US20070269428A1 - Method for the Treatment of Multiple Sclerosis by Inhibiting Il-17 Activity - Google Patents
Method for the Treatment of Multiple Sclerosis by