interferon beta-la is a 166 amino acid glycoprotein with a predicted molecular weight of approximately 22,500 daltons. It is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human IFN-β gene has been introduced. The amino acid sequence of β-IFN 1a is identical to that of natural human β-IFN and may be used to make Tf fusion proteins of the present invention.
  • β-IFN/transferrin fusion proteins treatment may also ameliorate autoimmune attacks by restoring suppressor T cell function; cotreatment with all-trans-retinoic acid seems to increase this restorative action for unknown reasons (Qu et al., 1998. All-trans retinoic acid potentiates the ability of interferon beta-lb. <http://members.tripod.com/˜ThJuland/ra-beta1b.html>). β-IFN may also inhibit the induction of inducible nitric oxide synthase (INOS) expression by IL-1 and IFN-65 . Production of nitric oxide by INOS in astrocytes has been implicated as a factor in the parthenogenesis of MS (Hua et al. 1998. Beta inteferon prevents nitric oxide/peroxynitrate from damaging the central nervous system. (<http://members.tripod.com/˜ThJuland/nitric-oxide_beta.html>).
  • In one aspect, the present invention includes the use of β-IFN analogs that are therapeutically effective for treating various diseases associated with β-IFN for generating β-IFN/transferrin fusion proteins.
  • In another aspect, the present invention includes the use of the β-IFN/transferrin fusion protein in the methods described above to inhibit or stimulate various cellular processes and for the treatment and prevention of the various disease and conditions described above. In particular, the β-IFN/transferrin fusion protein may be used to treat multiple sclerosis, herpes, influenza, brain tumor, and skin cancer.
  • The β-IFN/transferrin fusion protein of the present invention can be formulated into pharmaceutical compositions by well known methods. See, e.g., Remington's Pharmaceutical Sciences by E. W. Martin, hereby incorporated by reference, describes suitable formulations. The pharmaceutical composition of the β-IFN/transferrin fusion protein of the present invention may be formulated in a variety of forms, including liquid, gel, lyophilized, or any other suitable form. The preferred form will depend upon the particular indication being treated and will be apparent to one of skill in the art.
  • The β-IFN/transferrin fusion protein can be administered in pure form or in an appropriate pharmaceutical composition. Administration can be carried out via any of the accepted modes. Thus, administration can be, for example, orally, nasally, parenterally, topically, transdermally, or rectally, in the form of solid, semi-solid, lyophilized powder, or liquid dosage forms, such as for example, tablets, suppositories, pills, soft elastic and hard gelatin capsules, powders, solutions, suspensions, or aerosols, or the like, preferably in unit dosage forms suitable for simple administration of precise dosages. The compositions will include a conventional pharmaceutical carrier or excipient and the β-IFN/transferrin fusion protein as the active agent, and, in addition, may include other medicinal agents, pharmaceutical agents, carriers, adjuvants, etc.
  • Generally, depending on the intended mode of administration, the pharmaceutically acceptable compositions will contain about 1% to about 99% by weight of the β-IFN /transferrin fusion protein, and 99% to 1 % by weight of a suitable pharmaceutical excipient. The composition could be about 5% to 75% by weight of the β-IFN/transferrin fusion protein with the rest being suitable pharmaceutical excipients.
  • The route of administration could be parenterally, using a convenient daily dosage regimen which can be adjusted according to the degree of severity of the disease, preferably multiple sclerosis, to be treated. For such parenteral administration, a pharmaceutically acceptable composition containing the β-IFN/transferrin fusion protein may be formed by the methods disclosed in U.S. Pat. Nos. 4,462,940, 4,588,585 and 4,992,271.
  • Alternatively, the β-IFN/transferrin fusion protein pharmaceutical compositions may be administered orally, intravenously, intramuscularly, intraperitoneally, intradermally or subcutaneously or in any other acceptable manner. The preferred mode of administration will depend upon the particular indication being treated and will be apparent to one of skill in the art.
  • U.S. Pat. No. 6,333,032 describes effective methods of using β-IFN to treat diseases in warm-blooded vertebrates, such as multiple sclerosis. Treatment of multiple sclerosis comprises administering β-IFN at a dosage of 0.01 to about 5 IU/lb per day in a dosage form adapted to promote contact of said dosage of interferon with the oral and pharyngeal mucosa of said animal. The dosage of interferon could be from 0.1 to about 4.0 IU/lb per day, or from 0.5 to about 1.5 IU/lb of body weight per day.
  • The present invention contemplates administering the β-IFN in a dosage form adapted to assure maximum contact of the interferon in said dosage form with the oral and pharyngeal mucosa of the human or animal undergoing treatment. Contact of interferon with the mucosa can be enhanced by maximizing residence time of the treatment solution in the oral or pharyngeal cavity. Thus, best results seem to be achieved in human patients when the patient is requested to hold said solution of interferon in the mouth for a period of time. Contact of interferon with the oral and pharyngeal mucosa and thereafter with the lymphatic system of the treated human or animal is unquestionably the most efficient method administering immunotherapeutic amounts of interferon.
  • Further, the present invention contemplates the use of the β-IFN/transferrin protein for the manufacture of a medicament which is useful for the treatment of diseases associated with β-IFN. The diseases contemplated by the present invention include but are not limited to those described above.
  • Glucagon-Like Peptide-1 (GLP-1)
  • Glucagon-Like Peptide-1 (GLP-1) is a gastrointestinal hormone that regulates insulin secretion belonging to the so-called enteroinsular axis. The enteroinsular axis designates a group of hormones, released from the gastrointestinal mucosa in response to the presence and absorption of nutrients in the gut, which promote an early and potentiated release of insulin. The incretin effect which is the enhancing effect on insulin secretion is probably essential for a normal glucose tolerance. GLP-1 is a physiologically important insulinotropic hormone because it is responsible for the incretin effect.
  • GLP-1 is a product of proglucagon (Bell, et al., Nature, 1983, 304: 368-371). It is synthesized in intestinal endocrine cells in two principal major molecular forms, as GLP-1(7-36)amide and GLP-1(7-37). The peptide was first identified following the cloning of cDNAs and genes for proglucagon in the early 1980s.
  • Initial studies done on the full length peptide GLP-1(1-37 and 1-36amide) concluded that the larger GLP-1 molecules are devoid of biological activity. In 1987, three independent research groups demonstrated that removal of the first six amino acids resulted in a GLP-1 molecule with enhanced biological activity.
  • The amino acid sequence of GLP-1 is disclosed by Schmidt et al. (1985 Diabetologia 28 704-707). Human GLP-1 is a 37 amino acid residue peptide originating from preproglucagon which is synthesized in the L-cells in the distal ileum, in the pancreas, and in the brain. Processing of preproglucagon to GLP-1(7-36)amide, GLP-1(7-37) and GLP-2 occurs mainly in the L-cells. The amino acid sequence of GLP-1(7-36) and GLP-1(7-37) is (SEQ ID NO: 6):
    His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-
    Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-
    Trp-Leu-Val-Lys-Gly-Arg-X
    wherein X is NH2 for GLP-1 (7-36) and X is Gly for
    GLP-1 (7-37).
  • GLP-1 like molecules possesses anti-diabetic activity in human subjects suffering from Type II (non-insulin-dependent diabetes mellitus (NIDDM)) and, in some cases, even Type I diabetes. Treatment with GLP-1 elicits activity, such as increased insulin secretion and biosynthesis, reduced glucagon secretion, delayed gastric emptying, only at elevated glucose levels, and thus provides a potentially much safer therapy than insulin or sulfonylureas. Post-prandial and glucose levels in patients can be moved toward normal levels with proper GLP-1 therapy. There are also reports suggesting GLP-1-like molecules possess the ability to preserve and even restore pancreatic beta cell function in Type-II patients.
  • Any GLP-1 sequence may be used to make Tf fusion proteins of the present invention, including GLP-1(7-35), GLP-1(7-36), and GLP-1(7-37). GLP-1 also has powerful actions on the gastrointestinal tract. Infused in physiological amounts, GLP-1 potently inhibits pentagastrin-induced as well as meal-induced gastric acid secretion (Schjoldager et al., Dig. Dis. Sci. 1989, 35:703-708; Wettergren et al., Dig Dis Sci 1993; 38:665-673). It also inhibits gastric emptying rate and pancreatic enzyme secretion (Wettergren et al., Dig Dis Sci 1993; 38:665-673). Similar inhibitory effects on gastric and pancreatic secretion and motility may be elicited in humans upon perfusion of the ileum with carbohydrate- or lipid-containing solutions (Layer et al., Dig Dis Sci 1995, 40:1074-1082; Layer et al., Digestion 1993, 54: 385-38). Concomitantly, GLP-1 secretion is greatly stimulated, and it has been speculated that GLP-1 may be at least partly responsible for this so-called “ileal-brake” effect (Layer et al., Digestion 1993; 54: 385-38). In fact, recent studies suggest that, physiologically, the ileal-brake effects of GLP-1 may be more important than its effects on the pancreatic islets. Thus, in dose response studies GLP-1 influences gastric emptying rate at infusion rates at least as low as those required to influence islet secretion (Nauck et al., Gut 1995; 37 (suppl. 2): A124).
  • GLP-1 seems to have an effect on food intake. Intraventricular administration of GLP-1 profoundly inhibits food intake in rats (Schick et al. in Ditschuneit et al. (eds.), Obesity in Europe, John Libbey & Company ltd, 1994; pp. 363-367; Turton et al., Nature 1996, 379: 69-72). This effect seems to be highly specific. Thus, N-terminally extended GLP-1(PG 72-107) amide is inactive and appropriate doses of the GLP-1 antagonist, exendin 9-39, abolish the effects of GLP-I(Tang-Christensen et al., Am. J. Physiol., 1996, 271(4 Pt 2):R848-56). Acute, peripheral administration of GLP-1 does not inhibit food intake acutely in rats (Tang-Christensen et al., Am. J. Physiol., 1996, 271(4 Pt 2):R848-56; Turton et al., Nature 1996, 379: 69-72). However, it remains possible that GLP-1 secreted from the intestinal L-cells may also act as a satiety signal.
  • In diabetic patients, GLP's insulinotropic effects and the effects of GLP-1 on the gastrointestinal tract are preserved (Willms et al, Diabetologia 1994; 37, suppl. 1: A118), which may help curtail meal-induced glucose excursions, but, more importantly, may also influence food intake. Administered intravenously, continuously for one week, GLP-1 at 4 ng/kg/min has been demonstrated to dramatically improve glycaemic control in NIDDM patients without significant side effects (Larsen et al., Diabetes 1996; 45, suppl. 2: 233A.).
  • GLP-1/transferrin fusion proteins comprising at least one analog of GLP-1 and fragments thereof are useful in the treatment of Type 1 and Type 2 diabetes and obesity.
  • As used herein, the term “GLP-1 molecule” means GLP-1, a GLP-1 analog, or GLP-1 derivative.
  • As used herein, the term “GLP-1 analog” is defined as a molecule having one or more amino acid substitutions, deletions, inversions, or additions compared with GLP-1. Many GLP-1 analogs are known in the art and include, for example, GLP-1(7-34), GLP-1(7-35), GLP-1(7-36), Val8-GLP-1(7-37), Gln9-GLP1(7-37), D-Gln9-GLP-1(7-37), Thr16-Lys18-GLP-1(7-37), and Lys18-GLP-1(7-37). U.S. Pat. No. 5,118,666 discloses examples of GLP-1 analogs such as GLP-1(7-34) and GLP-1(7-35).
  • The term “GLP-1 derivative” is defined as a molecule having the amino acid sequence of GLP-1 or a GLP-1 analog, but additionally having chemical modification of one or more of its amino acid side groups, ∀-carbon atoms, terminal amino group, or terminal carboxylic acid group. A chemical modification includes, but is not limited to, adding chemical moieties, creating new bonds, and removing chemical moieties.
  • As used herein, the term “GLP-1 related compound” refers to any compound falling within the GLP-1, GLP-1 analog, or GLP-1 derivative definition.
  • WO 91/11457 discloses analogs of the active GLP-1 peptides 7-34, 7-35, 7-36, and 7-37 which can also be useful as GLP-1 moieties.
  • EP 0708179-A2 (Eli Lilly & Co.) discloses GLP-1 analogs and derivatives that include an N-terminal imidazole group and optionally an unbranched C6-C10 acyl group in attached to the lysine residue in position 34.
  • EP 0699686-A2 (Eli Lilly & Co.) discloses certain N-terminal truncated fragments of GLP-1 that are reported to be biologically active.
  • U.S. Pat. No. 5,545,618 discloses GLP-1 molecules consisting essentially of GLP-1(7-34), GLP1(7-35), GLP-1(7-36), or GLP-1(7-37), or the amide forms thereof, and pharmaceutically-acceptable salts thereof, having at least one modification selected from the group consisting of: (a) substitution of glycine, serine, cysteine, threonine, asparagine, glutamine, tyrosine, alanine, valine, isoleucine, leucine, methionine, phenylalanine, arginine, or D-lysine for lysine at position 26 and/or position 34; or substitution of glycine, serine, cysteine, threonine, asparagine, glutamine, tyrosine, alanine, valine, isoleucine, leucine, methionine, phenylalanine, lysine, or a D-arginine for arginine at position 36; (b) substitution of an oxidation-resistant amino acid for tryptophan at position 31; (c) substitution of at least one of: tyrosine for valine at position 16; lysine for serine at position 18; aspartic acid for glutamic acid at position 21; serine for glycine at position 22; arginine for glutamine at position 23; arginine for alanine at position 24; and glutamine for lysine at position 26; and (d) substitution of at least one of: glycine, serine, or cysteine for alanine at position 8; aspartic acid, glycine, serine, cysteine, threonine, asparagine, glutamine, tyrosine, alanine, valine, isoleucine, leucine, methionine, or phenylalanine for glutamic acid at position 9; serine, cysteine, threonine, asparagine, glutamine, tyrosine, alanine, valine, isoleucine, leucine, methionine, or phenylalanine for glycine at position 10; and glutamic acid for aspartic acid at position 15; and (e) substitution of glycine, serine, cysteine, threonine, asparagine, glutamine, tyrosine, alanine, valine, isoleucine, leucine, methionine, or phenylalanine, or the D- or N-acylated or alkylated form of histidine for histidine at position 7; wherein, in the substitutions is (a), (b), (d), and (e), the substituted amino acids can optionally be in the D-form and the amino acids substituted at position 7 can optionally be in the N-acylated or N-alkylated form.
  • U.S. Pat. No. 5,118,666 discloses a GLP-1 molecule having insulinotropic activity. Such molecule is selected from the group consisting of a peptide having the amino acid sequence His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys (SEQ ID NO: 7) or His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly (SEQ ID NO: 8); and a derivative of said peptide and wherein said peptide is selected from the group consisting of: a pharmaceutically-acceptable acid addition salt of said peptide; a pharmaceutically-acceptable carboxylate salt of said peptide; a pharmaceutically-acceptable lower alkylester of said peptide; and a pharmaceutically-acceptable amide of said peptide selected from the group consisting of amide, lower alkyl amide, and lower dialkyl amide.
  • U.S. Pat. No. 6,277,819 teaches a method of reducing mortality and morbidity after myocardial infarction comprising administering GLP-1, GLP-1 analogs, and GLP-1 derivatives to the patient. The GLP-1 analog being represented by the following structural formula (SEQ ID NO: 9): R1-X1-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-X2-Gly-Gln-Ala-Ala-Lys- X3-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-R2 and pharmaceutically-acceptable salts thereof, wherein: R1 is selected from the group consisting of L-histidine, D-histidine, desamino-histidine, 2-amino-histidine, .beta.-hydroxy-histidine, homohistidine, alpha-fluoromethyl-histidine, and alpha-methyl-histidine; X1 is selected from the group consisting of Ala, Gly, Val, Thr, Ile, and alpha-methyl-Ala; X2 is selected from the group consisting of Glu, Gin, Ala, Thr, Ser, and Gly; X3 is selected from the group consisting of Glu, Gln, Ala, Thr, Ser, and Gly; R2 is selected from the group consisting of NH2, and Gly—OH; provided that the GLP-1 analog has an isoelectric point in the range from about 6.0 to about 9.0 and further providing that when R1 is His, X1 is Ala, X2 is Glu, and X3 is Glu, R2 must be NH2.
  • Ritzel et al. (Journal of Endocrinology, 1998, 159: 93-102) disclose a GLP-1 analog, [Ser8]GLP-1, in which the second N-terminal alanine is replaced with serine. The modification did not impair the insulinotropic action of the peptide but produced an analog with increased plasma stability as compared to GLP-1.
  • U.S. Pat. No. 6,429,197 teaches that GLP-1 treatment after acute stroke or hemorrhage, preferably intravenous administration, can be an ideal treatment because it provides a means for optimizing insulin secretion, increasing brain anabolism, enhancing insulin effectiveness by suppressing glucagon, and maintaining euglycemia or mild hypoglycemia with no risk of severe hypoglycemia or other adverse side effects. The present invention provides a method of treating the ischemic or reperfused brain with GLP-1 or its biologically active analogues after acute stroke or hemorrhage to optimize insulin secretion, to enhance insulin effectiveness by suppressing glucagon antagonism, and to maintain euglycemia or mild hypoglycemia with no risk of severe hypoglycemia.
  • U.S. Pat. No. 6,277,819 provides a method of reducing mortality and morbidity after myocardial infraction, comprising administering to a patient in need thereof, a compound selected from the group consisting of GLP-1, GLP-1 analogs, GLP-1 derivatives and pharmaceutically-acceptable salts thereof, at a dose effective to normalize blood glucose.
  • U.S. Pat. No. 6,191,102 discloses a method of reducing body weight in a subject in need of body weight reduction by administering to the subject a composition comprising a glucagon-like peptide-1 (GLP-1), a glucagon-like peptide analog (GLP-1 analog), a glucagon-like peptide derivative (GLP-1 derivative) or a pharmaceutically acceptable salt thereof in a dose sufficient to cause reduction in body weight for a period of time effective to produce weight loss, said time being at least 4 weeks.
  • GLP-1 is fully active after subcutaneous administration (Ritzel et al., Diabetologia 1995; 38: 720-725), but is rapidly degraded mainly due to degradation by dipeptidyl peptidase IV-like enzymes (Deacon et al., J Clin Endocrinol Metab 1995, 80: 952-957; Deacon et al., 1995, Diabetes 44: 1126-1131). Thus, unfortunately, GL-1 and many of its analogues have a short plasma half-life in humans (Orskov et al., Diabetes 1993; 42:658-661). Accordingly, it is an objective of the present invention to provide transferrin fusion proteins comprising GLP-1 or analogues thereof which have a protracted profile of action relative to GLP-1(7-37). It is a further object of the invention to provide derivatives of GLP-1 and analogues thereof which have a lower clearance than GLP-1(7-37). Moreover, it is an object of the invention to provide pharmaceutical compositions comprising GLP-1/transferrin fusion proteins or GLP-1 analog/transferrin fusion proteins with improved stability. Additionally, the present invention includes the use of GLP-1/transferrin fusion proteins or GLP-1 analog/transferrin fusion proteins to treat diseases associated with GLP-1 such as but not limited to those described above.
  • In one aspect of the present invention, the pharmaceutical compositions comprising the GL-1 peptide/transferrin fusion proteins and GLP-1 analog/transferrin fusion proteins may be formulated by any of the established methods of formulating pharmaceutical compositions, e.g. as described in Remington's Pharmaceutical Sciences, 1985. The composition may be in a form suited for systemic injection or infusion and may, as such, be formulated with a suitable liquid vehicle such as sterile water or an isotonic saline or glucose solution. The compositions may be sterilized by conventional sterilization techniques which are well known in the art. The resulting aqueous solutions may be packaged for use or filtered under aseptic conditions and lyophilized, the lyophilized preparation being combined with the sterile aqueous solution prior to administration. The composition may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions, such as buffering agents, tonicity adjusting agents and the like, for instance sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, etc.
  • The GLP-1/transferrin fusion proteins and GLP-1 analog/transferrin fusion proteins of the present invention may also be adapted for nasal, transdermal, pulmonal or rectal administration. The pharmaceutically acceptable carrier or diluent employed in the composition may be any conventional solid carrier. Examples of solid carriers are lactose, terra alba, sucrose, talc, gelatin, agar, pectin, acacia, magnesium stearate and stearic acid. Similarly, the carrier or diluent may include any sustained release material known in the art, such as glyceryl monostearate or glyceryl distearate, alone or mixed with a wax.
  • It may be of particular advantage to provide the composition of the invention in the form of a sustained release formulation. As such, the composition may be formulated as microcapsules or microparticles containing the GLP-1/transferrin fusion protein or GLP-1 analog/transferrin fusion protein encapsulated by or dispersed in a suitable pharmaceutically acceptable biodegradable polymer such as polylactic acid, polyglycolic acid or a lactic acid/glycolic acid copolymer.
  • For nasal administration, the preparation may contain GLP-1/transferrin fusion proteins or GLP-1 analog/transferrin fusion proteins dissolved or suspended in a liquid carrier, in particular an aqueous carrier, for aerosol application. The carrier may contain additives such as solubilizing agents, e.g. propylene glycol, surfactants, absorption enhancers such as lecithin (phosphatidylcholine) or cyclodextrin, or preservatives such as parabenes.
  • Generally, the compounds of the present invention are dispensed in unit dosage form comprising 0.5-500 mg of the fusion protein together with a pharmaceutically acceptable carrier per unit dosage.
  • Moreover, the present invention contemplates the use of the GLP-1/transferrin and GLP-1 analog/transferrin fusion proteins for the manufacture of a medicinal product which can be used in the treatment of diseases associated with elevated glucose level, such as but not to limited to those described above. Specifically, the present invention contemplates the use of GLP-1/transferrin fusion protein for the treatment of diabetes including type II diabetes, obesity, severe bums, and heart failure, including congestive heart failure and acute coronary syndrome.
  • The N-terminus of GLP-1 is normally amidated. In yeast, amidation does not occur. In one aspect of the invention, in order to compensate for amidation on the N-terminus which does not occur in yeast, an extra amino acid is added on the N-terminus of GLP-1. The addition of an amino acid to the N-terminus of GLP-1 may prevent dipeptidyl peptidase from cleaving at the second amino acid of GLP-1 due to steric hindrance. Therefore, GLP-1 will remain functionally active. Any one of the 20 amino acids may be added to the N-terminus of GLP-1. In some instances, an uncharged or positively charged amino acid may be used and preferably, a smaller amino acid such as Glycine is added. The GLP-1 with the extra amino acid is then fused to transferrin. Accordingly, the GLP-1 with the added amino acid will be fused at the N-terminus of the GL-1/transferrin fusion protein.
  • GLP-mTf Fusion Protein for Treating Type 2 Diabetes
  • As discussed above, GLP-1 activates and regulates important endocrine hormone systems in the body and plays a critical management role in the metabolism of glucose. Unlike all other diabetic treatments on the market GLP-1 has the potential to be restorative by acting as a growth factor for B-cells thus improving the ability of the pancreas to secrete insulin and also, to make the existing insulin levels act more efficiently by improving sensitivity and better stabilizing glucose levels. This reduces the burden on daily monitoring of glucose levels and potentially offers a delay in the serious long term side effects caused by fluctuations in blood glucose due to diabetes. Furthermore, GLP-1 can reduce appetite and reduce weight. Obesity is an inherent consequence of poor control of glucose metabolism and this only serves to aggravate the diabetic condition.
  • Clinical application of natural GLP-1 is limited because it is rapidly degraded in the circulation (half-life is several minutes). To maintain therapeutic levels in the circulation requires constant administration of high doses using pumps or patch devices which adds to the cost of treatment. This is inconvenient for long term chronic use especially in conjunction with all the other medications for treating diabetes and monitoring of glucose levels. The GLP-1 fusion proteins retain the activity of GLP-1 but have the long half-life (14-17 days), solubility, and biodistribution properties of transferrin (mTf). These properties could provide for a low cost, small volume, monthly s.c. (subcutaneous) injection and this type of product is absolutely needed for long term chronic use.
  • EPO Mimetic Peptide (EMP)
  • Erythropoietin (EPO) is a glycoprotein hormone that is synthesized in the kidneys of mammals for stimulating mitotic cell division and differentiation of erythrocyte precursor cells. Accordingly, EPO acts to stimulate and regulate the production of erythrocytes. Because of its role in red blood cell formation, EPO is useful in both the diagnosis and the treatment of blood disorders characterized by low or defective red blood cell production.
  • Studies have shown the efficacy of EPO therapy in a variety of disease states, disorders, and states of hematologic irregularity, for example, beta-thalassemia (Vedovato et al. (1984) Acta. Haematol. 71:211-213); cystic fibrosis (Vichinsky et al. (1984) J. Pediatric 105:15-21); pregnancy and menstrual disorders (Cotes et al. (1983) Brit. J. Ostet. Gyneacol. 90:304-311); early anemia of prematurity (Haga et al. (1983) Acta Pediatr. Scand. 72:827-831); spinal cord injury (Claus-Walker et al. (1984) Arch. Phys. Med. Rehabil. 65:370-374); space flight (Dunn et al. (1984) Eur. J. Appl. Physiol. 52:178-182); acute blood loss (Miller et al. (1982) Brit. J. Haematol. 52:545-590); aging (Udupa et al. (1984) J. Lab. Clin. Med. 103:574-588); various neoplastic disease states accompanied by abnormal erythropoiesis (Dainiak et al. (1983) Cancer 5:1101-1106); and renal insufficiency (Eschbach et al (1987) N. Eng. J. Med. 316:73-78). During the last fifteen years, EPO has been used for the treatment of the anemia of renal failure, anemia of chronic disease associated with rheumatoid arthritis, inflammatory bowel disease, AIDS, and cancer, as well as for the treatment of anemia in hematopoietic malignancies, post-bone marrow transplantation, and autologous blood donation.
  • The activity of EPO is mediated by its receptor. The EPO-receptor (EPO-R) belongs to the class of growth-factor-type receptors which are activated by a ligand-induced protein dimerization. Other hormones and cytokines such as human growth hormone (hGH), granulocyte colony stimulating factor (G-CSF), epidermal growth factor (EGF) and insulin can cross-link two receptors resulting in juxtaposition of two cytoplasmic tails. Many of these dimerization-activated receptors have protein kinase domains within the cytoplasmic tails that phosphorylate the neighboring tail upon dimerization. While some cytoplasmic tails lack intrinsic kinase activity, these function by association with protein kinases. The EPO receptor is of the latter type. In each case, phosphorylation results in the activation of a signaling pathway.
  • There has been an increasing interest in molecular mimicry with EPO potency. For example, dimerization of the erythropoietin receptor (EPOR) in the presence of either natural EPO or synthetic EPO mimetic peptides (EMPs) is the extracellular event that leads to activation of the receptor and downstream signal transduction events. In general, there is an interest in obtaining mimetics with equivalent potency to EPO.
  • Wrighton et al (1996, Science, 273:458-463) employed phage display where random peptides are to be exposed on coat proteins of filamentous phage. A library of random peptide-phage was allowed to bind to and subsequently eluted from the extracellular domain of EPO receptor in the screening system. They used weak-binding system to first fish out EPO domain-weak-binding (Kd 10 mM) CRIGPITWVC (SEQ ID NO: 10) as the consensus sequence. Consequently, a 20-amino acid peptide, EMP1, (GGTYSCHFGPLTWVCKPQGG, SEQ ID NO: 11) with an affinity (Kd) of 200 nM, compared to 200 pM for EPO was isolated, the sequence of which does not actually exist in the native EPO. The crystal structure at 2.8 A resolution of a complex of this mimetic agonist peptide with the extracellular domain of EPO receptor revealed that a peptide dimer induces an almost perfect twofold dimerization of the receptor (Livnah et al., 1996 Science, 273 (274): 464-471). This 20-amino acid peptide has a b-sheet structure and is stabilized by the C—C disulfide bond.
  • The biological activity of EMP1 indicates that EMP1 can act as an EPO mimetic. For example, EMP1 competes with EPO in receptor binding assays to cause cellular proliferation of cell lines engineered to be responsive to EPO (Wrighton et al., 1996, Science, 273:458-463). Both EPO and EMP1 induce a similar cascade of phosphorylation events and cell cycle progression in EPO responsive cells (Wrighton et al., 1996, Science, 273:458-463). Further, EMP1 demonstrates significant erythropoietic effects in mice as monitored by two different in vivo assays of nascent red blood cell production (Wrighton et al., 1996, Science, 273:458-463).
  • Johnson et al. (1998, Biochemistry, 37:3699-3710) identified the minimal peptide that retained activity in the assays for EPO mimetic action. Using N- and C-terminal deletions, they found that the minimal active peptide is EMP20 having the sequence, YSCHFGPLTWVCK (SEQ ID NO: 12), namely amino acids 4 through 16 of EMP1. They also found Tyr4 and Trp 13 of EMP1 are critical for mimetic action.
  • The present invention provides EMP1/transferrin fusion proteins with increased half-life and pharmaceutical compositions comprising such fusion proteins. The present invention contemplates the use of the fusion protein to treat various diseases and conditions associated with EPO such as but not limited to those described above.
  • In one embodiment of the present invention, the pharmaceutical compositions comprising the EMP1/transferrin fusion protein and may be formulated by any of the established methods of formulating pharmaceutical compositions, e.g. as described in Remington's Pharmaceutical Sciences, 1985. The composition may be in a form suited for systemic injection or infusion and may, as such, be formulated with a suitable liquid vehicle such as sterile water or an isotonic saline or glucose solution. These pharmaceutical compositions may contain buffers, salts and other excipients to stabilize the composition or assist in the delivery of the transferrin fusion proteins.
  • In a preferred embodiment, the present invention provides a method for treating disorders associated with EPO. The method is accomplished by administering a EMP1/transferrin fusion protein provided herein for a time and under conditions sufficient to alleviate the symptoms of the disorder, i.e. sufficient to effect dimerization or biological activation of EPO receptors. In the case of EPO such methodology is useful in the treatment of end-stage renal failure/dialysis; anemia, especially associated with AIDS or chronic inflammatory diseases such as rheumatoid arthritis and chronic bowel inflammation; auto-immune disease; and for boosting the red blood cell count of patient when necessary, e.g. prior to surgery or as pretreatment to transfusion. The EMP1/transferrin fusion protein of the present invention which behave as EPO agonists can be used to activate megakaryocytes.
  • Since EPO has been shown to have a mitogenic and chemotactic effect on vascular endothelial cells as well as an effect on central cholinergic neurons (Amagnostou et al. (1990) Proc. Natl. Acad. Sci. USA 87:597805982; Konishi et al. (1993) Brain Res. 609:29-35), the compounds of this invention can also be used to treat a variety of vascular disorders, such as promoting wound healing, growth of collateral coronary blood vessels (such as those that may occur after myocardial infarction), trauma, and post vascular graft treatment, and a variety of neurological disorders, generally characterized by low absolute levels of acetyl choline or low relative levels of acetyl choline as compared to other neuroactive substances e.g., neurotransmitters.
  • Accordingly, the present invention includes pharmaceutical compositions comprising, as an active ingredient, the EMP1/transferrin fusion protein of the present invention in association with a pharmaceutical carrier or diluent. The EMP1/transferrin fusion protein of this invention can be administered by oral, parenteral (intramuscular, intraperitoneal, intravenous (IV) or subcutaneous injection), transdermal (either passively or using iontophoresis or electroporation) or transmucosal (nasal, vaginal, rectal, or sublingual) routes of administration in dosage forms appropriate for each route of administration.
  • Solid dosage forms for oral administration include capsules, tablets, pill, powders, and granules. In such solid dosage forms, the active compound is admixed with at least one inert pharmaceutically acceptable carrier such as sucrose, lactose, or starch. Such dosage forms can also comprise, as it normal practice, additional substances other than inert diluents, e.g., lubricating, agents such as magnesium stearate. In the case of capsules, tablets and pills, the dosage forms may also comprise buffering, agents. Tablets and pills can additionally be prepared with enteric coatings.
  • Liquid dosage forms for oral administration include pharmaceutically acceptable emulsions, solutions, suspensions, syrups, with the elixirs containing inert diluents commonly used in the art, such as water. Besides such inert diluents, compositions can also include adjuvants, such as wetting agents, emulsifying and suspending agents, and sweetening, flavoring and perfuming agents.
  • Preparations according to this invention for parenteral administration include sterile aqueous or non-aqueous solutions, suspensions, or emulsions. Examples of non-aqueous solvents or vehicles are propylene glycol, polyethylene glycol, vegetable oils, such as olive oil and corn oil, gelatin, and injectable organic esters such as ethyl oleate. Such dosage forms may also contain adjuvants such as preserving, wetting, emulsifying, and dispersing agents. They may be sterilized by, for example, filtration through a bacteria retaining filter, by incorporating sterilizing agents into the compositions, by irradiating the compositions, or by heating the compositions. They can also be manufactured using sterile water, or some other sterile injectable medium, immediately before use.
  • Compositions for rectal or vaginal administration are preferably suppositories which may contain, in addition to the active substance, excipients such as cocoa butter or a suppository wax. Compositions for nasal or sublingual administration are also prepared with standard excipients well known in the art.
  • The dosage of active ingredient in the compositions of this invention may be varied; however, it is necessary that the amount of the active ingredient shall be such that a suitable dosage form is obtained. The selected dosage depends upon the desired therapeutic effect, on the route of administration, and on the duration of the treatment desired. Generally dosage levels of between 0.001 to 10 mg/kg of body weight daily are administered to mammals.
  • Moreover, the present invention also contemplates the use of the transferrin fusion protein comprising EMP1 or analogs thereof for the manufacture of a medicinal product which can be used in the treatment of diseases associated with low or defective red blood cell production. Examples of such diseases are not limited to those described above.
  • T-20 and T-1249
  • HIV infection is pandemic and HIV associated diseases represent a major world health problem. Although considerable effort is being put into the successful design of effective therapeutics, currently no curative anti-retroviral drugs against AIDS exist. In attempts to develop such drugs, several stages of the HIV life cycle have been considered as targets for therapeutic intervention (Mitsuya, H. et al., 1991, FASEB J. 5:2369-2381). For example, virally encoded reverse transcriptase has been one focus of drug development. A number of reverse-transcriptase-targeted drugs, including 2′,3′-dideoxynucleoside analogs such as AZT, ddI, ddc, and d4T have been developed which have been shown to been active against HIV (Mitsuya, H. et al., 1991, Science 249:1533-1544). While beneficial, these nucleoside analogs are not curative, probably due to the rapid appearance of drug resistant HIV mutants (Lander, B. et al., 1989, Science 243:1731-1734). In addition, the drugs often exhibit toxic side effects, such as bone marrow suppression, vomiting, and liver function abnormalities.
  • Entry inhibitors are distinct from the existing classes of drugs that fight HIV. Other drugs work inside the infected cell. Nucleoside reverse transcriptase inhibitors such as AZT and abacavir and non-nucleoside reverse transcriptase inhibitors like nevirapine and efavirenz all act by shutting down the reverse transcriptase enzyme that HIV uses to replicate itself once it is inside the cell. Protease inhibitors shut down the viral protease enzyme HIV uses to package itself up for export. By contrast, entry inhibitors are drugs that interfere with the processes involved in the virus' initial assault on the cell's outer membrane.
  • T-20 is the most studied of all the entry inhibitors and is the first member of the fusion inhibitor class. Unlike existing AIDS drugs that work inside the cell and target viral enzymes involved in the replication of the virus, T-20 inhibits fusion of HIV with host cells before the virus enters the cell and begins its replication process. T-20 binds to one of the two helical domains of gp41. Gp41 is a spring-loaded HIV-1 protein that is activated when CD4 binds to HIV gp-120. The fusion action of gp41 is inhibited if its two helical domains cannot fold together. T-20 binds to gp41, effectively keeping the protein from functioning. It has been shown in early, single-arm clinical studies to be about as potent as a protease inhibitor by itself-giving greater than 10 fold reductions in viral load-and to be safe in combination with other antiretrovirals.
  • U.S. Pat. No. 5,464,933 discloses T-20 (pentafuside, DP-178) as a 36 amino acid synthetic peptide. Since this drug is a peptide, it cannot be given orally because it is readily broken down by the digestive system. When administered by subcutaneous injection, T-20 achieves sufficient levels in the blood to have anti-HIV activity. It is administered by subcutaneous injection twice daily. However, patients develop skin reactions at the injection site. The most frequently reported treatment related adverse events were mild to moderate local injection site reactions. These consist of mild pain, temporary swelling and redness at the site of injection.
  • U.S. Pat. No. 6,479,055 discloses peptide analogs of the DP-178 (peptides corresponding to amino acid residues 638 to 673 of transmembrane protein gp41 of HIV-1LA1, which exhibit anti-membrane fusion capability, antiviral activity, such as the ability to inhibit HIV transmission to uninfected CD-4+ cells, or an ability to modulate intracellular processes involving coiled-coil peptide structures. Further, the patent relates to the use of DP-178 and DP-1 78 portions and/or analogs as antifusogenic or antiviral compounds or as inhibitors of intracellular events involving coiled-coil peptide structures. Further, the patent teaches the use of the peptides as diagnostic agents. For example, a DP178 peptide may be used as an HIV subtype-specific diagnostic.
  • T-1249 is a sister compound of T-20. Like T-20, T-1249 targets the HIV glycoprotein known as gp41 which HIV uses to bind onto CD4 cells. T-1249 has shown potent anti-HIV effects in animal and laboratory studies. Preliminary safety, dosing and efficacy studies in humans have provided support for ongoing research.
  • T-1249 is currently administered by subcutaneous (under the skin) injection once or twice daily. The first safety study of T-1249 conducted in humans found two serious adverse events: hypersensitivity reaction (oral ulcers, maculopapular rash, fever) and severe neutropenia. Forty percent of recipients developed injection site reactions but these were deemed to be mild. Dizziness, diarrhea, headache and fever have also been reported by recipients. No dose-limiting toxicity was identified and experiments with higher doses are likely.
  • T-1249 has completed phase I/II safety and dosing studies. Initial results indicated that higher doses produced an average viral load drop of 1.3 log.
  • Dose-dependent decreases in HIV RNA have been reported. In the study of T-1249, the average reduction from baseline ranged from 0.29 to 1.96 log copies/ml (Gulick 2002).
  • The present invention provides transferrin fusion proteins comprising T-20, T-1249, or analogs thereof with increased half-life and pharmaceutical compositions comprising such fusion proteins. The present invention also provides pharmaceutical compositions comprising these transferrin fusion proteins for therapeutic purposes. The present invention contemplates the use of such fusion proteins as inhibitors of human and non-human retroviral, especially HIV, transmission to uninfected cells. The human retroviruses whose transmission may be inhibited by the peptides of the invention include, but are not limited to all strains of HIV-1 and HIV-2 and the human T-lymphocyte viruses (HTLV-I, II, III). The non-human retroviruses whose transmission may be inhibited by the peptides of the invention include, but are not limited to bovine leukosis virus, feline sarcoma and leukemia viruses, simian sarcoma and leukemia viruses, and sheep progress pneumonia viruses.
  • With respect to HIV, the transferrin fusion protein of the present invention comprising T-20, T-1249 or analogs thereof may be used as a therapeutic in the treatment of AIDS. These transferrin fusion proteins may be administered using techniques well known to those in the art. Preferably, the pharmaceutical compositions comprising these transferrin fusion proteins are formulated and administered systemically. Techniques for formulation and administration may be found in “Remington's Pharmaceutical Sciences” 18th ed., 1990 Mack Publishing Co., Easton, Pa. Suitable routes may include oral, rectal, transmucosal, or intestinal administration; parenteral delivery, including intramuscular, subcutaneous, intramedullary injections, as well as intrathecal, direct intraventricular, intravenous, intraperitoneal, intranasal, or intraocular injections, just to name a few. Most preferably, administration is intravenous. For injection, the transferrin fusion proteins comprising T-20, T1249, or analogs thereof may be formulated in aqueous solutions, preferably in physiologically compatible buffers such as Hanks' solution, Ringer's solution, or physiological saline buffer. For such transmucosal administration, penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art.
  • In addition, the transferrin fusion protein comprising T-20, T1249, or analogs thereof may be used as a prophylactic measure in previously uninfected individuals after acute exposure to an HIV virus. Examples of such prophylactic use of the peptides may include, but are not limited to, prevention of virus transmission from mother to infant and other settings where the likelihood of HIV transmission exists, such as, for example, accidents in health care settings wherein workers are exposed to HIV-containing blood products. The transferrin fusion proteins of the present invention comprising T-20, T-1249, or analogs thereof in such cases may serve the role of a prophylactic vaccine, wherein the host raises antibodies against the fusion proteins of the invention, which then serve to neutralize HIV viruses by, for example, inhibiting further HIV infection. Administration of the transferrin fusion proteins of the invention as a prophylactic vaccine, therefore, would comprise administering to a host a concentration of transferrin fusion protein effective in raising an immune response which is sufficient to neutralize HIV, by, for example, inhibiting HIV ability to infect cells. The exact concentration will depend upon the specific peptide in the transferrin fusion protein to be administered, but may be determined by using standard techniques for assaying the development of an immune response which are well known to those of ordinary skill in the art. The transferrin fusion protein to be used as vaccines are usually administered intramuscularly.
  • Effective dosages of the transferrin fusion proteins comprising T-20, T-1249, or analogs thereof to be administered may be determined through procedures well known to those in the art which address such parameters as biological half-life, bioavailability, and toxicity. Given the data presented below in Section 6, DP-178, for example, may prove efficacious in vivo at doses required achieve circulating levels of 10 ng per ml of peptide.
  • Furthermore, the present invention contemplates the use of the transferrin fusion proteins comprising T-20, T-1249, or analogs thereof for the manufacture of a medicinal product for the treatment of diseases associated with the transmission of a virus.
  • Soluble Toxin Receptors
  • The present invention provides fusion proteins comprising soluble toxin receptor and transferrin or modified transferrin. As used herein, the term “toxin” refers to a poisonous substance of biological origin. The fusion proteins comprising a soluble toxin receptor may be used to treat patients suffering from diseases associated with toxins. Such fusion proteins may also be used for diagnostic purposes.
  • Examples of toxins include, but are not limited to, Pseudomonas exotoxins (PE), Diphtheria toxins (DT), ricin toxin, abrin toxin, anthrax toxins, shiga toxin, botulism toxin, tetanus toxin, cholera toxin, maitotoxin, palytoxin, ciguatoxin, textilotoxin, batrachotoxin, alpha conotoxin, taipoxin, tetrodotoxin, alpha tityustoxin, saxitoxin, anatoxin, microcystin, aconitine, exfoliatin toxins A and B, enterotoxins, toxic shock syndrome toxin (TSST-1), Y. pestis toxin, gas gangrene toxin, and others. Because of the seriousness of the diseases that some of these toxins cause and the ease of obtaining some of them for biological warfare, there is a need to develop methods to obtain large quantities of potent anti-toxins at a low cost.
  • The present invention contemplates the use of soluble toxin receptors as anti-toxins for treatment and prevention of diseases associated with various toxins. Toxin receptors are molecules that bind to a specific toxin. A soluble toxin receptor is one that is capable of being dissolved. Usually peptides or fragments of a receptor are soluble. The present invention is directed to soluble peptides or fragments of a toxin receptor that bind a specific toxin.
  • Similar to other peptides discussed above, these peptides have a short half-life. The present invention provides fusion proteins comprising a soluble peptide of a toxin receptor fused to a transferrin or modified transferrin molecule. The resulting fusion protein has an increased half-life as compared to the soluble toxin receptor peptide. The fusion protein is also easy to produce in large quantities by recombinant means. Since the binding properties of the soluble peptide has not been altered, it will bind the toxin in circulation and prevent the toxin from binding to the target receptor, thus inactivating the toxin. Accordingly, the fusion protein is a potent anti-toxin.
  • In one embodiment, the present invention provides pharmaceutical composition comprising soluble toxin receptor fused to transferrin or modified transferrin and a pharmaceutically acceptable carrier. In another embodiment, the present invention provides the use of transferrin fusion protein comprising soluble toxin receptor for the manufacture of a medicament for the treatment or prevention of diseases or conditions associated with a toxin.
  • Unlike antibodies which are difficult and expensive to produce in large quantities, the present transferrin/anti-toxin fusion protein is highly potent and less costly to manufacture. Additionally, immunization is not expected to maintain the antibody titers required to protect in instances of mass exposure following an act of bioterrorism. It is unrealistic for the population to be immunized on a mass scale in anticipation of an exposure.
  • Bacillus Anthracis Toxin Receptor
  • Anthrax toxin is a well-known agent of biological warfare derived from Bacillus anthracis. Bacillus anthracis produces three proteins which when combined appropriately form two potent toxins, collectively designated anthrax toxin. Protective antigen (PA, 82,684 Da (Dalton)) and edema factor (EF, 89,840 Da) combine to form edema toxin (ET), while PA and lethal factor (LF, 90,237 Da) combine to form lethal toxin (LT) (Leppla, S. H. Alouf, J. E. and Freer, J. H., eds. Academic Press, London 277-302, 1991). ET and LT each conform to the AB toxin model, with PA providing the target cell binding (B) function and EF or LF acting as the effector or catalytic (A) moieties. A unique feature of these toxins is that LF and EF have no toxicity in the absence of PA, apparently because they cannot gain access to the cytosol of eukaryotic cells.
  • Recently, two of the targets of Lethal factor (LF) were identified in cells. LF is a metalloprotease that specifically cleaves Mek1 and Mek2 proteins, kinases that are part of the MAP-kinase signaling pathway. LF's proteolytic activity inactivates the MAP-kinase signaling cascade through cleavage of mitogen activated protein kinase kinases 1 or 2 (MEK1 or MEK2). (Leppla, S. A. In The Comprehensive Sourcebook of Bacterial Protein Toxins. J. E. Alouf and J. H. Freer, Eds. 2nd edition, San Diego, Academic Press, 1999; pp243-263.).
  • PA is capable of binding to the surface of many types of cells. After PA binds to a specific receptor (Leppla, supra, 1991) on the surface of susceptible cells, it is cleaved at a single site by a cell surface protease, probably furin, to produce an amino-terminal 19-kDa fragment that is released from the receptor/PA complex (Singh et al., J. Biol. Chem. 264:19103-19107, 1989). Removal of this fragment from PA exposes a high-affinity binding site for LF and EF on the receptor-bound 63-kDa carboxyl-terminal fragment (PA63). The complex of PA63 and LF or EF enters cells and probably passes through acidified endosomes to reach the cytosol.
  • PA, the non-toxic, cell-binding component of the toxin, is the essential component of the currently available human vaccine. The vaccine is usually produced from batch cultures of the Sterne strain of B. anthracis, which although avirulent, is still required to be handled as a Class III pathogen. In addition to PA, the vaccine contains small amounts of the anthrax toxin moieties, edema factor and lethal factor, and a range of culture derived proteins. All these factors contribute to the recorded reactogenicity of the vaccine in some individuals. The vaccine is expensive and requires a six month course of four vaccinations. Futhermore, present evidence suggests that this vaccine may not be effective against inhalation challenge with certain strains (M. G. Broster et al., Proceedings of the International Workshop on Anthrax, Apr. 11-13, 1989, Winchester UK. Salisbury med Bull Suppl No 68, (1990) 91-92).
  • Bradley et al. (Nature, 2001, 414: 225-229) disclose cloning of the human anthrax receptor that binds to PA. The receptor, ATR (anthrax toxin receptor) is a type I membrane protein consisting of 368 amino acids. The protein has a predicted signal peptide of 27 amino acids, an extracellular domain of 293 amino acids containing three putative N-linked glycosylation sites, a putative transmembrane region of 23 amino acids and a short cytoplasmic tail of 25 amino acids. A notable feature of ATR is that the extracellular domain consists of a von willebrand factor type A (VWA) domain which is known to be important in protein-protein interactions. This VWA domain is located at amino acids 44 to 216. A soluble version of ATR comprising amino acids 41-227 was shown to bind the anthrax toxin. Accordingly, the VWA domain of ATR binds directly to PA.
  • The present invention provides an anthrax antitoxin comprising the extracellular domain of ATR fused to transferrin or modified transferrin molecule. The present invention also contemplates fusion proteins comprising fragments thereof of the extracellular domain of ATR that binds PA fused to transferrin or modified transferrin molecule. Moreover, the present invention contemplates fusion proteins comprising small molecule mimetics of the extracellular domain of ATR that binds PA fused to transferrin or modified transferrin molecule. Preferably, the present invention provides amino acids 41-227 of ATR fused to transferrin or modified transferrin molecule.
  • Clostridium Botulinum Toxin
  • The clostridial neurotoxins are the most poisonous substance. Humans are exposed to the neurotoxin produced by Clostridium tetani (tetanus toxin) as a result of wounds. Although the tetanus toxin remains a serious public health problem in developing countries around the world, nearly everyone in the western world is protected from tetanus toxin as a consequence of childhood immunizations. Humans usually come into contact with the neurotoxin produced by Clostridium botulinum (botulinum toxin) through food poisoning. However, there are rare incidents of wound botulism and colonizing infection of neonates known as infant botulism. Since botulinum poisoning is rare, immunization of the general population is not warranted on the basis of cost and the expected rates of adverse reaction to the vaccine. Therefore, humans are not protected from botulinum toxins. Additionally, these toxins are relatively to produce. Consequently, botulinum toxins are likely biological warfare agents.
  • As discussed, the anaerobic, gram positive bacterium Clostridium botulinum produces the most poisonous biological neurotoxin known with a lethal human dose in the nanogram range. The effect of the toxin ranges from diarrheal diseases that can cause destruction of the colon, to paralytic effects that can cause death. The spores of Clostridium botulinum are found in soil and can grow in improperly sterilized and sealed food containers of home based canneries, which are the cause of many of the cases of botulism. The symptoms of botulism typically appear 18 to 36 hours after eating the foodstuffs infected with a Clostridium botulinum culture or spores. The botulinum toxin can apparently pass unattenuated through the lining of the gut and attack peripheral motor neurons. Symptoms of botulinum toxin intoxication can progress from difficulty walking, swallowing, and speaking to paralysis of the respiratory muscles and death.
  • Botulism disease may be grouped into four types, based on the method of introduction of toxin into the bloodstream. Food-borne botulism results from ingesting improperly preserved and inadequately heated food that contains botulinal toxin (i.e., the toxin is pre-formed prior to ingestion). Wound-induced botulism results from C. botulinum penetrating traumatized tissue and producing toxin that is absorbed into the bloodstream. Since 1950, thirty cases of wound botulism have been reported (Swartz, “Anaerobic Spore-Forming Bacilli: The Clostridia,” pp. 633-646, in Davis et al., (eds.), Microbiology, 4th edition, J.B. Lippincott Co. (1990)). Inhalation botulism results when the toxin is inhaled. Inhalation botulism has been reported as the result of accidental exposure in the laboratory (Holzer, Med. Klin., 41:1735 [1962]) and is a potential danger if the toxin is used as an agent of biological warfare (Franz et al., in Botulinum and Tetanus Neurotoxins, DasGupta (ed.), Plenum Press, New York [1993], pp. 473-476). Infectious infant botulism results from C. botulinum colonization of the infant intestine with production of toxin and its absorption into the bloodstream.
  • Different strains of Clostridium botulinum each produce antigenically distinct toxin designated by the letters A-G. Serotype A toxin has been implicated in 26% of the cases of food botulism; types B, E, and F have also been implicated in a smaller percentage of the food botulism cases (Sugiyama, Microbiol. Rev., 44:419 (1980)). Wound botulism has been reportedly caused by only types A or B toxins (Sugiyama, supra). Nearly all cases of infant botulism have been caused by bacteria producing either type A or type B toxin (exceptionally, one New Mexico case was caused by Clostridium botulinum producing type F toxin and another by Clostridium botulinum producing a type B-type F hybrid) (Arnon, Epidemiol. Rev., 3:45 (1981)). Type C toxin affects waterfowl, cattle, horses and mink. Type D toxin affects cattle, and type E toxin affects both humans and birds.
  • Clostridium botulinum neurotoxin acts on nerve endings to block acetylcholine release. Binding of the neurotoxin to a membrane receptor through its heavy chain is the first essential step in its mode of toxin action. Li et al. (J Nat Toxins 1998, 7(3):215-26) purified Type E botulinum neurotoxin (BoNT/E) or type A botulinum neurotoxin (BoNT/A) from rat brain synaptosomes employing a neurotoxin affinity column chromatography. The protein fraction eluted from the affinity column with 0.5 M NaCl contained a 57 kDa protein as a major eluant. Immunoblotting the eluant with anti-synaptotagmin antibodies revealed that the 57 kDa protein was synaptotagmin I. Rat synaptotagmin I has been suggested as the receptor for BoNT/B (Nishiki et al., J. Biol. Chem. 269, 10498-10503, 1994) in rat brain. Li et al. investigated the binding of BoNT/A and BoNT/E to synaptotagmin I by a microtiter plate-based method. Binding of synaptotagmin I to BoNT/A coated on the plate was competitively reduced upon preincubation of the proteins with BoNT/E, suggesting a competitive binding of BoNT/A and BoNT/E to the receptor. Taken together, these results suggest that the same receptor protein binds to all three BoNT serotypes tested.
  • Synaptotagmin I is a broad acting receptor of Clostridium botulinum neurotoxin serotypes A, B, and E and possibly C, D, F, and G. It is located on the motor neuronal cell. The N-terminal fragment of synaptotagmin I, amino acids 1-53 (SEQ ID NO: 4), is responsible for binding to the various neurotoxin serotypes. The binding mediates translocation of the neurotoxin into the cell and blocks neurotransmitter release which results in paralysis and in extreme cases fatality. The N-terminal fragment may be produced by recombinant means and used to bind neurotoxins in circulation. The binding of the fragment to the neurotoxin prevents the neurotoxin from binding its target receptor which results in neutralization of the toxin.
  • The goal of the present invention is to provide an anti-toxin of Clostridium botulinum with significantly increased half-life as compared to the recombinantly produced 53 amino acid fragment, so that the anti-toxin has sufficient time to find and bind the neurotoxins as they enter the circulation. The present invention provides a fusion protein comprising the N-terminal 53 amino acid fragment of synaptotagmin I fused to transferrin or modified transferrin, thereby increasing the half-life of the fragment without altering the binding properties of the fragment. Alternatively, the fragment could be chemically pegylated to prolong circulating life. The longer half-life of the anti-toxin will make a given dose more effective. Unlike antibodies, the present anti-toxin fusion protein is broad acting and bind to several neurotoxin serotypes, specifically neurotoxin A, B, and E.
  • In a preferred embodiment, the fusion protein is produced in a highly efficient microbial production system which can provide large quantities of the anti-toxin at a reasonable cost to treat the population following mass exposure in acts of bioterrorism. This fusion protein can also be used in a prophylactic mode prior to exposure
  • The present invention also contemplates anti-toxins comprising peptide fragments of amino acids 1-53 of synaptotagmin I or small molecule mimetics of amino acids 1-53 of snynaptotagmin I fused to transferrin or modified transferrin molecule.
  • The fusion protein can also be used to block botulism spread through food or air contamination among the civilian population.
  • In one aspect of the invention, the anti-toxin fusion protein is used to treat wound botulism resulting from drug use and accidental overdose of botulinum neurotoxin following the treatment of various diseases such as migraine dystonia, and hyperhidrosis.
  • In another aspect of the invention, the anti-toxin fusion protein is used to treat botulism from food poisoning.
  • Diptheria Toxin Receptor
  • Diphtheria is caused by a bacterium, Corynebacterium diphtheriae, which typically infects mucous membranes: the nose and throat are favorite places for the infection to take hold, but mucous membranes of the eyes or genitalia can be infected also. The bacteria produce a toxin which causes damage to tissue both at the site of the original infection and in other parts of the body once the toxin is spread via the bloodstream. The most serious effects of diphtheria toxin are on the heart (muscle damage leading to loss of pumping ability), kidneys, and the nervous system.
  • Diphtheria can be treated by giving penicillin or other antibiotics to kill the bacteria, and antitoxin to clear free toxin in the body. However the antitoxin will not clear toxin that has already bound to cells and started to damage them. The better approach is to give toxoid to stimulate immunity to the toxin, thus enabling the body to clear toxin as soon as it appears. Immunity to a bacterial toxin such as diphtheria toxin (DT) may be acquired naturally during the course of an infection, or artificially by injection of a detoxified form of the toxin (i.e., a toxoid) (Germanier, ed., Bacterial Vaccines, Academic Press, Orlando, Fla., 1984). Toxoids have traditionally been prepared by chemical modification of native toxins (e.g., with formalin or formaldehyde (Lingood et al., Brit. J. Exp. Path. 44:177, 1963)), rendering them nontoxic while retaining an antigenicity that protects the vaccinated animal against subsequent challenges by the natural toxin: an example of a chemically-inactivated DT is that described by Michel and Dirkx (Biochem. Biophys. Acta 491:286-295, 1977), in which Trp-153 of Fragment A is the modified residue. The toxoid is given initially at ages 2, 4, and 6 months, again at ages 18 months and 5 years, and regularly every 10 years after that.
  • Several years it appeared that diptheria was no longer a major public health threat. However, recently, there has been a resurgence of diphtheria in the New Independent States of the former Soviet Union, Ecuador, Thailand, Algeria and other countries. Although diphtheria patients have been treated with equine antitoxin, which neutralizes unbound toxin, surviving patients have often developed serum sickness, an immune complex-type disease. Thus, there is a need to develop a better treatment for diphtheria patients.
  • The DT molecule is produced as a single polypeptide of 535 amino acids that is readily spliced to form two subunits linked by a disulfide bond, Fragment A (N-terminal of about 21 Kda) and Fragment B (C-terminal of about 37 Kda), as a result of cleavage at residue 190, 192, or 193 (Moskaug, et al., Biol Chem 264:15709-15713, 1989; Collier et al., Biol Chem, 246:1496-1503, 1971). Fragment A is the catalytically active portion of DT. It is an NAD-dependent ADP-ribosyltransferase which specifically targets a protein synthesis factor termed elongation factor 2 (EF-2), thereby inactivating EF2 and shutting down protein synthesis in the cell. Fragment A consists of the diphtheria toxin C domain. Fragment A is linked to the diphtheria toxin Fragment B by a polypeptide loop. Fragment B of DT possesses a receptor-binding domain (the R domain) which recognizes and binds the toxin molecule to a particular receptor structure found on the surfaces of many types of mammalian cells. Once DT is bound to the cell via this receptor structure, the receptor/DT complex is taken up by the cell via receptor-mediated endocytosis. A second functional region on Fragment B (the T domain) acts to translocate DT across the membrane of the endocytic vesicle, releasing catalytically active Fragment A into the cytosol of the cell. A single molecule of Fragment A is sufficient to inactivate the protein synthesis machinery in a given cell.
  • Naglich et al (Cell, 1992, 69: 1051-1061) describe expression cloning of diphtheria toxin receptor from highly toxin-sensitive monkey Vero cells. The amino acid sequence of the receptor was found to be identical to that of the cell surface-expressed heparin-binding epidermal growth factor-like growth factor (HB-EGF) precursor (proHB-EGF). Although proHB-EGF is cleaved and released as soluble mature HB-EGF (Goishi et al., Mol. Biol. Cell, 1995, 6:967-980), a significant amount of proHB-EGF remains on the cell surface and functions as a juxtacrine growth factor (Hagashiyama et al., Science, 251: 929-938) and as a DT receptor (Iwamoto et al., EMBO J., 1994, 13:2322-2330; Naglich et al., Cell, 1992, 69: 1051-1061).
  • Hooper et al. (Biochem. Biophys. Res. Commun., 1995, 206: 710-717) show that recombinant mature human HB-EGF consisting of residues 63-148 (the extracellular domain or the mature growth factor) strongly inhibits the binding of radiolabeled DT to toxin receptor-bearing cells. This result suggests that it would be possible to treat diphtheria patients with mature HB-EGF, a natural growth factor which will not cause serum sickness. However, mature HB-EGF might produce side effects due to its growth factor activity.
  • Cha et al. (Infection and Immunity, 2002, 70(5): 2344-2350) developed a treatment based on human DT receptor/HB-EGF precursor. They teach a recombinant truncated HB-EGF, consisting of residues 106-149 and lacking most of the heparin binding domain, capable of inhibiting binding of radioiodinated DT to cells. Moreover, they showed that it was a more effective inhibitor of DT binding than the recombinant mature HB-EGF. Further the investigators mutated some residues in the EGF like domain of the recombinant truncated HB-EGF to destroy some of its mitogenic effect. It was demonstrated that the receptor analog (I117A/L148A) displayed a low mitogenic effect. The truncated (I117A/L148A) HB-EGF protein retained high DT binding affinity. The work of Cha et al. suggest that truncated (I117A/L148A) HB-EGF protein could be a safe anti-toxin for EGF receptor.
  • The present invention provides anti-toxin fusion protein comprising truncated (I117A/L148A) HB-EGF protein fused to transferrin or modified transferrin. The present invention also provides transferrin/anti-toxin fusion proteins comprising fragments thereof of truncated (I117A/L148A) HB-EGF protein that bind DT and has minimal mitogenic activity. Additionally, the invention provides transferrin/anti-toxin fusion proteins comprising analogs of truncated HB-EGF protein that bind DT and has minimal mitogenic activity.
  • Other Toxin Receptors
  • Bacterium Bacillus thuringiensis (BT) produces bacteriocidal proteins that are toxic to a limited range of insects, mostly in the orders Lepidoptera, Coleoptera and Diptera. Bt toxins have been used to control pests, by applying Bacillus thuringiensis to plants or transforming plants themselves so that they generate the toxins by virtue of their transgenic character. The toxins themselves are glycoprotein products of the cry gene as described by Hofte, H. et al. Microbiol Rev (1989) 53:242. U.S. Pat. No. 5,693,491 discloses the cDNA encoding a glycoprotein receptor from the tobacco hornworm that binds a Bacillus thuringiensis toxin. The availability of this cDNA permits the retrieval of DNAs encoding homologous receptors in other insects and organisms as well as the design of assays for the cytotoxicity and binding affinity of potential pesticides and the development of methods to manipulate natural and/or introduced homologous receptors and, thus, to destroy target cells, tissues and/or organisms.
  • Most Vibrio cholerae vaccine candidates constructed by deleting the ctxA gene encoding cholera toxin (CT) are able to elicit high antibody responses, but more than one-half of the vaccines still develop mild diarrhea (Levine et al., Infect. Immun., 56(1):161-167 (1988)). Given the magnitude of the diarrhea induced in the absence of CT, it was hypothesized that V. cholerae produce other enterotoxigenic factors, which are still present in strains deleted of the ctxA sequence (Levine et al., supra). As a result, a second toxin, zonula occludens toxin (hereinafter “ZOT”) elaborated by V. cholerae, and which contribute to the residual diarrhea, was discovered (Fasano et al., Proc. Nat. Acad. Sci., USA, 8:5242-5246 (1991)). The zot gene is located immediately adjacent to the ctx genes. The high percent concurrence of the zot gene with the ctx genes among V. cholerae strains (Johnson et al., J. Clin. Microb., 31/3:732-733 (1993); and Karasawa et al, FEBS Microbiology Letters, 106:143-146 (1993)) suggests a possible synergistic role of ZOT in the causation of acute dehydrating diarrhea typical of cholera. The zot gene has also been identified in other enteric pathogens (Tschape, 2nd Asian-Pacific Symposium on Typhoid fever and other Salomellosis, 47(Abstr.) (1994)). U.S. Pat. No. 5,864,014 discloses the purified receptor for zonula occludens toxin.
  • Diarrhea can be caused by small, heat stable peptide toxins (ST) produced by various pathogenic bacteria (Thompson, M. R., 1987, Pathol. Immunopathol. Res. 6, 103-116). In developing countries, such toxins may be responsible for 50% to 80% of the reported cases of diarrhea (Giannella, R. A., 1981, Ann. Rev. Med. 32, 341-357). ST are also a major cause of diarrhea in laboratory and domestic animals (Burgess et al., 1978, Infect. Immun. 21, 526-531). It has been shown that heat stable enterotoxins bind to a cell surface receptor in the intestine which subsequently leads to an activation of guanylyl cyclase (Field et al., 1978, Proc. Natl. Acad. Sci. USA 75, 2800-2804; Guerrant et al., 1980, J. Infectios Diseases 142, 220-228). The rise in cyclic GMP then stimulates fluid secretion thereby causing diarrhea. It has been reported that the ST receptor is a distinctly different protein than quanylyl cyclase based on partial chromatographic separation of a detergent-solubilized ST-binding protein from guanylyl cyclase activity (Kuno et al., 1986, J. Biol. Chem. 261, 1470-1476; Waldman, et al., 1986, Infect. Immun. 51, 320-326). U.S. Pat. No. 5,237,051 discloses cloning of the nucleic acid encoding the intestinal receptor which recognizes heat stable enterotoxins and has guanylyl cylase activity. Data shows that the receptor binds enterotoxin and signals normally through the cyclic GMP second messenger system.
  • Sepsis is most commonly caused by infection or trauma induced by a toxin. The initial symptoms of sepsis typically include chills, profuse sweat, irregularly remittent fever, prostration and the like, followed by persistent fever, hypotension leading to shock, neutropenia, leukopenia, disseminated intravascular coagulation, adult respiratory distress syndrome and multiple organ failure. Sepsis-inducing toxins have been found associated with pathogenic bacteria, viruses, plants and venoms. Among the well described bacterial toxins are the endotoxins or lipopolysaccharides(LPS) of the gram-negative bacteria. These molecules are glycolipids that are ubiquitous in the outer membrane of all gram-negative bacteria. It has been reported that report that membrane-fixed CD14 acts as a receptor for the protein-bound endotoxin (LPS) complex and mediates the cellular effects of endotoxin (Wright et al., 1990, Science, 249: 1431). Soluble CD14 truncated at amino acid 71(N71) contains the lipolysaccharide binding sequence. N71 has been shown to neutralize circulating LPS, i.e., acting as an endotoxin antagonist (Higuchi et al., Pathobiology, 2002, 70: 103).
  • Methods of Delivering Antitoxin Fusion Protein
  • In one embodiment, the anti-toxin fusion proteins of the present invention will be packaged in a single piston syringe with two contiguous chambers. The first chamber will contain diluent and the second will contain the lyophilized anti-toxin fusion protein. As the plunger is pushed down the diluent will be driven into the next chamber to dissolve the anti-toxin fusion protein which will be expelled through a needle for direct intramuscular delivery. The diluent can contain an anti-freeze such glycerol to act in freezing conditions. The lyophilized product will remain stable in tropical conditions.
  • The present invention contemplates delivering the antitoxin fusion proteins of the present invention in this manner to soldiers entering into a combat situation where the risk of exposure to toxins is high. The anti-toxin fusion protein can be used for immediate treatment on the battlefield and as a prophylactic before going on the battlefield.
  • Nucleic Acids
  • The present invention also provides nucleic acid molecules encoding transferrin fusion proteins comprising a transferrin protein or a portion of a transferrin protein covalently linked or joined to a therapeutic protein, preferably a therapeutic protein. As discussed in more detail below, any therapeutic protein may be used. The fusion protein may further comprise a linker region, for instance a linker less than about 50, 40, 30, 20, or 10 amino acid residues. The linker can be covalently linked to and between the transferrin protein or portion thereof and the therapeutic protein, preferably the therapeutic protein. Nucleic acid molecules of the invention may be purified or not.
  • Host cells and vectors for replicating the nucleic acid molecules and for expressing the encoded fusion proteins are also provided. Any vectors or host cells may be used, whether prokaryotic or eukaryotic, but eukaryotic expression systems, in particular yeast expression systems, may be preferred. Many vectors and host cells are known in the art for such purposes. It is well within the skill of the art to select an appropriate set for the desired application.
  • DNA sequences encoding transferrin, portions of transferrin and therapeutic proteins of interest may be cloned from a variety of genomic or cDNA libraries known in the art. The techniques for isolating such DNA sequences using probe-based methods are conventional techniques and are well known to those skilled in the art. Probes for isolating such DNA sequences may be based on published DNA or protein sequences (see, for example, Baldwin, G. S. (1993) Comparison of Transferrin Sequences from Different Species. Comp. Biochem. Physiol. 106B/1 :203-218 and all references cited therein, which are hereby incorporated by reference in their entirety). Alternatively, the polymerase chain reaction (PCR) method disclosed by Mullis et al. (U.S. Pat. No. 4,683,195) and Mullis (U.S. Pat. No. 4,683,202), incorporated herein by reference may be used. The choice of library and selection of probes for the isolation of such DNA sequences is within the level of ordinary skill in the art.
  • As known in the art “similarity” between two polynucleotides or polypeptides is determined by comparing the nucleotide or amino acid sequence and its conserved nucleotide or amino acid substitutes of one polynucleotide or polypeptide to the sequence of a second polynucleotide or polypeptide. Also known in the art is “identity” which means the degree of sequence relatedness between two polypeptide or two polynucleotide sequences as determined by the identity of the match between two strings of such sequences. Both identity and similarity can be readily calculated (Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D. W., ed., Academic Press, New York, 1993; Computer Analysis of Sequence Data, Part I, Griffin, A. M., and Griffin, H. G., eds., Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; and Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M Stockton Press, New York, 1991).
  • While there exist a number of methods to measure identity and similarity between two polynucleotide or polypeptide sequences, the terms “identity” and “similarity” are well known to skilled artisans (Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M Stockton Press, New York, 1991; and Carillo, H., and Lipman, D., SIAM J. Applied Math., 48: 1073 (1988). Methods commonly employed to determine identity or similarity between two sequences include, but are not limited to those disclosed in Guide to Huge Computers, Martin J. Bishop, ed., Academic Press, San Diego, 1994, and Carillo, H., and Lipman, D., SIAM J. Applied Math. 48:1073 (1988).
  • Preferred methods to determine identity are designed to give the largest match between the two sequences tested. Methods to determine identity and similarity are codified in computer programs. Preferred computer program methods to determine identity and similarity between two sequences include, but are not limited to, GCG program package (Devereux, et al., Nucleic Acids Research 12(1):387 (1984)), BLASTP, BLASTN, FASTA (Atschul, et al., J. Molec. Biol. 215:403 (1990)). The degree of similarity or identity referred to above is determined as the degree of identity between the two sequences indicating a derivation of the first sequence from the second. The degree of identity between two nucleic acid sequences may be determined by means of computer programs known in the art such as GAP provided in the GCG program package (Needleman and Wunsch (1970) Journal of Molecular Biology 48:443-453). For purposes of determining the degree of identity between two nucleic acid sequences for the present invention, GAP is used with the following settings: GAP creation penalty of 5.0 and GAP extension penalty of 0.3.
  • Codon Optimization
  • The degeneracy of the genetic code permits variations of the nucleotide sequence of a transferrin protein and/or therapeutic protein of interest, while still producing a polypeptide having the identical amino acid sequence as the polypeptide encoded by the native DNA sequence. The procedure, known as “codon optimization” (described in U.S. Pat. No. 5,547,871 which is incorporated herein by reference in its entirety) provides one with a means of designing such an altered DNA sequence. The design of codon optimized genes should take into account a variety of factors, including the frequency of codon usage in an organism, nearest neighbor frequencies, RNA stability, the potential for secondary structure formation, the route of synthesis and the intended future DNA manipulations of that gene. In particular, available methods may be used to alter the codons encoding a given fusion protein with those most readily recognized by yeast when yeast expression systems are used.
  • The degeneracy of the genetic code permits the same amino acid sequence to be encoded and translated in many different ways. For example, leucine, serine and arginine are each encoded by six different codons, while valine, proline, threonine, alanine and glycine are each encoded by four different codons. However, the frequency of use of such synonymous codons varies from genome to genome among eukaryotes and prokaryotes. For example, synonymous codon-choice patterns among mammals are very similar, while evolutionarily distant organisms such as yeast (S. cerevisiae), bacteria (such as E. coli) and insects (such as D. melanogaster) reveal a clearly different pattern of genomic codon use frequencies (Grantham, R., et al., Nucl. Acids Res., 8, 49-62 (1980); Grantham, R., et al., Nucl. Acids Res., 9, 43-74 (1981); Maroyama, T., et al., Nucl. Acids Res., 14, 151-197 (1986); Aota, S., et al., Nucl. Acids Res., 16, 315-402 (1988); Wada, K., et al., Nucl. Acids Res., 19 Supp., 1981-1985 (1991); Kurland, C. G., FEBS Letters, 285, 165-169 (1991)). These differences in codon-choice patterns appear to contribute to the overall expression levels of individual genes by modulating peptide elongation rates. (Kurland, C. G., FEBS Letters, 285, 165-169 (1991); Pedersen, S., EMBO J., 3, 2895-2898 (1984); Sorensen, M. A., J. Mol. Biol., 207, 365-377 (1989); Randall, L. L., et al., Eur. J. Biochem., 107, 375-379 (1980); Curran, J. F., and Yarus, M., J. Mol. Biol., 209, 65-77 (1989); Varenne, S., et al., J. Mol, Biol., 180, 549-576 (1984), Varenne, S., et al., J. Mol, Biol., 180, 549-576 (1984); Garel, J.-P., J. Theor. Biol., 43, 211-225 (1974); Ikemura, T., J. Mol. Biol., 146, 1-21 (1981); Ikemura, T., J. Mol. Biol., 151, 389-409 (1981)).
  • The preferred codon usage frequencies for a synthetic gene should reflect the codon usages of nuclear genes derived from the exact (or as closely related as possible) genome of the cell/organism that is intended to be used for recombinant protein expression, particularly that of yeast species. As discussed above, in one preferred embodiment the human Tf sequence is codon optimized, before or after modification as herein described for yeast expression as may be the nucleotide sequence of the therapeutic protein.
  • Vectors
  • Expression units for use in the present invention will generally comprise the following elements, operably linked in a 5′ to 3′ orientation: a transcriptional promoter, a secretory signal sequence, a DNA sequence encoding a modified Tf fusion protein comprising transferrin protein or a portion of a transferrin protein joined to a DNA sequence encoding a therapeutic protein or peptide of interest, preferably a therapeutic protein, and a transcriptional terminator. As discussed above, any arrangement of the therapeutic protein or peptide fused to or within the Tf portion may be used in the vectors of the invention. The selection of suitable promoters, signal sequences and terminators will be determined by the selected host cell and will be evident to one skilled in the art and are discussed more specifically below.
  • Suitable yeast vectors for use in the present invention are described in U.S. Pat. No. 6,291,212 and include YRp7 (Struhl et al., Proc. Natl. Acad. Sci. USA 76: 1035-1039, 1978), YEp13 (Broach et al., Gene 8: 121-133, 1979), pJDB249 and pJDB219 (Beggs, Nature 275:104-108, 1978), pPPC0005, pSeCHSA, pScNHSA, pC4 and derivatives thereof. Useful yeast plasmid vectors also include pRS403-406, pRS413-416 and the Pichia vectors available from Stratagene Cloning Systems, La Jolla, Calif. 92037, USA. Plasmids pRS403, pRS404, pRS405 and pRS406 are Yeast Integrating plasmids (YIps) and incorporate the yeast selectable markers HIS3, 7RPI, LEU2 and URA3. Plasmids pRS413˜41.6 are Yeast Centromere plasmids (Ycps).
  • Such vectors will generally include a selectable marker, which may be one of any number of genes that exhibit a dominant phenotype for which a phenotypic assay exists to enable transformants to be selected. Preferred selectable markers are those that complement host cell auxotrophy, provide antibiotic resistance or enable a cell to utilize specific carbon sources, and include LEU2 (Broach et al. ibid.), URA3 (Botstein et al., Gene 8: 17, 1979), HIS3(Struhl et al., ibid.) or POT1 (Kawasaki and Bell, EP 171,142). Other suitable selectable markers include the CAT gene, which confers chloramphenicol resistance on yeast cells. Preferred promoters for use in yeast include promoters from yeast glycolytic genes (Hitzeman et al., J. Biol. Chem. 225: 12073-12080, 1980; Alber and Kawasaki, J. Mol. Appl. Genet. 1: 419-434, 1982; Kawasaki, U.S. Pat. No. 4,599,311) or alcohol dehydrogenase genes (Young et al., in Genetic Engineering of Microorganisms for Chemicals, Hollaender et al., (eds.), p. 355, Plenum, N.Y., 1982; Ammerer, Meth. Enzymol. 101: 192-201, 1983). In this regard, particularly preferred promoters are the TPI1 promoter (Kawasaki, U.S. Pat. No. 4,599,311) and the ADH2-4C (see U.S. Pat. No. 6,291,212) promoter (Russell et al., Nature 304: 652-654, 1983). The expression units may also include a transcriptional terminator. A preferred transcriptional terminator is the TPI1 terminator (Alber and Kawasaki, ibid.).
  • In addition to yeast, modified fusion proteins of the present invention can be expressed in filamentous fungi, for example, strains of the fungi Aspergillus. Examples of useful promoters include those derived from Aspergillus nidulans glycolytic genes, such as the ADH3 promoter (McKnight et al., EMBO J. 4: 2093-2099, 1985) and the tpiA promoter. An example of a suitable terminator is the ADH3 terminator (McKnight et al., ibid.). The expression units utilizing such components may be cloned into vectors that are capable of insertion into the chromosomal DNA of Aspergillus, for example.
  • Mammalian expression vectors for use in carrying out the present invention will include a promoter capable of directing the transcription of the modified Tf fusion protein, preferably a transferrin fusion protein comprising a modified Tf. Preferred promoters include viral promoters and cellular promoters. Preferred viral promoters include the major late promoter from adenovirus 2 (Kaufman and Sharp, Mol. Cell. Biol. 2: 1304-13199, 1982) and the SV40 promoter (Subramani et al., Mol. Cell. Biol. 1: 854-864, 1981). Preferred cellular promoters include the mouse metallothionein-1 promoter (Palmiter et al., Science 222: 809-814, 1983) and a mouse V6 (see U.S. Pat. No. 6,291,212) promoter (Grant et al., Nuc. Acids Res. 15: 5496, 1987). A particularly preferred promoter is a mouse VH (see U.S. Pat. No. 6,291,212) promoter. Such expression vectors may also contain a set of RNA splice sites located downstream from the promoter and upstream from the DNA sequence encoding the transferrin fusion protein. Preferred RNA splice sites may be obtained from adenovirus and/or immunoglobulin genes.
  • Also contained in the expression vectors is a polyadenylation signal located downstream of the coding sequence of interest. Polyadenylation signals include the early or late polyadenylation signals from SV40 (Kaufman and Sharp, ibid.), the polyadenylation signal from the adenovirus 5 E1B region and the human growth hormone gene terminator (DeNoto et al., Nuc. Acids Res. 9: 3719-3730, 1981). A particularly preferred polyadenylation signal is the VH (see U.S. Pat. No. 6,291,212) gene terminator. The expression vectors may include a noncoding viral leader sequence, such as the adenovirus 2 tripartite leader, located between the promoter and the RNA splice sites. Preferred vectors may also include enhancer sequences, such as the SV40 enhancer and the mouse: (see U.S. Pat. No. 6,291,212) enhancer (Gillies, Cell 33: 717-728, 1983). Expression vectors may also include sequences encoding the adenovirus VA RNAs.
  • Transformation
  • Techniques for transforming fungi are well known in the literature, and have been described, for instance, by Beggs (ibid.), Hinnen et al. (Proc. Natl. Acad. Sci. USA 75: 1929-1933, 1978), Yelton et al., (Proc. Natl. Acad. Sci. USA 81: 1740-1747, 1984), and Russell (Nature 301: 167-169, 1983). The genotype of the host cell will generally contain a genetic defect that is complemented by the selectable marker present on the expression vector. Choice of a particular host and selectable marker is well within the level of ordinary skill in the art.
  • Cloned DNA sequences comprising modified Tf fusion proteins of the invention may be introduced into cultured mammalian cells by, for example, calcium phosphate-mediated transfection (Wigler et al., Cell 14: 725, 1978; Corsaro and Pearson, Somatic Cell Genetics 7: 603, 1981; Graham and Van der Eb, Virology 52: 456, 1973.) Other techniques for introducing cloned DNA sequences into mammalian cells, such as electroporation (Neumann et al., EMBO J. 1: 841-845, 1982), or lipofection may also be used. In order to identify cells that have integrated the cloned DNA, a selectable marker is generally introduced into the cells along with the gene or cDNA of interest. Preferred selectable markers for use in cultured mammalian cells include genes that confer resistance to drugs, such as neomycin, hygromycin, and methotrexate. The selectable marker may be an amplifiable selectable marker. A preferred amplifiable selectable marker is the DHFR gene. A particularly preferred amplifiable marker is the DHFRr (see U.S. Pat. No. 6,291,212) cDNA (Simonsen and Levinson, Proc. Natl. Acad. Sci. USA 80: 2495-2499, 1983). Selectable markers are reviewed by Thilly (Mammalian Cell Technology, Butterworth Publishers, Stoneham, Mass.) and the choice of selectable markers is well within the level of ordinary skill in the art.
  • Host Cells
  • The present invention also includes a cell, preferably a yeast cell transformed to express a modified transferrin fusion protein of the invention. In addition to the transformed host cells themselves, the present invention also includes a culture of those cells, preferably a monoclonal (clonally homogeneous) culture, or a culture derived from a monoclonal culture, in a nutrient medium. If the polypeptide is secreted, the medium will contain the polypeptide, with the cells, or without the cells if they have been filtered or centrifuged away.
  • Host cells for use in practicing the present invention include eukaryotic cells, and in some cases prokaryotic cells, capable of being transformed or transfected with exogenous DNA and grown in culture, such as cultured mammalian, insect, fungal, plant and bacterial cells.
  • Fungal cells, including species of yeast (e.g., Saccharomyces spp., Schizosaccharomyces spp., Pichia spp.) may be used as host cells within the present invention. Exemplary genera of yeast contemplated to be useful in the practice, of the present invention as hosts for expressing the transferrin fusion protein, preferably the transferrin fusion protein, of the inventions are Pichia (formerly classified as Hansenula), Saccharomyces, Kluyveromyces, Aspergillus, Candida, Torulopsis, Torulaspora, Schizosaccharomyces, Citeromyces, Pachysolen, Zygosaecharomyces, Debaromyces, Trichoderma, Cephalosporium, Humicola, Mucor, Neurospora, Yarrowia, Metschunikowia, Rhodosporidium, Leucosporidium, Botryoascus, Sporidiobolus, Endomycopyis, and the like. Examples of Saccharomyces spp. are S. cerevisiae, S. italicus and S. rouxii. Examples of KIuyveromyces spp. are K ftagilis, K. lactis and K. marxianus. A suitable Tórulasppra species is T. delbrueckii. Examples of Pichia (Hansenula) spp. are P. angusta (formerly H. polymorpha), P. anomala (formerly H. anomala) and P. pastoris.
  • Particularly useful host cells to produce the Tf fusion proteins of the invention are the methanoltrophic Pichia pastoris (Steinlein et al. (1995) Protein Express. Purif 6:619-624). Pichia pastoris has been developed to be an outstanding host for the production of foreign proteins since its alcohol oxidase promoter was isolated and cloned; its transformation was first reported in 1985. P. pastoris can utilize methanol as a carbon source in the absence of glucose. The P. pastoris expression system can use the methanol-induced alcohol oxidase (AOX1) promoter, which controls the gene that codes for the expression of alcohol oxidase, the enzyme which catalyzes the first step in the metabolism of methanol. This promoter has been characterized and incorporated into a series of P. pastoris expression vectors. Since the proteins produced in P. pastoris are typically folded correctly and secreted into the medium, the fermentation of genetically engineered P. pastoris provides an excellent alternative to E. coli expression systems. A number of proteins have been produced using this system, including tetanus toxin fragment, Bordatella pertussis pertactin, human serum albumin and lysozyme.
  • The transformation of F. oxysporum may, for instance, be carried out as described by Malardier et al. (1989) Gene 78:147-156.
  • Strains of the yeast Saccharomyces cerevisiae are another preferred host. In a preferred embodiment, a yeast cell, or more specifically, a Saccharomyces cerevisiae host cell that contains a genetic deficiency in a gene required for asparagine-linked glycosylation of glycoproteins is used. S. cerevisiae host cells having such defects may be prepared using standard techniques of mutation and selection, although many available yeast strains have been modified to prevent or reduce glycosylation or hypermannosylation. Ballou et al. (J. Biol. Chem. 255: 5986-5991, 1980) have described the isolation of mannoprotein biosynthesis mutants that are defective in genes which affect asparagine-linked glycosylation.
  • To optimize production of the heterologous proteins, it is also preferred that the host strain carries a mutation, such as the S. cerevisiae pep4 mutation (Jones, Genetics 85: 23-33, 1977), which results in reduced proteolytic activity. Host strains containing mutations in other protease encoding regions are particularly useful to produce large quantities of the Tf fusion proteins of the invention.
  • Host cells containing DNA constructs of the present invention are grown in an appropriate growth medium. As used herein, the term “appropriate growth medium” means a medium containing nutrients required for the growth of cells. Nutrients required for cell growth may include a carbon source, a nitrogen source, essential amino acids, vitamins, minerals and growth factors. The growth medium will generally select for cells containing the DNA construct by, for example, drug selection or deficiency in an essential nutrient which are complemented by the selectable marker on the DNA construct or co-transfected with the DNA construct. Yeast cells, for example, are preferably grown in a chemically defined medium, comprising a non-amino acid nitrogen source, inorganic salts, vitamins and essential amino acid supplements. The pH of the medium is preferably maintained at a pH greater than 2 and less than 8, preferably at pH 6.5. Methods for maintaining a stable pH include buffering and constant pH control, preferably through the addition of sodium hydroxide. Preferred buffering agents include succinic acid and Bis-Tris (Sigma Chemical Co., St. Louis, Mo.). Yeast cells having a defect in a gene required for asparagine-linked glycosylation are preferably grown in a medium containing an osmotic stabilizer. A preferred osmotic stabilizer is sorbitol supplemented into the medium at a concentration between 0.1 M and 1.5 M., preferably at 0.5 M or 1.0 M.
  • Cultured mammalian cells are generally grown in commercially available serum-containing or serum-free media. Selection of a medium appropriate for the particular cell line used is within the level of ordinary skill in the art. Transfected mammalian cells are allowed to grow for a period of time, typically 1-2 days, to begin expressing the DNA sequence(s) of interest. Drug selection is then applied to select for growth of cells that are expressing the selectable marker in a stable fashion. For cells that have been transfected with an amplifiable selectable marker the drug concentration may be increased in a stepwise manner to select for increased copy number of the cloned sequences, thereby increasing expression levels.
  • Baculovirus/insect cell expression systems may also be used to produce the modified Tf fusion proteins of the invention. The BacPAK™ Baculovirus Expression System (BD Biosciences (Clontech) expresses recombinant proteins at high levels in insect host cells. The target gene is inserted into a transfer vector, which is cotransfected into insect host cells with the linearized BacPAK6 viral DNA. The BacPAK6 DNA is missing an essential portion of the baculovirus genome. When the DNA recombines with the vector, the essential element is restored and the target gene is transferred to the baculovirus genome. Following recombination, a few viral plaques are picked and purified, and the recombinant phenotype is verified. The newly isolated recombinant virus can then be amplified and used to infect insect cell cultures to produce large amounts of the desired protein.
  • Secretory Signal Sequences
  • The terms “secretory signal sequence” or “signal sequence” or “secretion leader sequence” are used interchangeably and are described, for example in U.S. Pat. No. 6,291,212 and U.S. Pat. No. 5,547,871, both of which are herein incorporated by reference in their entirety. Secretory signal sequences or signal sequences or secretion leader sequences encode secretory peptides. A secretory peptide is an amino acid sequence that acts to direct the secretion of a mature polypeptide or protein from a cell. Secretory peptides are generally characterized by a core of hydrophobic amino acids and are typically (but not exclusively) found at the amino termini of newly synthesized proteins. Very often the secretory peptide is cleaved from the mature protein during secretion. Secretory peptides may contain processing sites that allow cleavage of the signal peptide from the mature protein as it passes through the secretory pathway. Processing sites may be encoded within the signal peptide or may be added to the signal peptide by, for example, in vitro mutagenesis.
  • Secretory peptides may be used to direct the secretion of modified Tf fusion proteins of the invention. One such secretory peptide that may be used in combination with other secretory peptides is the third domain of the yeast Barrier protein. Secretory signal sequences or signal sequences or secretion leader sequences are required for a complex series of post-translational processing steps which result in secretion of a protein. If an intact signal sequence is present, the protein being expressed enters the lumen of the rough endoplasmic reticulum and is then transported through the Golgi apparatus to secretory vesicles and is finally transported out of the cell. Generally, the signal sequence immediately follows the initiation codon and encodes a signal peptide at the amino-terminal end of the protein to be secreted. In most cases, the signal sequence is cleaved off by a specific protease, called a signal peptidase. Preferred signal sequences improve the processing and export efficiency of recombinant protein expression using viral, mammalian or yeast expression vectors. In some cases, the native Tf signal sequence may be used to express and secrete fusion proteins of the invention. Linkers
  • The Tf moiety and the therapeutic protein of the modified transferrin fusion proteins of the invention can be fused directly or using a linker peptide of various lengths to provide greater physical separation and allow more spatial mobility between the fused proteins and thus maximize the accessibility of the therapeutic protein, for instance, for binding to its cognate receptor. The linker peptide may consist of amino acids that are flexible or more rigid. For example, a linker such as but not limited to a poly-glycine stretch. The linker can be less than about 50, 40, 30, 20, or 10 amino acid residues. The linker can be covalently linked to and between the transferrin protein or portion thereof and the therapeutic protein.
  • Detection of Tf Fusion Proteins
  • Assays for detection of biologically active modified transferrin-fusion protein may include Western transfer, protein blot or colony filter as well as activity based assays that detect the fusion protein comprising transferrin and therapeutic protein. A Western transfer filter may be prepared using the method described by Towbin et al. (Proc. Natl. Acad. Sci. USA 76: 4350-4354, 1979). Briefly, samples are electrophoresed in a sodium dodecylsulfate polyacrylamide gel. The proteins in the gel are electrophoretically transferred to nitrocellulose paper. Protein blot filters may be prepared by filtering supernatant samples or concentrates through nitrocellulose filters using, for example, a Minifold (Schleicher & Schuell, Keene, N. H.). Colony filters may be prepared by growing colonies on a nitrocellulose filter that has been laid across an appropriate growth medium. In this method, a solid medium is preferred. The cells are allowed to grow on the filters for at least 12 hours. The cells are removed from the filters by washing with an appropriate buffer that does not remove the proteins bound to the filters. A preferred buffer comprises 25 mM Tris-base, 19 mM glycine, pH 8.3, 20% methanol.
  • Transferrin fusion proteins of the present invention may be labeled with a radioisotope or other imaging agent and used for in vivo diagnostic purposes. Preferred radioisotope imaging agents include iodine-125 and technetium-99, with technetium-99 being particularly preferred. Methods for producing protein-isotope conjugates are well known in the art, and are described by, for example, Eckelman et al. (U.S. Pat. No. 4,652,440), Parker et al. (WO 87/05030) and Wilber et al. (EP 203,764). Alternatively, the transferrin fusion proteins may be bound to spin label enhancers and used for magnetic resonance (MR) imaging. Suitable spin label enhancers include stable, sterically hindered, free radical compounds such as nitroxides. Methods for labeling ligands for MR imaging are disclosed by, for example, Coffman et al. (U.S. Pat. No. 4,656,026).
  • Detection of a transferrin fusion protein of the present invention can be facilitated by coupling (i.e., physically linking) the therapeutic protein to a detectable substance. Examples of detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, and radioactive materials. Examples of suitable enzymes include horseradish peroxidase, alkaline phosphatase, β-galactosidase, or acetylcholinesterase; examples of suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin; examples of suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material includes luminol; examples of bioluminescent materials include luciferase, luciferin, and aequorin, and examples of suitable radioactive material include 125I, 131I, 35S or 3H.
  • In one embodiment where one is assaying for the ability of a transferrin fusion protein of the invention to bind or compete with an antigen for binding to an antibody, various immunoassays known in the art can be used, including but not limited to, competitive and non-competitive assay systems using techniques such as radioimmunoassays, ELISA (enzyme linked immunosorbent assay), sandwich immunoassays, immunoradiometric assays, gel diffusion precipitation reactions, immunodiffusion assays, in situ immunoassays (using colloidal gold, enzyme or radioisotope labels, for example), western blots, precipitation reactions, agglutination assays (e.g., gel agglutination assays), complement fixation assays, immunofluorescence assays, protein A assays, and immunoelectrophoresis assays, etc. In one embodiment, the binding of the transferrin fusion protein is detected by detecting a label on the transferrin fusion protein. In another embodiment, the transferrin fusion protein is detected by detecting binding of a secondary antibody or reagent that interacts with the transferrin fusion protein. In a further embodiment, the secondary antibody or reagent is labeled. Many means are known in the art for detecting binding in an immunoassay and are within the scope of the present invention.
  • Fusion proteins of the invention may also be detected by assaying for the activity of the therapeutic protein moiety. Specifically, transferrin fusion proteins of the invention may be assayed for functional activity (e.g., biological activity or therapeutic activity) using assays known to one of ordinary skill in the art. Additionally, one of skill in the art may routinely assay fragments of a therapeutic protein corresponding to a therapeutic protein portion of a fusion protein of the invention, for activity using well-known assays. Further, one of skill in the art may routinely assay fragments of a modified transferrin protein for activity using assays known in the art.
  • For example, in one embodiment where one is assaying for the ability of a transferrin fusion protein of the invention to bind or compete with a therapeutic protein for binding to an anti-therapeutic polypeptide antibody and/or anti-transferrin antibody, various immunoassays known in the art can be used, including but not limited to, competitive and non-competitive assay systems using techniques such as radioimmunoassays, ELISA (enzyme linked immunosorbent assay), sandwich immunoassays, immunoradiometric assays, gel diffusion precipitation reactions, immunodiffusion assays, in situ immunoassays (using colloidal gold, enzyme or radioisotope labels, for example), western blots, precipitation reactions, agglutination assays (e.g., gel agglutination assays), complement fixation assays, immunofluorescence assays, protein A assays, and immunoelectrophoresis assays, etc. In one embodiment, antibody binding is detected by detecting a label on the primary antibody. In another embodiment, the primary antibody is detected by detecting binding of a secondary antibody or reagent to the primary antibody. In a further embodiment, the secondary antibody is labeled. Many means are known in the art for detecting binding in an immunoassay and are within the scope of the present invention.
  • In a further embodiment, where a binding partner (e.g., a receptor or a ligand) of a therapeutic protein is identified, binding to that binding partner by a transferrin fusion protein containing that therapeutic protein as the therapeutic protein portion of the fusion can be assayed, e.g., by means well-known in the art, such as, for example, reducing and non-reducing gel chromatography, protein affinity chromatography, and affinity blotting. Other methods will be known to the skilled artisan and are within the scope of the invention.
  • Production of Fusion Proteins
  • The present invention further provides methods for producing a modified fusion protein of the invention using nucleic acid molecules herein described. In general terms, the production of a recombinant form of a protein typically involves the following steps.
  • A nucleic acid molecule is first obtained that encodes a transferrin fusion protein of the invention. The nucleic acid molecule is then preferably placed in operable linkage with suitable control sequences, as described above, to form an expression unit containing the protein open reading frame. The expression unit is used to transform a suitable host and the transformed host is cultured under conditions that allow the production of the recombinant protein. Optionally the recombinant protein is isolated from the medium or from the cells; recovery and purification of the protein may not be necessary in some instances where some impurities may be tolerated.
  • Each of the foregoing steps can be accomplished in a variety of ways. For example, the construction of expression vectors that are operable in a variety of hosts is accomplished using appropriate replicons and control sequences, as set forth above. The control sequences, expression vectors, and transformation methods are dependent on the type of host cell used to express the gene and were discussed in detail earlier and are otherwise known to persons skilled in the art. Suitable restriction sites can, if not normally available, be added to the ends of the coding sequence so as to provide an excisable gene to insert into these vectors. A skilled artisan can readily adapt any host/expression system known in the art for use with the nucleic acid molecules of the invention to produce a desired recombinant protein.
  • As discussed above, any expression system may be used, including yeast, bacterial, animal, plant, eukaryotic and prokaryotic systems. In some embodiments, yeast, mammalian cell culture and transgenic animal or plant production systems are preferred. In other embodiments, yeast systems that have been modified to reduce native yeast glycosylation, hyper-glycosylation or proteolytic activity may be used.
  • Isolation/Purification of Modified Transferrin Fusion Proteins
  • Secreted, biologically active, modified transferrin fusion proteins may be isolated from the medium of host cells grown under conditions that allow the secretion of the biologically active fusion proteins. The cell material is removed from the culture medium, and the biologically active fusion proteins are isolated using isolation techniques known in the art. Suitable isolation techniques include precipitation and fractionation by a variety of chromatographic methods, including gel filtration, ion exchange chromatography and affinity chromatography.
  • A particularly preferred purification method is affinity chromatography on an iron binding or metal chelating column or an immunoaffinity chromatography using an antigen directed against the transferrin or therapeutic protein of the polypeptide fusion. The antigen is preferably immobilized or attached to a solid support or substrate. A particularly preferred substrate is CNBr-activated Sepharose (Pharmacia LKB Technologies, Inc., Piscataway, N.J.). By this method, the medium is combined with the antigen/substrate under conditions that will allow binding to occur. The complex may be washed to remove unbound material, and the transferrin fusion protein is released or eluted through the use of conditions unfavorable to complex formation. Particularly useful methods of elution include changes in pH, wherein the immobilized antigen has a high affinity for the transferrin fusion protein at a first pH and a reduced affinity at a second (higher or lower) pH; changes in concentration of certain chaotropic agents; or through the use of detergents.
  • Delivery of a Drug or Therapeutic Protein to the Inside of a Cell and/or Across the Blood Brain Barrier (BBB)
  • Within the scope of the invention, the modified transferrin fusion proteins may be used as a carrier to deliver a molecule or small molecule therapeutic complexed to the ferric ion of transferrin to the inside of a cell or across the blood brain barrier. In these embodiments, the transferrin will typically be engineered or modified to inhibit, prevent or remove glycosylation to extend the serum half-life of the transferrin fusion protein and/or therapeutic protein. The addition of a targeting peptide is specifically contemplated to further target the transferrin fusion protein to a particular cell type, e.g., a cancer cell.
  • In one embodiment, the iron-containing, anti-anemic drug, ferric-sorbitol-citrate complex is loaded onto a modified Tf fusion protein of the invention. Ferric-sorbitol-citrate (FSC) has been shown to inhibit proliferation of various murine cancer cells in vitro and cause tumor regression in vivo, while not having any effect on proliferation of non-malignant cells (Poljak-Blazi et al. (June 2000) Cancer Biotherapy and Radiopharmaceuticals (United States), 15/3:285-293).
  • In another embodiment, the antineoplastic drug adriamycin (Doxorubicin) and/or the chemotherapeutic drug bleomycin, both of which are known to form complexes with ferric ion, is loaded onto a transferrin fusion protein of the invention. In other embodiments, a salt of a drug, for instance, a citrate or carbonate salt, may be prepared and complexed with the ferric iron that is then bound to Tf. As tumor cells often display a higher turnover rate for iron; transferrin modified to carry at least one anti-tumor agent, may provide a means of increasing agent exposure or load to the tumor cells. (Demant, E. J., (1983) Eur. J. of Biochem. 137/(1-2):113-118; Padbury et al. (1985) J. Biol. Chem. 260/13:7820-7823).
  • Pharmaceutical Formulations and Treatment Methods
  • The modified fusion proteins comprising a modified transferrin of the invention may be administered to a patient in need thereof using standard administration protocols. For instance, the modified Tf fusion proteins of the present invention can be provided alone, or in combination, or in sequential combination with other agents that modulate a particular pathological process. As used herein, two agents are said to be administered in combination when the two agents are administered simultaneously or are administered independently in a fashion such that the agents will act at the same or near the same time.
  • The fusion proteins of the present invention can be administered via parenteral, subcutaneous, intravenous, intramuscular, intraperitoneal, transdermal and buccal routes. For example, an agent may be administered locally to a site of injury via microinfusion. Alternatively, or concurrently, administration may be noninvasive by either the oral, inhalation, nasal, or pulmonary route. The dosage administered will be dependent upon the age, health, and weight of the recipient, kind of concurrent treatment, if any, frequency of treatment, and the nature of the effect desired.
  • The present invention further provides compositions containing one or more fusion proteins of the invention. While individual needs vary, determination of optimal ranges of effective amounts of each component is within the skill of the art. Typical dosages comprise about 1 pg/kg to about 100 mg/kg body weight. The preferred dosages for systemic administration comprise about 100 ng/kg to about 100 mg/kg body weight or about 100-200 mg of protein/dose. The preferred dosages for direct administration to a site via microinfusion comprise about 1 ng/kg to about 1 mg/kg body weight. When administered via direct injection or microinfusion, modified fusion proteins of the invention may be engineered to exhibit reduced or no binding of iron to prevent, in part, localized iron toxicity.
  • In addition to the pharmacologically active fusion protein, the compositions of the present invention may contain suitable pharmaceutically acceptable carriers comprising excipients and auxiliaries that facilitate processing of the active compounds into preparations which can be used pharmaceutically for delivery to the site of action. Suitable formulations for parenteral administration include aqueous solutions of the active compounds in water-soluble form, for example, water-soluble salts. In addition, suspensions of the active compounds as appropriate oily injection suspensions may be administered. Suitable lipophilic solvents or vehicles include fatty oils, for example, sesame oil, or synthetic fatty acid esters, for example, ethyl oleate or triglycerides. Aqueous injection suspensions may contain substances which increase the viscosity of the suspension include, for example, sodium carboxymethyl cellulose, sorbitol and dextran. Optionally, the suspension may also contain stabilizers. Liposomes can also be used to encapsulate the agent for delivery into the cell.
  • The pharmaceutical formulation for systemic administration according to the invention may be formulated for enteral, parenteral or topical administration. Indeed, all three types of formulations may be used simultaneously to achieve systemic administration of the active ingredient. Suitable formulations for oral administration include hard or soft gelatin capsules, pills, tablets, including coated tablets, elixirs, suspensions, syrups or inhalations and controlled release forms thereof.
  • The pharmaceutical composition of the present invention can be in unit dosage form, e.g. as tablets or capsules. In such form, the composition is sub-divided in unit dose containing appropriate quantities of the active ingredient; the unit dosage forms can be packaged compositions, for example, packeted powders, vials, ampoules, prefilled syringes or sachets containing liquids. The unit dosage form can be, for example, a capsule or tablet itself, or it can be the appropriate number of any such compositions in package form. The dosage to be used in the treatment must be subjectively determined by the physician.
  • In practicing the methods of this invention, the fusion proteins of this invention may be used alone or in combination, or in combination with other therapeutic or diagnostic agents. In certain preferred embodiments, the compounds of this invention may be co-administered along with other compounds typically prescribed for these conditions according to generally accepted medical practice. The compounds of this invention can be utilized in vivo, ordinarily in mammals, such as humans, sheep, horses, cattle, pigs, dogs, cats, rats and mice, or in vitro.
  • Transgenic Animals
  • The production of transgenic non-human animals that contain a modified transferrin fusion construct with increased serum half-life increased serum stability or increased bioavailability of the instant invention is contemplated in one embodiment of the present invention. In some embodiments, lactoferrin may be used as the Tf portion of the fusion protein so that the fusion protein is produced and secreted in milk.
  • The successful production of transgenic, non-human animals has been described in a number of patents and publications, such as, for example U.S. Pat. No. 6,291,740 (issued Sep. 18, 2001); U.S. Pat. No. 6,281,408 (issued Aug. 28, 2001); and U.S. Pat. No. 6,271,436 (issued Aug. 7, 2001) the contents of which are hereby incorporated by reference in their entireties.
  • The ability to alter the genetic make-up of animals, such as domesticated mammals including cows, pigs, goats, horses, cattle, and sheep, allows a number of commercial applications. These applications include the production of animals which express large quantities of exogenous proteins in an easily harvested form (e.g., expression into the milk or blood), the production of animals with increased weight gain, feed efficiency, carcass composition, milk production or content, disease resistance and resistance to infection by specific microorganisms and the production of animals having enhanced growth rates or reproductive performance. Animals which contain exogenous DNA sequences in their genome are referred to as transgenic animals.
  • The most widely used method for the production of transgenic animals is the microinjection of DNA into the pronuclei of fertilized embryos (Wall et al., J. Cell. Biochem. 49:113 [1992]). Other methods for the production of transgenic animals include the infection of embryos with retroviruses or with retroviral vectors. Infection of both pre- and post-implantation mouse embryos with either wild-type or recombinant retroviruses has been reported (Janenich, Proc. Natl. Acad. Sci. USA 73:1260 [1976]; Janenich et al., Cell 24:519 [1981]; Stuhlmann et al., Proc. Natl. Acad. Sci. USA 81:7151 [1984]; Jahner et al., Proc. Natl. Acad. Sci. USA 82:6927 [1985]; Van der Putten et al., Proc. Natl. Acad. Sci. USA 82:6148-6152 [1985]; Stewart et al., EMBO J. 6:383-388 [1987]).
  • An alternative means for infecting embryos with retroviruses is the injection of virus or virus-producing cells into the blastocoele of mouse embryos (Jahner, D. et al., Nature 298:623 [1982]). The introduction of transgenes into the germline of mice has been reported using intrauterine retroviral infection of the midgestation mouse embryo (Jahner et al., supra [1982]). Infection of bovine and ovine embryos with retroviruses or retroviral vectors to create transgenic animals has been reported. These protocols involve the micro-injection of retroviral particles or growth arrested (i.e., mitomycin C-treated) cells which shed retroviral particles into the perivitelline space of fertilized eggs or early embryos (PCT International Application WO 90/08832 [1990]; and Haskell and Bowen, Mol. Reprod. Dev., 40:386 [1995]. PCT International Application WO 90/08832 describes the injection of wild-type feline leukemia virus B into the perivitelline space of sheep embryos at the 2 to 8 cell stage. Fetuses derived from injected embryos were shown to contain multiple sites of integration.
  • U.S. Pat. No. 6,291,740 (issued Sep. 18, 2001) describes the production of transgenic animals by the introduction of exogenous DNA into pre-maturation oocytes and mature, unfertilized oocytes (i.e., pre-fertilization oocytes) using retroviral vectors which transduce dividing cells (e.g., vectors derived from murine leukemia virus [MLV]). This patent also describes methods and compositions for cytomegalovirus promoter-driven, as well as mouse mammary tumor LTR expression of various recombinant proteins.
  • U.S. Pat. No. 6,281,408 (issued Aug. 28, 2001) describes methods for producing transgenic animals using embryonic stem cells. Briefly, the embryonic stem cells are used in a mixed cell co-culture with a morula to generate transgenic animals. Foreign genetic material is introduced into the embryonic stem cells prior to co-culturing by, for example, electroporation, microinjection or retroviral delivery. ES cells transfected in this manner are selected for integrations of the gene via a selection marker such as neomycin.
  • U.S. Pat. No. 6,271,436 (issued Aug. 7, 2001) describes the production of transgenic animals using methods including isolation of primordial germ cells, culturing these cells to produce primordial germ cell-derived cell lines, transforming both the primordial germ cells and the cultured cell lines, and using these transformed cells and cell lines to generate transgenic animals. The efficiency at which transgenic animals are generated is greatly increased, thereby allowing the use of homologous recombination in producing transgenic non-rodent animal species.
  • Gene Therapy
  • The use of modified transferrin fusion constructs for gene therapy wherein a modified transferrin protein or transferrin domain is joined to a therapeutic protein or peptide is contemplated in one embodiment of this invention. The modified transferrin fusion constructs with increased serum half-life or serum stability of the instant invention are ideally suited to gene therapy treatments.
  • The successful use of gene therapy to express a soluble fusion protein has been described. Briefly, gene therapy via injection of an adenovirus vector containing a gene encoding a soluble fusion protein consisting of cytotoxic lymphocyte antigen 4 (CTLA4) and the Fc portion of human immunoglubulin G1 was recently shown in Ijima et al. (Jun. 10, 2001) Human Gene Therapy (United States) 12/9:1063-77. In this application of gene therapy, a murine model of type II collagen-induced arthritis was successfully treated via intraarticular injection of the vector.
  • Gene therapy is also described in a number of U.S. patents including U.S. Pat. No. 6,225,290 (issued May 1, 2001); U.S. Pat. No. 6,187,305 (issued Feb. 13, 2001); and U.S. Pat. No. 6,140,111 (issued Oct. 31, 2000).
  • U.S. Pat. No. 6,225,290 provides methods and constructs whereby intestinal epithelial cells of a mammalian subject are genetically altered to operatively incorporate a gene which expresses a protein which has a desired therapeutic effect. Intestinal cell transformation is accomplished by administration of a formulation composed primarily of naked DNA, and the DNA may be administered orally. Oral or other intragastrointestinal routes of administration provide a simple method of administration, while the use of naked nucleic acid avoids the complications associated with use of viral vectors to accomplish gene therapy. The expressed protein is secreted directly into the gastrointestinal tract and/or blood stream to obtain therapeutic blood levels of the protein thereby treating the patient in need of the protein. The transformed intestinal epithelial cells provide short or long term therapeutic cures for diseases associated with a deficiency in a particular protein or which are amenable to treatment by overexpression of a protein.
  • U.S. Pat. No. 6,187,305 provides methods of gene or DNA targeting in cells of vertebrate, particularly mammalian, origin. Briefly, DNA is introduced into primary or secondary cells of vertebrate origin through homologous recombination or targeting of the DNA, which is introduced into genomic DNA of the primary or secondary cells at a preselected site.
  • U.S. Pat. No. 6,140,111 (issued Oct. 31, 2000) describes retroviral gene therapy vectors. The disclosed retroviral vectors include an insertion site for genes of interest and are capable of expressing high levels of the protein derived from the genes of interest in a wide variety of transfected cell types. Also disclosed are retroviral vectors lacking a selectable marker, thus rendering them suitable for human gene therapy in the treatment of a variety of disease states without the co-expression of a marker product, such as an antibiotic. These retroviral vectors are especially suited for use in certain packaging cell lines. The ability of retroviral vectors to insert into the genome of mammalian cells have made them particularly promising candidates for use in the genetic therapy of genetic diseases in humans and animals. Genetic therapy typically involves (1) adding new genetic material to patient cells in vivo, or (2) removing patient cells from the body, adding new genetic material to the cells and reintroducing them into the body, i.e., in vitro gene therapy. Discussions of how to perform gene therapy in a variety of cells using retroviral vectors can be found, for example, in U.S. Pat. No. 4,868,116, issued Sep. 19, 1989, and 4,980,286, issued Dec. 25, 1990 (epithelial cells), WO89/07136 published Aug. 10, 1989 (hepatocyte cells), EP 378,576 published Jul. 25, 1990 (fibroblast cells), and WO89/05345 published Jun. 15, 1989 and WO/90/06997, published Jun. 28, 1990 (endothelial cells), the disclosures of which are incorporated herein by reference.
  • Kits Containing Transferrin Fusion Proteins
  • In a further embodiment, the present invention provides kits containing transferrin fusion proteins, which can be used, for instance, for the therapeutic or non-therapeutic applications. The kit comprises a container with a label. Suitable containers include, for example, bottles, vials, and test tubes. The containers may be formed from a variety of materials such as glass or plastic. The container holds a composition which includes a transferrin fusion protein that is effective for therapeutic or non-therapeutic applications, such as described above. The active agent in the composition is the therapeutic protein. The label on the container indicates that the composition is used for a specific therapy or non-therapeutic application, and may also indicate directions for either in vivo or in vitro use, such as those described above.
  • The kit of the invention will typically comprise the container described above and one or more other containers comprising materials desirable from a commercial and user standpoint, including buffers, diluents, filters, needles, syringes, and package inserts with instructions for use.
  • Without further description, it is believed that a person of ordinary skill in the art can, using the preceding description and the following illustrative examples, make and utilize the present invention and practice the claimed methods. For example, a skilled artisan would readily be able to determine the biological activity, both in vitro and in vivo, for the fusion protein constructs of the present invention as compared with the comparable activity of the therapeutic moiety in its unfused state. Similarly, a person skilled in the art could readily determine the serum half life and serum stability of constructs according to the present invention. The following working examples therefore, specifically point out the preferred embodiments of the present invention, and are not to be construed as limiting in any way the remainder of the disclosure.
  • EXAMPLES Example 1 T-20/Transferrin Fusion Protein
  • T-20 is a HIV fusogenic inhibitor peptide with the following amino acid sequence: YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF (SEQ ID NO: 17). The present invention provides fusion proteins comprising T-20 peptide and modified transferrin (mTf) with increased half-life and pharmaceutical compositions of such fusion proteins for the treatment of diseases associated with the transmission of a virus. The example described below may also be used to generate transferrin fusion proteins with analogs of the T-20 peptides.
  • The transferrin fusion protein with anti-HIV activity of the present invention was produced by fusing T-20 to modified transferrin (mTf) using Saccharomyces cerevisiae. Accordingly, in the first step, SEQ ID NO: 17 was back translated into DNA codon optimized for Saccharomyces cerevisiae and used to produce fusion constructs of T-20 at the N- or C-terminus of mTf .
  • 5′ Fusion
  • As an example, T-20 is fused to the 5′ end of mTf using overlapping primers with restriction site overhangs at each end, such as XbaI and KpnI sites for ligation into an appropriate vector. Alternatively, overlapping primers with other restriction site overhangs could be generated or the primers could be annealed to adapters with appropriate restriction site overhangs for ligation into a specifically designed vector.
  • A vector is specifically designed with restriction sites such as XbaI and KpnI sites to allow fusion of therapeutic molecules into the N-terminus of mTf. The primers are annealed and cloned into this vector using the XbaI and KpnI sites or other appropriate restriction sites at the 5′ end of the modified transferrin (mTf) vector. The cassette encoding the T-20/mTf fusion protein is then removed from the vector and cloned into a yeast vector for protein expression
  • Specifically, the following overlapping primers with restriction overhangs are designed for producing the 5′ T-20 fusion:
    Figure US20070050855A1-20070301-C00001
  • he overlapping primers have the following sequences:
    P0038:
    (SEQ ID NO: 18)
    CTAGAGAAAAGGTACACTAGCTTAATACAC
    P0039:
    (SEQ ID NO: 19)
    TGCGATTCTTCAATTAAGGAGTGTATTAAGCTAGTGTACCTTTTCT
    P0040:
    (SEQ ID NO: 20)
    TCCTTAATTGAAGAATCGCAAAACCAGCAAGAAAAGAATG
    P0041:
    (SEQ ID NO: 21)
    TAATTCCAATAATTCTTGTTCATTCTTTTCTTGCTGGTTT
    P0042:
    (SEQ ID NO: 22)
    AACAAGAATTATTGGAATTAGATAAATGGGCAAGTTTGTGGAATTGGTTT
    GTAC
    P0043:
    (SEQ ID NO: 23)
    AAACCAATTCCACAAACTTGCCCATTTATC
  • The primers are annealed at 65° C. and ligated into the specifically designed vector pREX5004, cut with XbaI and KpnI to create pREX5016. Following identification of a correct clone by sequencing, the correct clone is bulked up and digested with another pair of appropriate restriction enzymes such as Psil and Agel to remove the cassette encoding the T-20/mTf fusion protein out of pREX5016. The cassette is ligated into a yeast vector, such as pSAC3, cut with PsiI and AgeI. pSAC3 containing the T-20/mTf N-terminus fusion protein is then electroporated into yeast for protein production.
  • 3′ Fusion
  • In the same manner, T-20 fusion is fused to the 3′ end of T-20 using overlapping primers with restriction site overhangs, such as SalI and HindIII or other restriction enzymes, at each end. Once annealed, this fragment is cloned into a specifically designed vector, pREX5001, using restriction sites such as SalI and HindIII sites. Following identification of the correct clone through sequencing, the plasmid is cut with SalI and HindIII and the fragment is sub-cloned into pREX5004 which is specifically designed to with unique SalI and HindIII sites to allow fusion of therapeutic protein to the C-terminus of mTf. The resulting plasmid is pREX5017. pREX5017 is then cut with appropriate enzymes such as Psil and Agel to remove the T-20/mTf cassette out of the vector. The T-20/m-Tf cassette is sub-cloned into a yeast vector, such as pSAC3, for expression in yeast.
  • Specifically, the following overlapping primers with restriction overhangs are designed for producing the T-20 fusion to the C-terminus of mTf:
    Figure US20070050855A1-20070301-C00002
  • The overlapping primers have the following sequences:
    P0044:
    (SEQ ID NO: 24)
    TCGACCTTACACTAGCTTAATACAC
    P0045:
    (SEQ ID NO: 25)
    TGCGATTCTTCAATTAAGGAGTGTATTAAGCTAGTGTAAGG
    P0040:
    (SEQ ID NO: 26)
    TCCTTAATTGAAGAATCGCAAAACCAGCAAGAAAAGAATG
    P0041:
    (SEQ ID NO: 27)
    TAATTCCAATAATTCTTGTTCATTCTTTTCTTGCTGGTTT
    P0046:
    (SEQ ID NO: 28)
    AACAAGAATTATTGGAATTAGATAAATGGGCAAGTTTGTGGAATTGGTTT
    TAATA
    P0047:
    (SEQ ID NO: 29)
    AGCTTATTAAAACCAATTCCACAAACTTGCCCATTTATC
  • The primers are annealed at 65° C. and ligated into the specifically designed vector cut with SalI and HindIII. Following identification of a correct clone by sequencing, the correct clone is bulked up and digested with another pair of appropriate restriction enzymes such as Psil and Agel to remove the cassette encoding the T-20/mTf C-terminus fusion protein out of the vector. This cassette is ligated into a yeast vector, such as pSAC3, cut with Psil and Agel. pSAC3 containing the T-20/mTf fusion protein is then electroporated into yeast for protein production.
  • C-terminus Modifications
  • Modifications are made at the 3′ end of mTf to determine if they would effect an increase in fusion expression levels, T-20 fusion activity, and/or improve mobility of the peptide at the C terminus of mTf.
  • RRP Deletion
  • In the first step, proline at the 3′ end of mTf is removed. In addition to the proline, the adjoining two arginine residues are removed since they may present a potential Kex2p protease cleavage site. The deleted sequence is shown in the alignment below of unmodified 3′ T-20 mTf fusion insert (pREX5017, SEQ ID NO: 31) and 3′ T-20 mTf fusion insert with RRP deletion (pREX5032, SEQ ID NO: 30):
    Figure US20070050855A1-20070301-C00003
  • Specifically, the RRP sequence is deleted using primers homologous to adjoining regions of the sequence. The primers used for generating the deletion are:
    P0060:
    (SEQ ID NO: 32)
    TCATCACTCCTGGAAGCCTGCACTTTCTACACTAGCTTAATACACTCCTT
    P0061:
    (SEQ ID NO: 33)
    AAGGAGTGTATTAAGCTAGTGTAGAAAGTGCAGGCTTCCAGGAGTGATGA
  • A mutagenic PCR reaction is performed using the external primers and pREX5017 as the template to generate a product missing the 9 bases coding for RRP. This product is then cut with SphI/HindIII and cloned into SphI/HindIII cut pREX5017 to make pREX5032. pREX5032 was then cut with AgeI/Psil, sub-cloned into a yeast vector such as pSAC3 and transformed into yeast for protein expression.
  • C402-C674 Disulfide Removal
  • In the next step, the disulfide bond that stretches between Cys402 and Cys674 in the mTF molecule, is removed. This is accomplished by mutating both cysteine residues to glycine residues. First, using mutagenic primers Cys402 is mutated to Gly. The mutagenic primers are:
    P0064:
    (SEQ ID NO: 34)
    TTGTCTACATAGCGGGCAAGGGTGGTCTGGTGCCTGTCTTG
    P0065:
    (SEQ ID NO: 35)
    CAAGACAGGCACCAGACCACCCTTGCCCGCTATGTAGACAA
  • A PCR reaction is performed using the external primers and pREX5017 as the template to generate the product with the desired mutation. This product is then cut with HpaI/PstI and cloned back into pREX5017 making a Gly402 intermediate, pREX5039. Next, Cys674 is mutated into Gly674 following the same procedure and using pREX5004 as a template and the following primers:
    P0068:
    (SEQ ID NO: 36)
    TCCACCTCATCACTCCTGGAAGCCGGTACTTTCCGTCGACCTTAA
    P0069:
    (SEQ ID NO: 37)
    CTTATTAAGGTCGACGGAAAGTACCGGCTTCCAGGAGTGATGAGGTGG
  • The resulting product is cut with SphI/HindIII and sub-cloned into the new Gly402 intermediate, pREX5039, making pREX5038. This plasmid does not contain the T-20 peptide making it useful in the future for other mTf fusions. To insert the T-20 peptide into pREX5038, the SalI/Agel fragment of pREX5017 is cloned to form pREX5034. pREX5034 was then cut with AgeI/PsiI. The cassette is sub-cloned into a yeast vector, such as pSAC3, and transformed into yeast for protein expression. The mutations are shown in the alignment below of unmodified 3′ T-20 mTf fusion plasmid insert (pREX5017) and 3′ T-20 mTf fusion insert with C402-C674 disulfide deletion:
    Figure US20070050855A1-20070301-C00004

    Disulfide and RRP Removal Combination
  • In the third step, RRP deletion and the C402-C674 disulfide deletion are combined. To begin, an intermediate plasmid, pREX5041, is made in the manner as pREX5032 with the exception that the Cys674 mutation was present in the primers. The following primers are used:
    P0066:
    (SEQ ID NO: 42)
    TCCACCTCATCACTCCTGGAAGCCGGCACTTTCTACACTAGCTTAATA
    P0067:
    (SEQ ID NO: 43)
    GTGTATTAAGCTAGTGTAGAAAGTACCGGCTTCCAGGAGTGATGAGGT
  • pREX5041 is then cut with SphI/HindIII and sub-cloned into pREX5039 to create pREX5033. pREX5033 is then cut with AgeI/PsiI. The cassette is sub-cloned into a yeast vector, such as pSAC3, and then transformed into yeast for protein expression. The following alignment of the mTf 3′ T-20 fusion of pREX5033 with pREX5017 shows the mutations of the resulting product.
    Figure US20070050855A1-20070301-C00005
  • Example 2 EMP1/Transferrin Fusion Protein
  • EMP1 (SEQ ID NO: 11) has been shown to mimic EPO activity by causing dimerization of the EPO receptor. The peptide, which is cyclic, has no homology to EPO. To become active, the peptide has to act in concert with another peptide, i.e. as a dimer, such that two copies of the receptor are brought in close enough proximity to form an active complex. As with many peptides, the peptide dimer suffers from short half life and would benefit from the longevity that fusion to transferrin would give. The present invention provides fusion protein with EPO mimetic activity. As an example, the fusion protein of the present invention comprises EMP1 peptide (SEQ ID NO: 11) and modified transferrin (mTf) with increased half-life. The present invention also provides pharmaceutical compositions of such fusion proteins for the treatment of diseases associated with low or defective red blood cell production.
  • EMP1-mTF fusions and insertions
  • The initial fusions to mTf comprises fusions to the N-, C-, and N- and C-termini of mTf. The individual fusions will bind the receptor but not cause activation of the receptor. The dual fusion, one of which must be a different codon composition than the other to prevent recombination, will enable binding to the receptor and cause activation.
  • Examination of the N-domain of human Tf (PDB identifier 1A8E) and the full Tf model AAAaoTfwo, generated using the ExPasy Swiss Model Server with the rabbit model 1JNF as template, reveals a number of potential sites for insertion of a peptide, either directly or by replacement of a number of residues. These sites are duplicated by their equivalent sites in the C domain.
    N1 N2
    Asp33 Ser105
    Asn55 Glu141
    Asn75 Asp166
    Asp90 Gln184
    Gly257 Asp197
    Lys280 Lys217
    His289 Thr231
    Ser298 Cys241
  • Two of these loops are the preferred sites into which the EMP1 peptide may be inserted: N1 His289 (286-292) and N2 Asp166 (162-170). These positions give the correct orientation required for binding to the two halves of the EPO receptor. As the insertion sites are on the N1 and N2 domains of the N domain, they have the flexibility of the hinge between these two sub domains, which allows them to work their way into the receptor.
  • Due to the structural similarity between the N and C domain the equivalent insertion sites on the C domain (C1 489-495, C2 623-628) may also be used to make the molecule multivalent. This is done using a variety of the potential insert sites indicated above either on just the N or C domain or by a combination of sites on both domains.
    Figure US20070050855A1-20070301-C00006
  • Steps for Producing the EMP1/mTf Fusion Protein
  • In this Example, two EMP1 peptides (SEQ ID NO: 11) are engineered into the transferrin scaffold using the encoding nucleic acids of the peptides and mTf.
    1 ggtggtactt actcttgtca ttttggtcca ttgacttggg tttgtaagcc acaaggtggt
        g  g  t   y  s  c   h  f  g  p   l  t  w   v  c  k   p  q  g  g
    nucleic acid sequence: SEQ ID NO: 45
    amino acid sequence: SEQ ID NO: 11
  • A EMP1 peptide is engineered into mTf between His289 and Gly290. The duplication inherent to the transferrin molecule, with the two domains mirroring each other, makes it possible to engineer a second EMP1 peptide into the duplicate region of the C domain, between Glu625 and Thr626.
    Figure US20070050855A1-20070301-C00007
  • As an example, for each insertion two overlapping mutagenic primers are synthesized (see below). Using a vector containing the nucleic acid encoding mTf, such as pREX5010, as a template, reactions are performed with each mutagenic primer and an external primer from the 5′ or 3′ of the Tf cDNA. The products from these two reactions were then mixed and a further reaction performed with the external primers to join the two products together. The His289-Gly290 insert PCR product is digested with XbaI and HpaI for ligation into XbaI/HpaI digested pREX50 10. The resulting vector is then digested with HpaI and SalI for ligation of HpaI/SalI digested Glu625-Thr626 insert PCR product.
    His289-Gly290 insert (SEQ ID NO: 46)
                                        
    Figure US20070050855A1-20070301-P00801
    -------------
    2031 agacaaatca [aaagaatttc aactattcag ctctcctcat ggtggtactt actcttgtca ttttggtcca
    tctgtttagt tttcttaaag ttgataagtc gagaggagta ccaccatgaa [tgagaacagt aaaaccaggt
                                              >>.............EMOm..............>
    >....................................Tf....................................>
    >.................................N domain.................................>
    2101 ttgacttggg tttgtaagcc] acaaggtggt gggaaggacc tgctgtttaa ggactctgcc cacgggtttt
    aactgaaccc aaacattcgg tgttccacca cccttcctgg acgacaaatt cctgagacgg] gtgcccaaaa
                              -----------→
    >............EMOm.............>>
    >....................................Tf....................................>
    >.................................N domain.................................>
    Glu625-Thr626 insert (SEQ ID NO: 47)
                                                            
    Figure US20070050855A1-20070301-P00801
    -------------
    3081 cctatttgga agcaacgtaa ctgactgctc [gggcaacttt tgtttgttcc ggtcggaagg tggtacttac
    ggataaacct tcgttgcatt gactgacgag cccgttgaaa acaaacaagg ccagccttcc accatgaat [g
                                                                   >>...EPOm...>
    >.................................C domain.................................>
    >....................................Tf....................................>
                                                       KpnI
                                                      -------
    3151 tcttgtcatt ttggtccatt gacttgggtt tgtaagccac] aaggtggtac caaggacctt ctgttcagag
    agaacagtaa aaccaggtaa ctgaacccaa acattcggtg ttccaccatg gttcctggaa gacaagtctc
                              -----------→
    >......................EPOm.......................>>
    >.................................C domain.................................>
    >....................................Tf....................................>
    3221 atgacacagt atgtttggcc aaacttcatg acagaaacac atatgaaaaa tacttaggag aagaatatgt
    tactgtgtca] tacaaaccgg tttgaagtac tgtctttgtg tatacttttt atgaatcctc ttcttataca
    >.................................C domain.................................>
    >....................................Tf....................................>
  • The cassette containing the EMP1/mTF fusion protein is cut out of the vector with appropriate restriction enzymes and ligated into a yeast vector, such as pSAC3. pSAC3 is transformed into yeast for protein expression.
  • Alternative points for insertion of the EPO mimetic peptide(s), or any other peptide(s) are the two glycosylation sites on the C domain of Transferrin at N413 and N61 1. The advantage of these sites is that once insertion is achieved, glycosylation is prevented by through disruption of the N—X—S/T sequence.
  • Example 3 GLP-1/Transferrin Fusion Protein
  • GLP-1 is a peptide that regulates insulin secretion. It possesses anti-diabetic activity in human subjects suffering diabetes, especially type II diabetes. Like other peptides, GLP-1 has a short plasma half-life in humans. The present invention provides fusion proteins with GLP-1 fused to mTf with increased half-life and pharmaceutical compositions of such fusion proteins for the treatment of diseases associated with abnormal glucose levels.
  • In this example, the steps for producing a GLP-1/mTf fusion protein are described. The same steps may be used to generate transferrin fusion proteins with analogs of the GLP-1 peptides.
  • To produce the GLP-1/mTf fusion protein, the amino acid sequence of GLP-1(7-36) and GLP-1(7-37) may be used.
    (SEQ ID NO: 48)
    haegtftsdvssylegqaakefiawlvkgr
    (SEQ ID NO: 66)
    haegtftsdvssylegqaakefiawlvkgrg
  • For example, the peptide sequence of GLP-1(7-36) is back translated into DNA and codon optimized for yeast:
    catgctgaaggtacttttacttctgatgtttcttcttatttggaaggtcaagctgctaaagaa
      h  a  e  q  t  f  t  s  d  v  s  s  y  l  e  g  q  a  a  k  e
    tttattgcttggttggttaaaggtaga (SEQ ID NO: 49)
      f  i  a  w  l  v  k  g  r (SEQ ID NO: 48)
  • The primers used are specifically designed to form a 5′ XbaI and 3′ KpnI sticky ends after annealing and be directly ligated into XbaI/KpnI cut pREX5004, just 5′ of the end of the mating factor V leader sequence and at the N-terminus of mTf. Alternatively, other sticky ends may be engineered for ligations into other vectors.
    Figure US20070050855A1-20070301-C00008
  • After annealing and ligation, the clones are sequenced to confirm correct insertion. This vector is designated pREX5028. The cassette is cut out of pREX5028 with PsiI/Agel and sub-cloned into PsiI/Agel cut yeast vector, such as PSAC3, to make the pREX5030.
  • pREX5030 is transformed into SMD1168 (his, pep4) and mut+ and mutS clones selected. Stocks were made at 100D/mL:
      • Y0023=SMD1168 pREX5030 mut+
      • Y0024=SMD1168 pREX5030 mutS
    Example 4 β-IFN/Transferrin Protein
  • β-IFN is effective in the treatment of various diseases such as but not limited to multiple sclerosis, brain tumor, skin cancer, and hepatitis B and C. Like most cytokines, β-IFN has a short circulation half-life. The present invention provides fusion proteins comprising β-IFN fused to mTf with increased half-life and efficacy in patients. This example describes the steps in generating β-IFN/mTf fusion protein.
  • In this example, IFNβ-1 is fused to modified transferrin at both the N- and C-termini. The IFNβ-1 clone is obtained from ATCC (no. 39517). Specifically designed primers are used to confirm the DNA sequence of the IFNβ-1 clone. These primers are external to the IFNβ-1 DNA sequence and designed to read in from the vector such that the full sequence of the clone were obtained. The primers used are:
    P0070
    (SEQ ID NO: 54)
    GCTATGACCAACAAGTGTCTC
    P0071
    (SEQ ID NO: 55)
    CGCACCTGTGGCGCCGGTGATG

    N-Terminal Fusion
  • Once the DNA sequence is confirmed, primers are designed for fusion of IFNβ-1 to mTf. The N-terminal fusion is a two step process. A straight fusion using primers with XbaI and KpnI sites would destroy the KpnI site and clip the beginning of mTf. A linker, primers P0082 (nucleotides 18-48 of SEQ ID NO: 56) and P0083 (nucleotides 17-39 SEQ ID NO: 57), is designed to create an internal KpnI site in the 3′ of IFNβ-1, by a single silent mutation of bp 486 from T to G (bold), and with a 5′ XbaI overhang and 3′ GTAC which would anneal with a KpnI site. The overhang destroys the existing KpnI site in pREX5004. The linkers are annealed and ligated into pREX5004 cut with XbaI/KpnI creating an intermediate vector with mTf untouched and a KpnI site that could be used to fuse the IFNβ-L gene at the N-terminus of mTf.
    Figure US20070050855A1-20070301-C00009
  • A second set of primers, P0084 (SEQ ID NO: 61) and P0085 (SEQ ID NO: 62), are designed to tailor the ends of the IFNβ-L gene by mutagenic PCR for subsequent insertion into the intermediate vector via the XbaI and KpnI sites. A XbaI/KpnI digest of this tailored gene removes the last 5 amino acids of IFNβ-1; however, these are already engineered into the intermediate vector. The resulting construct, pREX5048, is created by ligating the IFNβ-L gene cut with XbaI/KpnI into the XbaI/KpnI cut intermediate vector.
    Figure US20070050855A1-20070301-C00010
  • After the pREX5048 construct was created, it was sequenced to confirm correct insertion. The expression cassette, as a PsiI/AgeI fragment, was then sub-cloned into PsiI/AgeI cut yeast vector, pSAC3, to make the pREX5050.
  • C-terminal fusion
  • Specifically designed primers, P0086 (SEQ ID NO: 63) and P0087 (SEQ ID NO: 64), are used to PCR amplify the original clone and in addition tailor the ends of IFNβ-1 to have SalI and HindIII sites at the 5′ and 3′ ends respectively. The newly tailored product is ligated into SalI/HindIII cut pREX5004 to create pREX5049.
    Figure US20070050855A1-20070301-C00011
  • After the pREX5049 construct is created, it is sequenced to confirm correct insertion. The expression cassette, as a PsiI/Agel fragment, is then sub-cloned into PsiI/Agel cut yeast vector, such as pSAC3, to make pREX5051.
  • In one embodiment of the invention, β-IFN-1 (GenBank Acc. 002176) is made more stable and soluble by mutating Cys17 into Ser. The mutation of Cys17 into Ser can be performed by routine mutagenic reactions such as a mutagenic PCR reaction using specifically designed primers and the nucleic acid encoding β-IFN-1 as the template.
  • Further, the β-IFN-1 is modified to prevent glycosylation by modifying the N-linked glycosylation site, NXS/T. As an example, N could be mutagenized to Q and S/T could be mutagenized to Ala or other amino acid acids. Such mutagenesis could be performed with mutagenic PCR reaction using specifically designed primers and the nucleic acid encoding β-IFN-1 as the template.
  • Example 5 Soluble Toxin Receptor/Transferrin Protein
  • Clostridial neurotoxins are poisonous substance. Synaptotagmin I is a broad acting receptor of Clostridium botulinum neurotoxin serotypes. Amino acids 1-53 (SEQ ID NO: 4) of synaptotagmin I is responsible for binding to various neurotoxin serotypes. Like other peptides, a soluble toxin receptor, such as amino acids 1-53, has a short half-life. The present invention provides fusion protein comprising amino acids 1-53 fused mTf with increased half-life as compared to the soluble toxin receptor having SEQ ID NO: 1-53.
  • The present invention provides fusion proteins with anti-toxin activity and increased half-life. Specifically, in this example, a fusion protein comprising modified Tf and a peptide consisting of amino acids 1-53 (SEQ ID NO: 4) of synaptotagmin I, is produced by fusing one or more copies of the nucleotide sequence encoding the peptide to the nucleotide sequence of Tf to produce a fusion protein with a peptide fused to the N- or C-terminus of Tf.
  • To insert the sequence encoding SEQ ID NO: 4, the vector pREX5010 with the modified transferrin cDNA, is digested with the restriction enzymes XbaI/KpnI for insertion at the 5′ end and SalI/Hind III for insertion at the 3′ end.
  • For the 5′ insertion, two overlapping oligos that form an XbaI overhang at the 5′ end and a KpnI overhang at the 3′ end of the nucleic acid encoding SEQ ID NO: 4 are synthesized. These oligos are then annealed together and ligated into the XbaI/KpnI digested pREX5010 vector.
  • Transformation, selection, and expression are then performed in yeast.
  • Although the present invention has been described in detail with reference to examples above, it is understood that various modifications can be made without departing from the spirit of the invention. Accordingly, the invention is limited only by the following claims. All cited patents, patent applications and publications referred to in this application are herein incorporated by reference in their entirety.

Claims (86)

1. A fusion protein comprising a modified transferrin (Tf) protein fused to a therapeutic protein or peptide, wherein the Tf protein exhibits reduced glycosylation, reduced metal binding, or reduced receptor binding.
2. A fusion protein of claim 1, wherein the therapeutic protein or peptide is selected from the group comprising β-interferon (IFN), glucagon-like peptide (GLP-1), erythropoietin mimetic peptide (EMP1), T-20, and soluble toxin receptor.
3. A fusion protein of claim 2, wherein the soluble toxin receptor is synaptotagmin I.
4. A fusion protein of claim 1, wherein the therapeutic protein or peptide or the soluble toxin receptor is fused to the C-Terminal end of Tf.
5. A fusion protein of claim 1, wherein the therapeutic protein or peptide or the soluble toxin receptor is fused to the N-terminal end of Tf.
6. A fusion protein of claim 1, wherein the therapeutic protein or peptide or the soluble toxin receptor is inserted into at least one loop of the Tf.
7. A fusion protein of claim 1, wherein the Tf protein has reduced affinity for a transferrin receptor (TfR).
8. A fusion protein of claim 1, wherein the Tf protein is lactoferrin.
9. A fusion protein of claim 7, wherein the Tf protein does not bind a TfR.
10. A fusion protein of claim 1, wherein the Tf protein has reduced affinity for iron.
11. A fusion protein of claim 10, wherein the Tf protein does not bind iron.
12. A fusion protein of claim 1, wherein said Tf protein comprises at least one mutation that prevents glycosylation.
13. A fusion protein of claim 12, wherein the Tf protein is lactoferrin.
14. A fusion protein of claim 1, which is expressed in the presence of tunicamycin.
15. A fusion protein of claim 1, wherein said Tf protein comprises a portion of the N domain of a Tf protein, a bridging peptide and a portion of the C domain of a Tf protein.
16. A fusion protein of claim 15, wherein the bridging peptide links the therapeutic protein or peptide to Tf
17. A fusion protein of claim 15, wherein the therapeutic protein or peptide is inserted between an N and a C domain of Tf protein.
18. A fusion protein of claim 1, wherein the Tf protein comprises at least one amino acid substitution, deletion or addition in the hinge region.
19. A fusion protein of claim 18, wherein said hinge region is selected from the group consisting of about residue 94 to about residue 96, about residue 245 to about residue 247, about residue 316 to about residue 318, about residue 425 to about residue 427, about residue 581 to about residue 582 and about residue 652 to about residue 658.
20. A fusion protein of claim 1, wherein said Tf protein has at least one amino acid substitution, deletion or addition at a position selected from the group consisting of Asp 63, Gly 65, Tyr 95, Tyr 188, Lys 206, His 207, His 249, Asp 392, Tyr 426, Tyr 514, Tyr 517, His 585, Thr 120, Arg 124, Ala 126, Gly 127, Thr 452, Arg 456, Ala 458 and Gly 459.
21. A fusion protein of claim 6, wherein the therapeutic protein or peptide replaces at least one loop of Tf.
22. A fusion protein of claim 12, wherein the glycosylation site is selected from the group consisting of an amino acid residue corresponding to amino acids N413, N61 1.
23. A fusion protein of claim 7 or 9, wherein the Tf comprises at least one amino acid substitution, deletion or addition at an amino acid residue corresponding to an amino acid selected from the group consisting of Asp 63, Gly 65, Tyr 95, Tyr 188, Lys 206, His 207, His 249, Asp 392, Tyr 426, Tyr 514, Tyr 517, His 585, Thr 120, Arg 124, Ala 126, Gly 127, Thr 452, Arg 456, Ala 458 and Gly 459.
24. A fusion protein of claim 4, wherein the Tf C-terminal proline residue is deleted.
25. A fusion protein of claim 4, wherein the Tf C-terminal cysteine loop is deleted.
26. A fusion protein of claim 1, wherein the serum half-life of the therapeutic protein or peptide is increased over the serum half-life of the therapeutic protein or peptide or soluble toxin receptor in an unfused state.
27. A fusion protein of claim 1, wherein the Tf protein does not bind a TfR.
28. A fusion protein of claim 1, wherein said Tf protein exhibits reduced or no glycosylation.
29. A fusion protein of claim 28, comprising at least one mutation that prevents glycosylation.
30. A nucleic acid molecule encoding a fusion protein of either claim 1.
31. A vector comprising a nucleic acid molecule of claim 30.
32. A host cell comprising a vector of claim 31.
33. A host cell comprising a nucleic acid molecule of claim 30.
34. A method of expressing a Tf fusion protein comprising culturing a host cell of claim 32 under conditions which express the encoded fusion protein.
35. A method of expressing a Tf fusion protein comprising culturing a host cell of claim 33 under conditions which express the encoded fusion protein.
36. A host cell of claim 32, wherein the cell is prokaryotic or eukaryotic.
37. A host cell of claim 33, wherein the cell is prokaryotic or eukaryotic.
38. A host cell of claim 36, wherein the cell is a yeast cell.
39. A host cell of claim 37, wherein the cell is a yeast cell.
40. A transgenic animal comprising a nucleic acid molecule of 30.
41. A method of producing a Tf fusion protein comprising isolating a fusion protein from a transgenic animal of claim 40.
42. A method of claim 41, wherein the Tf fusion protein comprises lactoferrin.
43. A method of claim 42, wherein the fusion protein is isolated from a biological fluid from the transgenic animal.
44. A method of claim 42, wherein the fluid is serum or milk.
45. A method of treating a disease or disease symptom in a patient, comprising the step of administering a fusion protein of claim 1.
46. The fusion protein of claim 1, wherein the Tf protein has a N-terminal domain at each end of the protein.
47. The fusion protein of claim 46, wherein the therapeutic protein or peptide or the soluble toxin receptor is fused to each N-terminal domain of the Tf protein.
48. The fusion protein of claim 2, wherein the soluble toxin receptor binds specifically to a toxin.
49. A fusion protein of claim 2, wherein the therapeutic protein or peptide is an analog of β-IFN, GLP-1, erythropoietin mimetic peptide (EMP1), T-20, or soluble toxin receptor wherein the analog is effective in treating, preventing, or ameliorating a disease, condition or disorder.
50. A pharmaceutical composition comprising the fusion protein of claims 1, 2 or 3, and a carrier.
51. A method of treating a subject comprising administering to the subject a therapeutically effective amount of a fusion protein of claim 1.
52. A method of claim 51, wherein the subject is suffering from multiple sclerosis, brain tumor, skin cancer, hepatitis B, or hepatitis C, and wherein the fusion protein comprises β-IFN or an analog thereof.
53. A method of claim 52, wherein the subject is suffering from multiple sclerosis.
54. A method of claim 51, wherein the subject is suffering from elevated level of glucose as compared to a healthy subject and wherein the fusion protein comprises GLP-1 or an analog thereof.
55. A method of claim 54, wherein the elevated level of glucose is associated with diabetes.
56. A method of claim 55, wherein the diabetes is Type II diabetes.
57. A method of claim 51, wherein the subject is suffering from low or defective red blood cell production as compared to a healthy subject and wherein the fusion protein comprises EMP1 or an analog thereof.
58. A method of claim 57, wherein the low or defective red blood cell production is associated with anemia, P-thalassemia, pregnancy or menstrual disorders, rheumatoid arthritis, AIDS, and cancer.
59. A method of claim 51, wherein the subject is suffering from a disease caused by the transmission of a retrovirus and wherein the therapeutic peptide is an inhibitor of virus entry.
60. A method of claim 59, wherein the retrovirus is a human retrovirus.
61. A method of claim 60, wherein the human retrovirus is selected from the group consisting of HIV-1, HIV-2, and the human T-lymphocyte virus I (HTLV-1), HTLV-II, and HTLV-III.
62. A method of claim 59, wherein the retrovirus is a non-human retrovirus.
63. A method of claim 62, wherein the non-human retrovirus is selected from the group consisting of bovine leukosis virus, feline sarcoma and leukemia viruses, simian sarcoma and leukemia viruses, and sheep progress pneumonia viruses.
64. A method of claim 59, wherein the inhibitor is T-20, T-1249 or an analog thereof.
65. A method of claim 59, wherein the disease is AIDS.
66. A method of preventing or treating a disease or condition associated with a toxin comprising administering to the subject a therapeutically effective amount of a fusion protein comprising a modified Tf protein fused to a soluble toxin receptor, wherein the modified Tf protein exhibits reduced glycosylation, reduced metal binding, or reduced receptor binding.
67. A method of claim 66, wherein the soluble toxin receptor is selected from the group consisting of anthrax toxin receptor, botulinum toxin receptor, and diptheria toxin receptor.
68. A method of claim 67, wherein the soluble botulinum toxin receptor is amino acids 1-53 (SEQ ID NO: 4) of synaptotagmin.
69. A fusion protein of claim 1, wherein a therapeutic protein or peptide is inserted in one or more of the transferrin loops.
70. A fusion protein of claim 69, wherein a therapeutic protein is inserted in each of the 5 transferrin loops.
71. A fusion protein of claim 2, wherein the GLP-1 further comprises an additional amino acid at the N-terminus.
72. The fusion protein of claim 71, wherein the amino acid is Gly.
73. The fusion protein of claim 71, wherein the GLP-1 analog is fused to modified transferrin protein at the N-terminal end.
74. A method of regulating glucose level in a subject comprising administering to the subject a therapeutically effective amount of a fusion protein comprising a modified Tf protein fused to GLP-1 or analog thereof, wherein the modified Tf protein exhibits reduced glycosylation, reduced metal binding, or reduced receptor binding.
75. A fusion protein of claim 1, wherein the therapeutic protein or peptide is inserted into the N-domain of mTf at one or more of the sites selected from the group consisting of Asp33, Asn55, Asn 75, Asp9O, Gly257, Lys280, His289, Ser298, Ser105, Glu141, Asp166, Gln184, asp197, Lys217, Thr231, and Cys241.
76. A fusion protein of claim 1, wherein the therapeutic protein or peptide is inserted into the C-domain of mTf at one or more sites corresponding to Asp33, Asn55, Asn 75, Asp9O, Gly257, Lys280, His289, Ser298, Ser105, Glu141, Asp166, Gln184, asp197, Lys217, Thr231, or Cys241.
77. A fusion protein of claim 75, wherein the therapeutic protein or peptide is further inserted into the mTf at one or more sites corresponding to Asp33, Asn55, Asn 75, Asp90, Gly257, Lys280, His289, Ser298, Ser105, Glu141, Asp166, Gln184, asp197, Lys217, Thr231, or Cys241,
78. A fusion protein of claim 2, wherein the therapeutic peptide is EMP1 and wherein EMP1 is inserted into the N-domain of mTf at one or more sites selected from the group consisting of His289 and Asp166.
79. A fusion protein of claim 2, wherein the therapeutic peptide is EMP1 and wherein EMP1 is inserted into the C-domain of mTf at one or more sites corresponding to His289 or Asp166.
80. A fusion protein of claim 78, wherein the therapeutic peptide is further inserted into the C-domain of mTf at one or more sites corresponding to His289 or Asp166.
81. A fusion protein of claim 1, wherein mTf is further modified by deletion of the C-terminus Pro.
82. A fusion protein of claim 81, wherein mTf is further modified by deletion of Arg-Arg adjacent to the C-terminus Pro.
83. A fusion protein of claim 1, wherein the mTf is further modified by removing the disulfide bond between Cys402 and Cys674.
84. A fusion protein of claim 83, wherein the disulfide bond is removed by mutating Cys402 and Cys674 into Gly residues.
85. A fusion protein of claim 82, wherein th0.e mTf is further modified by mutating Cys402 and Cys674 into Gly residues.
86. A fusion protein of claim 1, wherein the therapeutic peptide or protein is inserted into one or more of the loops selected from the group consisting of N1(286-292), N2(162-170), C1(489-495), and C2(623-628).
US11/504,099 2001-08-30 2006-08-15 Modified transferrin fusion proteins Abandoned US20070050855A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US11/504,099 US20070050855A1 (en) 2001-08-30 2006-08-15 Modified transferrin fusion proteins

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US31574501P 2001-08-30 2001-08-30
US33405901P 2001-11-30 2001-11-30
US40697702P 2002-08-30 2002-08-30
US10/231,494 US20040023334A1 (en) 2001-08-30 2002-08-30 Modified transferrin fusion proteins
US10/378,094 US7176278B2 (en) 2001-08-30 2003-03-04 Modified transferrin fusion proteins
US11/504,099 US20070050855A1 (en) 2001-08-30 2006-08-15 Modified transferrin fusion proteins

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
US10/378,094 Division US7176278B2 (en) 2001-08-30 2003-03-04 Modified transferrin fusion proteins

Publications (1)

Publication Number Publication Date
US20070050855A1 true US20070050855A1 (en) 2007-03-01

Family

ID=31981207

Family Applications (3)

Application Number Title Priority Date Filing Date
US10/378,094 Expired - Fee Related US7176278B2 (en) 2001-08-30 2003-03-04 Modified transferrin fusion proteins
US10/515,430 Abandoned US20070066813A1 (en) 2001-08-30 2003-08-28 Modified transferrin fusion proteins
US11/504,099 Abandoned US20070050855A1 (en) 2001-08-30 2006-08-15 Modified transferrin fusion proteins

Family Applications Before (2)

Application Number Title Priority Date Filing Date
US10/378,094 Expired - Fee Related US7176278B2 (en) 2001-08-30 2003-03-04 Modified transferrin fusion proteins
US10/515,430 Abandoned US20070066813A1 (en) 2001-08-30 2003-08-28 Modified transferrin fusion proteins

Country Status (9)

Country Link
US (3) US7176278B2 (en)
EP (1) EP1611093B1 (en)
AU (1) AU2003268208B2 (en)
BR (1) BR0314092A (en)
CA (1) CA2495210A1 (en)
DK (1) DK1611093T3 (en)
ES (1) ES2547925T3 (en)
IL (1) IL166750A0 (en)
WO (1) WO2004020405A2 (en)

Cited By (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20070117159A1 (en) * 2000-12-05 2007-05-24 Young John A T Receptor for B. anthracis toxin
US20090275481A1 (en) * 2005-06-17 2009-11-05 Pfizer, Inc. Anchored Transferrin Fusion Protein Libraries
US20100068289A1 (en) * 2006-05-10 2010-03-18 Biocompatibles Uk Ltd Spherical microcapsules comprising glp-i peptides, their production and use
US20100160556A1 (en) * 2007-03-21 2010-06-24 Christine Wallrapp GLP-1 Fusion Peptides Conjugated to Polymer(s), Their Production and Use
US20110130329A1 (en) * 2005-09-22 2011-06-02 Peter Geigle Glp-1 Fusion Peptides, Their Production and Use
US20110236431A1 (en) * 2008-09-12 2011-09-29 Biocompatibles Uk Ltd. Treatment of acute myocardial infarction (ami) using encapsulated cells encoding and secreting glp-1 peptides or analogs thereof
WO2013043071A1 (en) 2011-09-23 2013-03-28 Technophage, Investigação E Desenvolvimento Em Biotecnologia, Sa Modified albumin-binding domains and uses thereof to improve pharmacokinetics
US8822639B2 (en) 2006-12-12 2014-09-02 Biorexis Pharmaceutical Corporation Transferrin fusion protein libraries

Families Citing this family (125)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20050272652A1 (en) * 1999-03-29 2005-12-08 Gault Victor A Peptide analogues of GIP for treatment of diabetes, insulin resistance and obesity
US8129504B2 (en) 2001-08-30 2012-03-06 Biorexis Technology, Inc. Oral delivery of modified transferrin fusion proteins
BR0212256A (en) * 2001-08-30 2004-08-31 Biorexis Pharmaceutical Corp Modified transferrin fusion proteins
US20070031440A1 (en) * 2001-08-30 2007-02-08 Prior Christopher P Modified transferin-antibody fusion proteins
US7176278B2 (en) * 2001-08-30 2007-02-13 Biorexis Technology, Inc. Modified transferrin fusion proteins
US20030226155A1 (en) * 2001-08-30 2003-12-04 Biorexis Pharmaceutical Corporation Modified transferrin-antibody fusion proteins
GB0205693D0 (en) * 2002-03-09 2002-04-24 Astrazeneca Ab Chemical compounds
ES2347144T3 (en) * 2002-08-30 2010-10-26 Biorexis Pharmaceutical Corporation FUSION PROTEINS OF THE MODIFIED TRANSFERRINE THAT INCLUDE DOMINOS AINO OR CARBOXILO OF TRANSFERRINA DUPLICATED.
WO2004020588A2 (en) * 2002-08-30 2004-03-11 Biorexis Pharmaceutical Corporation Transferrin fusion protein libraries
WO2005016233A2 (en) * 2002-10-31 2005-02-24 Wisconsin Alumni Research Foundation Botulinum neurotoxin b receptors and use thereof
WO2004052277A2 (en) * 2002-12-05 2004-06-24 Wisconsin Alumni Research Foundation Anthrax antitoxins
US7772188B2 (en) 2003-01-28 2010-08-10 Ironwood Pharmaceuticals, Inc. Methods and compositions for the treatment of gastrointestinal disorders
EP1626981A4 (en) * 2003-03-04 2006-11-22 Biorexis Pharmaceutical Corp Dipeptidyl-peptidase protected proteins
US20070060512A1 (en) * 2003-03-04 2007-03-15 Homayoun Sadeghi Dipeptidyl-peptidase protected protein
US7379700B2 (en) * 2003-05-06 2008-05-27 Canon Kabushiki Kaisha Image reading apparatus with rotatable internal and external guides
US20060205037A1 (en) * 2003-08-28 2006-09-14 Homayoun Sadeghi Modified transferrin fusion proteins
WO2005021579A2 (en) * 2003-08-28 2005-03-10 Biorexis Pharmaceutical Corporation Epo mimetic peptides and fusion proteins
EP1670428A4 (en) * 2003-10-10 2008-03-12 Univ Southern California G-csf transferrin fusion proteins
EP1704164B1 (en) * 2003-12-03 2011-12-28 Kröz, Monika Interleukin-11 fusion proteins
GB0329722D0 (en) * 2003-12-23 2004-01-28 Delta Biotechnology Ltd Modified plasmid and use thereof
GB0329681D0 (en) 2003-12-23 2004-01-28 Delta Biotechnology Ltd Gene expression technique
US7906140B2 (en) * 2004-06-17 2011-03-15 Virun, Inc. Compositions for mucosal delivery of agents
CA2575756A1 (en) * 2004-08-03 2006-02-16 Biorexis Technology, Inc. Combination therapy using transferrin fusion proteins comprising glp-1
WO2006055855A2 (en) * 2004-11-19 2006-05-26 Mcw Research Foundation, Inc. Method of imaging cell death in vivo
AU2005317828A1 (en) 2004-12-23 2006-06-29 Novozymes Delta Limited Gene expression technique
EP2390264A1 (en) 2005-02-11 2011-11-30 Amylin Pharmaceuticals Inc. GIP analog and hybrid polypeptides with selectable propperties
US8263545B2 (en) 2005-02-11 2012-09-11 Amylin Pharmaceuticals, Inc. GIP analog and hybrid polypeptides with selectable properties
GB0512707D0 (en) * 2005-06-22 2005-07-27 Delta Biotechnology Ltd Gene expression technique
ES2638792T3 (en) * 2005-07-28 2017-10-24 Carbon Sink Inc. Removal of carbon dioxide from the air
AU2006289259A1 (en) * 2005-09-08 2007-03-15 Uutech Limited Analogs of gastric inhibitory polypeptide as a treatment for age related decreased pancreatic beta cell function
US20090170762A1 (en) * 2005-09-08 2009-07-02 Uutech Limited Treatment of Diabetes Related Obesity
US20130172274A1 (en) 2005-12-20 2013-07-04 Duke University Methods and compositions for delivering active agents with enhanced pharmacological properties
WO2007073486A2 (en) 2005-12-20 2007-06-28 Duke University Methods and compositions for delivering active agents with enhanced pharmacological properties
US8841255B2 (en) 2005-12-20 2014-09-23 Duke University Therapeutic agents comprising fusions of vasoactive intestinal peptide and elastic peptides
AU2007227202B2 (en) 2006-03-21 2013-08-22 Amylin Pharmaceuticals, Llc Peptide-peptidase inhibitor conjugates and methods of using same
CA2657277C (en) 2006-07-13 2015-11-24 Upperton Limited Process for preparing particles of proteinaceous material
CN101511868B (en) * 2006-07-24 2013-03-06 比奥雷克西斯制药公司 Exendin fusion proteins
WO2008021412A2 (en) * 2006-08-14 2008-02-21 Biorexis Pharmaceutical Corporation Interferon beta and transferrin fusion proteins
US8497240B2 (en) 2006-08-17 2013-07-30 Amylin Pharmaceuticals, Llc DPP-IV resistant GIP hybrid polypeptides with selectable properties
US8920808B2 (en) 2006-10-31 2014-12-30 East Carolina University Cytokine-based fusion proteins for treatment of multiple sclerosis
EP1975176A1 (en) * 2007-03-27 2008-10-01 Biocompatibles UK Limited Novel glp-1 fusion peptides, their production and use
EP2604623A3 (en) 2007-08-08 2013-10-02 Novozymes Biopharma DK A/S Transferrin variants and conjugates
US8598314B2 (en) * 2007-09-27 2013-12-03 Amylin Pharmaceuticals, Llc Peptide-peptidase-inhibitor conjugates and methods of making and using same
EP2207890A4 (en) * 2007-10-05 2010-12-15 Barofold Inc High pressure treatment of aggregated interferons
CA2953975C (en) 2008-06-27 2019-11-26 Duke University Therapeutic agents comprising elastin-like peptides
CN102369213A (en) 2009-02-06 2012-03-07 诺维信生物制药丹麦公司 Purification process
EP2216341A1 (en) 2009-02-10 2010-08-11 Novozymes Biopharma UK Limited Transferrin variants and conjugates
US9238878B2 (en) 2009-02-17 2016-01-19 Redwood Bioscience, Inc. Aldehyde-tagged protein-based drug carriers and methods of use
EP2413958A4 (en) 2009-03-31 2014-04-02 Univ East Carolina Cytokines and neuroantigens for treatment of immune disorders
JP5727459B2 (en) 2009-04-22 2015-06-03 アルテオゼン, インクAlteogen, Inc Protein or peptide fusion with increased half-life in the body by maintaining body persistence
WO2011009747A1 (en) * 2009-07-24 2011-01-27 Novozymes A/S Carbohydrate oxidases
KR101943420B1 (en) 2009-08-14 2019-04-17 파세비오 파마수티컬스 인코포레이티드 Modified Vasoactive Intestinal Peptide
CN101993485B (en) 2009-08-20 2013-04-17 重庆富进生物医药有限公司 Peptide analog homologous dimer capable of accelerating insulin secretion and application thereof
DK2483824T3 (en) 2009-09-30 2017-11-27 Dreamed Diabetes Ltd INSULIN CONTROL MONITORING MONITOR
CA2780741C (en) 2009-10-12 2023-04-04 Smith Holdings, Llc Methods and compositions for modulating gene expression using oligonucleotide based drugs administered in vivo or in vitro
JP5737597B2 (en) 2009-11-19 2015-06-17 浙江大学 Non-natural collagen-like protein and its application
US8765432B2 (en) 2009-12-18 2014-07-01 Oligasis, Llc Targeted drug phosphorylcholine polymer conjugates
AR080993A1 (en) 2010-04-02 2012-05-30 Hanmi Holdings Co Ltd FORMULATION OF PROLONGED BETA INTERFERTION ACTION WHERE AN IMMUNOGLOBULIN FRAGMENT IS USED
KR101331101B1 (en) 2010-06-04 2013-11-19 에스케이케미칼주식회사 Fusion protein having factor vii activity
WO2012003398A1 (en) * 2010-07-02 2012-01-05 University Of Southern California Method for uses of protein precursors as prodrugs
US10513563B2 (en) 2010-07-02 2019-12-24 University Of Southern California Method for uses of proinsulin transferrin fusion proteins as prodrugs
SI2646470T1 (en) 2010-11-30 2017-05-31 F. Hoffmann-La Roche Ag Low affinity anti-transferrin receptor antibodies and their use to transfer therapeutic scfv across the blood brain barrier
RU2606016C2 (en) 2011-01-14 2017-01-10 Редвуд Байосайнс, Инк. Aldehyde marked immunoglobulin polypeptides and methods of their application
EP2709648A4 (en) 2011-05-19 2015-04-08 Geysen Hendrik M Compounds that bind to the erythropoietin receptor
US9561262B2 (en) 2011-06-06 2017-02-07 Phasebio Pharmaceuticals, Inc. Use of modified vasoactive intestinal peptides in the treatment of hypertension
KR102238317B1 (en) 2012-05-17 2021-04-12 익스텐드 바이오사이언시즈, 인크. Carriers for improved drug delivery
EP2830135A1 (en) 2013-07-26 2015-01-28 NIM Energy Catalyzer body and hydrogen generator device
WO2015023649A2 (en) 2013-08-12 2015-02-19 3M Innovative Properties Company Peptides for enhancing transdermal delivery
EP3760639A1 (en) 2013-09-08 2021-01-06 Kodiak Sciences Inc. Zwitterionic polymer conjugates
US10988745B2 (en) 2013-10-31 2021-04-27 Resolve Therapeutics, Llc Therapeutic nuclease-albumin fusions and methods
WO2015069660A2 (en) * 2013-11-05 2015-05-14 New York Blood Center, Inc. Methods and compositions for increasing hepcidin expression using modified iron binding/releasing transferrin
CA2947982C (en) 2014-05-08 2022-11-29 Phasebio Pharmaceuticals, Inc. Methods and compositions for treating cystic fibrosis
US9840553B2 (en) 2014-06-28 2017-12-12 Kodiak Sciences Inc. Dual PDGF/VEGF antagonists
US20170216403A1 (en) 2014-08-12 2017-08-03 Massachusetts Institute Of Technology Synergistic tumor treatment with il-2, a therapeutic antibody, and an immune checkpoint blocker
DK3180018T3 (en) 2014-08-12 2019-10-28 Massachusetts Inst Technology Synergistic tumor treatment with IL-2 and integrin-binding Fc fusion protein
KR20210013299A (en) 2014-10-17 2021-02-03 코디악 사이언시스 인코포레이티드 Butyrylcholinesterase zwitterionic polymer conjugates
WO2016065042A1 (en) 2014-10-22 2016-04-28 Extend Biosciences, Inc. Therapeutic vitamin d conjugates
WO2016065052A1 (en) 2014-10-22 2016-04-28 Extend Biosciences, Inc. Insulin vitamin d conjugates
US9789197B2 (en) 2014-10-22 2017-10-17 Extend Biosciences, Inc. RNAi vitamin D conjugates
WO2016069889A1 (en) 2014-10-31 2016-05-06 Resolve Therapeutics, Llc Therapeutic nuclease-transferrin fusions and methods
AU2016219513B2 (en) 2015-02-09 2021-09-30 Immunoforge Co., Ltd. Methods and compositions for treating muscle disease and disorders
US10781246B2 (en) 2015-06-05 2020-09-22 New York University Compositions and methods for anti-staphylococcal biologic agents
RU2744860C2 (en) 2015-12-30 2021-03-16 Кодиак Сайенсиз Инк. Antibodies and their conjugates
CA3019398A1 (en) 2016-04-26 2017-11-02 R.P. Scherer Technologies, Llc Antibody conjugates and methods of making and using the same
MX2018013546A (en) 2016-05-06 2019-04-22 Phasebio Pharmaceuticals Inc Elp fusion proteins for controlled and sustained release.
US10350266B2 (en) 2017-01-10 2019-07-16 Nodus Therapeutics, Inc. Method of treating cancer with a multiple integrin binding Fc fusion protein
US10603358B2 (en) 2017-01-10 2020-03-31 Nodus Therapeutics Combination tumor treatment with an integrin-binding-Fc fusion protein and immune stimulator
AU2018250695A1 (en) 2017-04-14 2019-11-07 Kodiak Sciences Inc. Complement factor D antagonist antibodies and conjugates thereof
EP3684811A2 (en) 2017-08-17 2020-07-29 Massachusetts Institute of Technology Multiple specificity binders of cxc chemokines and uses thereof
SG11202001311VA (en) 2017-08-22 2020-03-30 Sanabio Llc Soluble interferon receptors and uses thereof
CN109053899B (en) 2017-12-22 2021-11-16 湖南远泰生物技术有限公司 Chimeric antigen receptor containing human transferrin antigen epitope sequence
WO2019154985A1 (en) 2018-02-12 2019-08-15 Biontech Rna Pharmaceuticals Gmbh Treatment using cytokine encoding rna
CA3106858A1 (en) 2018-07-24 2020-01-30 Biontech Rna Pharmaceuticals Gmbh Il2 agonists
JP2022502037A (en) 2018-09-28 2022-01-11 マサチューセッツ インスティテュート オブ テクノロジー Immunomodulatory molecules localized to collagen and their methods
MX2021008081A (en) 2019-01-04 2021-08-05 Resolve Therapeutics Llc Treatment of sjogren's disease with nuclease fusion proteins.
WO2020154032A1 (en) 2019-01-23 2020-07-30 Massachusetts Institute Of Technology Combination immunotherapy dosing regimen for immune checkpoint blockade
BR112021015455A2 (en) 2019-02-08 2021-10-19 Biontech Cell & Gene Therapies Gmbh TREATMENT INVOLVING CAR-DESIGNED T CELLS AND CYTOKINES
AU2020242254A1 (en) 2019-03-18 2020-09-24 Biontech Cell & Gene Therapies Gmbh Lnterleukin-2 receptor (IL2R) and interleukin-2 (IL2) variants for specific activation of immune effector cells
WO2020200481A1 (en) 2019-04-05 2020-10-08 Biontech Rna Pharmaceuticals Gmbh Treatment involving interleukin-2 (il2) and interferon (ifn)
TW202115105A (en) 2019-06-24 2021-04-16 德商拜恩迪克Rna製藥有限公司 Il2 agonists
WO2021058091A1 (en) 2019-09-24 2021-04-01 Biontech Rna Pharmaceuticals Gmbh Treatment involving therapeutic antibody and interleukin-2 (il2)
CA3157509A1 (en) 2019-10-10 2021-04-15 Kodiak Sciences Inc. Methods of treating an eye disorder
WO2021129927A1 (en) 2019-12-23 2021-07-01 Biontech Cell & Gene Therapies Gmbh Treatment with immune effector cells engineered to express an antigen receptor
WO2021129945A1 (en) 2019-12-27 2021-07-01 Biontech Cell & Gene Therapies Gmbh In vitro and in vivo gene delivery to immune effector cells using nanoparticles functionalized with designed ankyrin repeat proteins (darpins)
AU2021238582A1 (en) 2020-03-16 2022-09-22 Biontech Cell & Gene Therapies Gmbh Antigen-specific T cell receptors and T cell epitopes
WO2021197589A1 (en) 2020-03-31 2021-10-07 BioNTech SE Treatment involving non-immunogenic rna for antigen vaccination
EP4171614A1 (en) 2020-06-29 2023-05-03 Resolve Therapeutics, LLC Treatment of sjogren's syndrome with nuclease fusion proteins
WO2022135666A1 (en) 2020-12-21 2022-06-30 BioNTech SE Treatment schedule for cytokine proteins
TW202245808A (en) 2020-12-21 2022-12-01 德商拜恩迪克公司 Therapeutic rna for treating cancer
WO2022135667A1 (en) 2020-12-21 2022-06-30 BioNTech SE Therapeutic rna for treating cancer
WO2022159414A1 (en) 2021-01-22 2022-07-28 University Of Rochester Erythropoietin for gastroinfestinal dysfunction
AU2022256732A1 (en) 2021-04-12 2023-10-19 Biontech Delivery Technologies Gmbh Rna compositions comprising a buffer substance and methods for preparing, storing and using the same
AU2022260466A1 (en) 2021-04-20 2023-11-02 BioNTech SE Virus vaccine
WO2023051926A1 (en) 2021-09-30 2023-04-06 BioNTech SE Treatment involving non-immunogenic rna for antigen vaccination and pd-1 axis binding antagonists
CA3235180A1 (en) 2021-10-21 2023-04-27 BioNTech SE Coronavirus vaccine
CA3234578A1 (en) 2021-10-22 2023-04-27 Advait Vijay Badkar Compositions for administration of different doses of rna
WO2023083434A1 (en) 2021-11-09 2023-05-19 BioNTech SE Rna encoding peptidoglycan hydrolase and use thereof for treating bacterial infection
WO2023126053A1 (en) 2021-12-28 2023-07-06 BioNTech SE Lipid-based formulations for administration of rna
WO2023165681A1 (en) 2022-03-01 2023-09-07 BioNTech SE Rna lipid nanoparticles (lnps) comprising a polyoxazoline and/or polyoxazine polymer
WO2023193892A1 (en) 2022-04-05 2023-10-12 BioNTech SE Nucleic acid compositions comprising an inorganic polyphosphate and methods for preparing, storing and using the same
US11878055B1 (en) 2022-06-26 2024-01-23 BioNTech SE Coronavirus vaccine
WO2024017479A1 (en) 2022-07-21 2024-01-25 BioNTech SE Multifunctional cells transiently expressing an immune receptor and one or more cytokines, their use and methods for their production
WO2024028325A1 (en) 2022-08-01 2024-02-08 BioNTech SE Nucleic acid compositions comprising amphiphilic oligo ethylene glycol (oeg)-conjugated compounds and methods of using such compounds and compositions
WO2024027910A1 (en) 2022-08-03 2024-02-08 BioNTech SE Rna for preventing or treating tuberculosis
WO2024028445A1 (en) 2022-08-03 2024-02-08 BioNTech SE Rna for preventing or treating tuberculosis

Citations (34)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4289689A (en) * 1980-03-14 1981-09-15 Hoffmann-La Roche Inc. Preparation of homogeneous human fibroblast interferon
US4738931A (en) * 1981-02-04 1988-04-19 Juridical Foundation, Japanese Foundation For Cancer Research Human interferon-β gene
US5026651A (en) * 1985-04-25 1991-06-25 Board Of Regents, The University Of Texas System Methods and compositions for the production of human transferrin
US5091513A (en) * 1987-05-21 1992-02-25 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
US5262177A (en) * 1986-02-07 1993-11-16 Oncogen Recombinant viruses encoding the human melanoma-associated antigen
US5432018A (en) * 1990-06-20 1995-07-11 Affymax Technologies N.V. Peptide library and screening systems
US5442043A (en) * 1992-11-27 1995-08-15 Takeda Chemical Industries, Ltd. Peptide conjugate
US5455030A (en) * 1986-09-02 1995-10-03 Enzon Labs, Inc. Immunotheraphy using single chain polypeptide binding molecules
US5464933A (en) * 1993-06-07 1995-11-07 Duke University Synthetic peptide inhibitors of HIV transmission
US5571896A (en) * 1992-04-24 1996-11-05 Baylor College Of Medicine Production of recombinant human lactoferrin
US5571691A (en) * 1989-05-05 1996-11-05 Baylor College Of Medicine Production of recombinant lactoferrin and lactoferrin polypeptides using CDNA sequences in various organisms
US5656272A (en) * 1991-03-18 1997-08-12 New York University Medical Center Methods of treating TNF-α-mediated Crohn's disease using chimeric anti-TNF antibodies
US5672683A (en) * 1989-09-07 1997-09-30 Alkermes, Inc. Transferrin neuropharmaceutical agent fusion protein
US5817789A (en) * 1995-06-06 1998-10-06 Transkaryotic Therapies, Inc. Chimeric proteins for use in transport of a selected substance into cells
US5876969A (en) * 1992-01-31 1999-03-02 Fleer; Reinhard Fusion polypeptides comprising human serum albumin, nucleic acids encoding same, and recombinant expression thereof
US5948613A (en) * 1991-05-31 1999-09-07 The United States Of America As Represented By The Department Of Health And Human Services Methods of screening for risk of cancer using human lactoferrin DNA probe or primer
US5977307A (en) * 1989-09-07 1999-11-02 Alkermes, Inc. Transferrin receptor specific ligand-neuropharmaceutical agent fusion proteins
US5986067A (en) * 1991-02-08 1999-11-16 The University Of Vermont And State Agricultural College Recombinant transferrins, transferrin half-molecules and mutants thereof
US6066469A (en) * 1990-03-08 2000-05-23 Ferro Dynamics, Inc. Cloning, expression, and uses of human lactoferrin
US6069193A (en) * 1996-01-11 2000-05-30 Cornell Research Foundation, Inc. Use of human transferrin in controlling insulin levels
US6174996B1 (en) * 1993-10-19 2001-01-16 University Of Florida Hybrid interferon τ/type I interferon polypeptides
US6245737B1 (en) * 1995-04-27 2001-06-12 The United States Of America As Represented By The Department Of Health And Human Services Conjugates of antiviral proteins or peptides and virus or viral envelope glycoproteins
US6266026B1 (en) * 1998-07-31 2001-07-24 Sti-Co Industries, Inc. Multiple band antenna
US6329336B1 (en) * 1999-05-17 2001-12-11 Conjuchem, Inc. Long lasting insulinotropic peptides
US6348568B1 (en) * 1998-05-20 2002-02-19 Trimeris, Inc. Hybrid polypeptides with enhanced pharmacokinetic properties
US6380362B1 (en) * 1999-12-23 2002-04-30 Genesis Research & Development Corporation Ltd. Polynucleotides, polypeptides expressed by the polynucleotides and methods for their use
US6458924B2 (en) * 1996-08-30 2002-10-01 Novo Nordisk A/S Derivatives of GLP-1 analogs
US20030199672A1 (en) * 1996-08-30 2003-10-23 Knudsen Liselotte Bjerre Derivatives of GLP-1 analogs
US20030221201A1 (en) * 2001-08-30 2003-11-27 Biorexis Pharmaceutical Corporation Modified transferrin fusion proteins
US20030226155A1 (en) * 2001-08-30 2003-12-04 Biorexis Pharmaceutical Corporation Modified transferrin-antibody fusion proteins
US20040023334A1 (en) * 2001-08-30 2004-02-05 Biorexis Pharmaceutical Corporation Modified transferrin fusion proteins
US20060105387A1 (en) * 2002-08-30 2006-05-18 Prior Christopher P Transferrin fusion proteins libraries
US20060130158A1 (en) * 2002-08-30 2006-06-15 Turner Andrew J Modified transferrin fusion proteins comprising duplicate transferrin amino or carboxy terminal domains
US20060205037A1 (en) * 2003-08-28 2006-09-14 Homayoun Sadeghi Modified transferrin fusion proteins

Family Cites Families (78)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB1479283A (en) 1973-07-23 1977-07-13 Bespak Industries Ltd Inhaler for powdered medicament
NL8020393A (en) 1979-10-30 1981-09-01 Riker Laboratories, Inc. Te Loughborough, Groot-Brittannie.
JPS58201794A (en) 1982-05-17 1983-11-24 Toray Ind Inc Purification of human interferon through concentration
US4599311A (en) 1982-08-13 1986-07-08 Kawasaki Glenn H Glycolytic promotersfor regulated protein expression: protease inhibitor
US4462940A (en) 1982-09-23 1984-07-31 Cetus Corporation Process for the recovery of human β-interferon-like polypeptides
US4992271A (en) 1982-09-23 1991-02-12 Cetus Corporation Formulation for lipophilic IL-2 proteins
FI79651C (en) 1982-10-08 1990-02-12 Glaxo Group Ltd Dosing device for medicine
US4588585A (en) 1982-10-19 1986-05-13 Cetus Corporation Human recombinant cysteine depleted interferon-β muteins
US4444683A (en) 1982-11-17 1984-04-24 University Of Utah Glycosylated insulin derivatives
US4816449A (en) 1984-08-09 1989-03-28 Immunetech Pharmaceuticals Immunotherapeutic anti-inflammatory peptide agents
AU600885B2 (en) 1984-05-25 1990-08-30 Zymogenetics Inc. Stable DNA constructs
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
US4683202A (en) 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences
US4980286A (en) 1985-07-05 1990-12-25 Whitehead Institute For Biomedical Research In vivo introduction and expression of foreign genetic material in epithelial cells
DE3681787D1 (en) 1985-07-05 1991-11-07 Whitehead Biomedical Inst EXPRESSION OF FOREIGN GENETIC MATERIAL IN EPITHELIC CELLS.
US4811731A (en) 1985-07-30 1989-03-14 Glaxo Group Limited Devices for administering medicaments to patients
GB8620926D0 (en) 1986-08-29 1986-10-08 Delta Biotechnology Ltd Yeast promoter
HU213344B (en) 1987-04-09 1997-05-28 Delta Biotechnology Ltd Process for producing of stable dezintegrating plasmid-vectors
JP2656944B2 (en) 1987-04-30 1997-09-24 クーパー ラボラトリーズ Aerosolization of protein therapeutics
US4992418A (en) 1987-07-17 1991-02-12 Mount Sinai School Of Medicine Superactive human insulin analogue-[10-Aspartic Acid-B]Human Insulin
DE3852823T2 (en) 1987-09-11 1995-05-24 Whitehead Biomedical Inst TRANSDUCTION-CHANGED FIBROBLASTS AND THEIR USE.
NZ226414A (en) 1987-10-02 1992-07-28 Genentech Inc Cd4 peptide adhesion variants and their preparation and use
GB8726953D0 (en) 1987-11-18 1987-12-23 Delta Biotechnology Ltd Yeast expression system
DE3851153T2 (en) 1987-12-11 1995-01-05 Whitehead Biomedical Inst GENETIC MODIFICATION OF ENDOTHELIAL CELLS.
US6018026A (en) 1988-01-22 2000-01-25 Zymogenetics, Inc. Biologically active dimerized and multimerized polypeptide fusions
WO1989007136A2 (en) 1988-02-05 1989-08-10 Whitehead Institute For Biomedical Research Modified hepatocytes and uses therefor
WO1990001063A1 (en) 1988-07-23 1990-02-08 Delta Biotechnology Limited New secretory leader sequences
GB8820951D0 (en) 1988-09-07 1988-10-05 Delta Biotechnology Ltd Fermentation method
US5260202A (en) 1988-09-07 1993-11-09 Delta Biotechnology Limited Fermentation method
EP0456640A1 (en) 1988-12-13 1991-11-21 UNITED STATES GOVERNMENT as represented by THE SECRETARY OF THE DEPARTMENT OF HEALTH AND HUMAN SERVICES Genetically engineered endothelial cells and use thereof
US5716927A (en) 1988-12-23 1998-02-10 Novo Nordisk A/S Insulin analogs having a modified B-chain
EP0460064A4 (en) 1989-02-23 1992-04-01 Rorer International (Holdings) Inc. Therapeutic aerosol formulations
IL89662A (en) 1989-03-19 1997-11-20 Interpharm Lab Ltd Kiryat Weiz Pharmaceutical compositions comprising interferon-beta
IT1230313B (en) 1989-07-07 1991-10-18 Somova Spa INHALER FOR CAPSULES MEDICATIONS.
GB8927480D0 (en) 1989-12-05 1990-02-07 Delta Biotechnology Ltd Mutant fungal strain detection and new promoter
EP0413662A3 (en) 1989-08-15 1991-10-23 Ciba-Geigy Ag Polyaryleneethers
DE3927170A1 (en) 1989-08-17 1991-02-21 Boehringer Ingelheim Kg INHALATOR
GB8923521D0 (en) 1989-10-18 1989-12-06 Delta Biotechnology Ltd Yeast promoter
US5667986A (en) 1989-10-18 1997-09-16 Delta Biotechnology Limited Yeast promoter for expressing heterologous polypeptides
IT1243344B (en) 1990-07-16 1994-06-10 Promo Pack Sa MULTI-DOSE INHALER FOR POWDER MEDICATIONS
GB9123953D0 (en) 1991-11-12 1992-01-02 Minnesota Mining & Mfg Inhalation device
DE4226971C2 (en) 1992-08-14 1997-01-16 Widmar Prof Dr Tanner Modified fungal cells and processes for the production of recombinant products
US5728553A (en) 1992-09-23 1998-03-17 Delta Biotechnology Limited High purity albumin and method of producing
US5547871A (en) 1993-01-25 1996-08-20 American Cyanamid Company Heterologous signal sequences for secretion of insect controlling proteins
US6024090A (en) 1993-01-29 2000-02-15 Aradigm Corporation Method of treating a diabetic patient by aerosolized administration of insulin lispro
WO1994017810A1 (en) 1993-02-12 1994-08-18 The Wistar Institute Of Anatomy And Biology Recombinant cytomegalovirus vaccine
US5888511A (en) 1993-02-26 1999-03-30 Advanced Biotherapy Concepts, Inc. Treatment of autoimmune diseases, including AIDS
CA2160583A1 (en) 1993-04-16 1994-10-27 Stanley A. Plotkin Recombinant cytomegalovirus vaccine
US6479055B1 (en) 1993-06-07 2002-11-12 Trimeris, Inc. Methods for inhibition of membrane fusion-associated events, including respiratory syncytial virus transmission
EP0792290B1 (en) 1993-09-17 2001-08-29 Novo Nordisk A/S Acylated insulin
US5840707A (en) 1993-10-04 1998-11-24 Albany Medical College Stabilizing and delivery means of biological molecules
GB9404270D0 (en) 1994-03-05 1994-04-20 Delta Biotechnology Ltd Yeast strains and modified albumins
GB9411356D0 (en) 1994-06-07 1994-07-27 Delta Biotechnology Ltd Yeast strains
US5693491A (en) 1994-10-19 1997-12-02 University Of Wyoming Receptor for a Bacillus thuringiensis toxin
US5824638A (en) 1995-05-22 1998-10-20 Shire Laboratories, Inc. Oral insulin delivery
US5681558A (en) 1995-11-30 1997-10-28 Berlex Laboratories, Inc. Method of using beta-interferons to treat restenosis
AU702567B2 (en) 1996-03-13 1999-02-25 Novozymes Biopharma Dk A/S Fermentation control
JP2002511732A (en) 1996-10-11 2002-04-16 ザ・テキサス・エイ・アンド・エム・ユニヴァーシティ・システム Compositions and methods for generating transgenic animals
HU223205B1 (en) 1996-12-03 2004-03-29 Zoltán Dárdai Topical pharmaceutical composition for applicating peptidelike compounds into the living organismus
US6080912A (en) 1997-03-20 2000-06-27 Wisconsin Alumni Research Foundation Methods for creating transgenic animals
GB9713412D0 (en) 1997-06-26 1997-08-27 Delta Biotechnology Ltd Improved protein expression strains
CN1198937C (en) 1998-01-30 2005-04-27 第一三得利制药株式会社 Process for producing peptide with use of accessory peptide
US6281408B1 (en) 1998-02-20 2001-08-28 Thomas Jefferson University Efficient method for production of compound transgenic animals
EP1062240B1 (en) 1998-02-27 2010-04-28 Novo Nordisk A/S N-terminally modified glp-1 derivatives
IL138214A0 (en) 1998-03-09 2001-10-31 Zealand Pharmaceuticals As Pharmacolgically active peptide conjugates having a reduced tendency towards enzymatic hydrolysis
GB9902000D0 (en) 1999-01-30 1999-03-17 Delta Biotechnology Ltd Process
EP1076066A1 (en) 1999-07-12 2001-02-14 Zealand Pharmaceuticals A/S Peptides for lowering blood glucose levels
DE19947456A1 (en) 1999-10-02 2001-04-05 Aventis Pharma Gmbh New synthetic derivatives of the C-peptide of proinsulin, useful in the preparation of human insulin or insulin analogs in high yield
IL149679A0 (en) 1999-11-19 2002-11-10 Transkaryotic Therapies Inc Nucleic acid construct and methods utilizing the same
EP1244701A1 (en) 1999-12-23 2002-10-02 Human Genome Sciences, Inc. Transferrin polynucleotides, polypeptides, and antibodies
US6420346B1 (en) 2000-02-07 2002-07-16 Rappaport Family Institute For Research In The Medical Sciences Polynucleotides encoding MIP-1α, MCP-1, MIP-1β, Rantes and TNF-α, and methods for treating rheumatoid arthritis
EP1276849A4 (en) 2000-04-12 2004-06-09 Human Genome Sciences Inc Albumin fusion proteins
SI1724284T1 (en) 2000-12-07 2009-12-31 Lilly Co Eli GLP-1 fusion proteins
CN1363654A (en) 2001-07-19 2002-08-14 上海华谊生物技术有限公司 Genetically engineered bacteria and process for preparing insulinotropic hormone secretion peptide GLP-1 (7-36)
US20030232761A1 (en) 2002-03-28 2003-12-18 Hinke Simon A. Novel analogues of glucose-dependent insulinotropic polypeptide
AU2003270009A1 (en) 2002-08-30 2004-03-19 Biorexis Pharmaceutical Corporation Oral delivery of modified transferrin fusion proteins
WO2004020588A2 (en) 2002-08-30 2004-03-11 Biorexis Pharmaceutical Corporation Transferrin fusion protein libraries
EP1626981A4 (en) 2003-03-04 2006-11-22 Biorexis Pharmaceutical Corp Dipeptidyl-peptidase protected proteins

Patent Citations (39)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4289689A (en) * 1980-03-14 1981-09-15 Hoffmann-La Roche Inc. Preparation of homogeneous human fibroblast interferon
US4738931A (en) * 1981-02-04 1988-04-19 Juridical Foundation, Japanese Foundation For Cancer Research Human interferon-β gene
US5026651A (en) * 1985-04-25 1991-06-25 Board Of Regents, The University Of Texas System Methods and compositions for the production of human transferrin
US5262177A (en) * 1986-02-07 1993-11-16 Oncogen Recombinant viruses encoding the human melanoma-associated antigen
US5455030A (en) * 1986-09-02 1995-10-03 Enzon Labs, Inc. Immunotheraphy using single chain polypeptide binding molecules
US5518889A (en) * 1986-09-02 1996-05-21 Enzon Labs Inc. Immunoassay methods using single polypeptide chain binding molecules
US5091513A (en) * 1987-05-21 1992-02-25 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
US5571691A (en) * 1989-05-05 1996-11-05 Baylor College Of Medicine Production of recombinant lactoferrin and lactoferrin polypeptides using CDNA sequences in various organisms
US5977307A (en) * 1989-09-07 1999-11-02 Alkermes, Inc. Transferrin receptor specific ligand-neuropharmaceutical agent fusion proteins
US5672683A (en) * 1989-09-07 1997-09-30 Alkermes, Inc. Transferrin neuropharmaceutical agent fusion protein
US6455687B1 (en) * 1990-03-08 2002-09-24 Ferradynamics, Inc Human lactoferrin
US6277817B1 (en) * 1990-03-08 2001-08-21 Ferro Dynamics Inc. Human lactoferrin
US6066469A (en) * 1990-03-08 2000-05-23 Ferro Dynamics, Inc. Cloning, expression, and uses of human lactoferrin
US5432018A (en) * 1990-06-20 1995-07-11 Affymax Technologies N.V. Peptide library and screening systems
US5986067A (en) * 1991-02-08 1999-11-16 The University Of Vermont And State Agricultural College Recombinant transferrins, transferrin half-molecules and mutants thereof
US5656272A (en) * 1991-03-18 1997-08-12 New York University Medical Center Methods of treating TNF-α-mediated Crohn's disease using chimeric anti-TNF antibodies
US5948613A (en) * 1991-05-31 1999-09-07 The United States Of America As Represented By The Department Of Health And Human Services Methods of screening for risk of cancer using human lactoferrin DNA probe or primer
US5876969A (en) * 1992-01-31 1999-03-02 Fleer; Reinhard Fusion polypeptides comprising human serum albumin, nucleic acids encoding same, and recombinant expression thereof
US5571896A (en) * 1992-04-24 1996-11-05 Baylor College Of Medicine Production of recombinant human lactoferrin
US5442043A (en) * 1992-11-27 1995-08-15 Takeda Chemical Industries, Ltd. Peptide conjugate
US5464933A (en) * 1993-06-07 1995-11-07 Duke University Synthetic peptide inhibitors of HIV transmission
US6174996B1 (en) * 1993-10-19 2001-01-16 University Of Florida Hybrid interferon τ/type I interferon polypeptides
US6245737B1 (en) * 1995-04-27 2001-06-12 The United States Of America As Represented By The Department Of Health And Human Services Conjugates of antiviral proteins or peptides and virus or viral envelope glycoproteins
US5817789A (en) * 1995-06-06 1998-10-06 Transkaryotic Therapies, Inc. Chimeric proteins for use in transport of a selected substance into cells
US6027921A (en) * 1995-06-06 2000-02-22 Transkaryotic Therapies, Inc. Chimeric proteins for use in transport of a selected substance into cells and DNA encoding chimeric proteins
US6069193A (en) * 1996-01-11 2000-05-30 Cornell Research Foundation, Inc. Use of human transferrin in controlling insulin levels
US6458924B2 (en) * 1996-08-30 2002-10-01 Novo Nordisk A/S Derivatives of GLP-1 analogs
US20030199672A1 (en) * 1996-08-30 2003-10-23 Knudsen Liselotte Bjerre Derivatives of GLP-1 analogs
US6348568B1 (en) * 1998-05-20 2002-02-19 Trimeris, Inc. Hybrid polypeptides with enhanced pharmacokinetic properties
US6266026B1 (en) * 1998-07-31 2001-07-24 Sti-Co Industries, Inc. Multiple band antenna
US20020049153A1 (en) * 1999-05-17 2002-04-25 BRIDON Dominique P. Long lasting insulinoptropic peptides
US6329336B1 (en) * 1999-05-17 2001-12-11 Conjuchem, Inc. Long lasting insulinotropic peptides
US6380362B1 (en) * 1999-12-23 2002-04-30 Genesis Research & Development Corporation Ltd. Polynucleotides, polypeptides expressed by the polynucleotides and methods for their use
US20030221201A1 (en) * 2001-08-30 2003-11-27 Biorexis Pharmaceutical Corporation Modified transferrin fusion proteins
US20030226155A1 (en) * 2001-08-30 2003-12-04 Biorexis Pharmaceutical Corporation Modified transferrin-antibody fusion proteins
US20040023334A1 (en) * 2001-08-30 2004-02-05 Biorexis Pharmaceutical Corporation Modified transferrin fusion proteins
US20060105387A1 (en) * 2002-08-30 2006-05-18 Prior Christopher P Transferrin fusion proteins libraries
US20060130158A1 (en) * 2002-08-30 2006-06-15 Turner Andrew J Modified transferrin fusion proteins comprising duplicate transferrin amino or carboxy terminal domains
US20060205037A1 (en) * 2003-08-28 2006-09-14 Homayoun Sadeghi Modified transferrin fusion proteins

Cited By (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20070117159A1 (en) * 2000-12-05 2007-05-24 Young John A T Receptor for B. anthracis toxin
US20090275481A1 (en) * 2005-06-17 2009-11-05 Pfizer, Inc. Anchored Transferrin Fusion Protein Libraries
US20110130329A1 (en) * 2005-09-22 2011-06-02 Peter Geigle Glp-1 Fusion Peptides, Their Production and Use
US8431533B2 (en) 2005-09-22 2013-04-30 Biocompatibles Uk Ltd. GLP-1 fusion peptides, their production and use
US8853159B2 (en) 2005-09-22 2014-10-07 Biocompatibles Uk Ltd GLP-1 Fusion Peptides
US20100068289A1 (en) * 2006-05-10 2010-03-18 Biocompatibles Uk Ltd Spherical microcapsules comprising glp-i peptides, their production and use
US8790705B2 (en) 2006-05-10 2014-07-29 Biocompatibles Uk Ltd. Spherical microcapsules comprising GLP-1 peptides, their production and use
US8822639B2 (en) 2006-12-12 2014-09-02 Biorexis Pharmaceutical Corporation Transferrin fusion protein libraries
US20100160556A1 (en) * 2007-03-21 2010-06-24 Christine Wallrapp GLP-1 Fusion Peptides Conjugated to Polymer(s), Their Production and Use
US20110236431A1 (en) * 2008-09-12 2011-09-29 Biocompatibles Uk Ltd. Treatment of acute myocardial infarction (ami) using encapsulated cells encoding and secreting glp-1 peptides or analogs thereof
WO2013043071A1 (en) 2011-09-23 2013-03-28 Technophage, Investigação E Desenvolvimento Em Biotecnologia, Sa Modified albumin-binding domains and uses thereof to improve pharmacokinetics

Also Published As

Publication number Publication date
DK1611093T3 (en) 2015-09-28
WO2004020405A2 (en) 2004-03-11
IL166750A0 (en) 2006-01-15
EP1611093B1 (en) 2015-07-15
EP1611093A4 (en) 2006-06-28
ES2547925T3 (en) 2015-10-09
AU2003268208B2 (en) 2009-04-23
BR0314092A (en) 2006-03-28
US20070066813A1 (en) 2007-03-22
AU2003268208A1 (en) 2004-03-19
US20030221201A1 (en) 2003-11-27
CA2495210A1 (en) 2004-03-11
EP1611093A2 (en) 2006-01-04
US7176278B2 (en) 2007-02-13
WO2004020405A3 (en) 2005-09-01

Similar Documents

Publication Publication Date Title
US7176278B2 (en) Modified transferrin fusion proteins
AU2009202932B2 (en) Modified transferrin fusion proteins
US20060205037A1 (en) Modified transferrin fusion proteins
US10799565B2 (en) Cholix toxin-derived fusion molecules for oral delivery of biologically active cargo
JP2008531059A (en) Modified transferrin fusion protein
WO2004019872A2 (en) Oral delivery of modified transferrin fusion proteins
US20070060512A1 (en) Dipeptidyl-peptidase protected protein
US20130053315A1 (en) Novel glp-1 derivatives
MXPA04001804A (en) Modified transferrin fusion proteins.
AU2005271403A1 (en) Combination therapy using transferrin fusion proteins comprising GLP-1
WO2004078777A2 (en) Dipeptidyl-peptidase protected proteins
US20190388520A1 (en) Compositions and Methods for Oral Delivery of Therapeutic Cargo
US20220226445A1 (en) Cholix toxin-derived fusion molecules for oral delivery of biologically active cargo
US8129504B2 (en) Oral delivery of modified transferrin fusion proteins
US11752216B2 (en) Insulin analog complex with reduced affinity for insulin receptor and use thereof
WO2006049983A2 (en) Peptide yy modified transferrin fusion proteins
US20060269514A1 (en) Methods and compositions for the modulation of immune responses and cancer diseases
WO2008021412A2 (en) Interferon beta and transferrin fusion proteins

Legal Events

Date Code Title Description
STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION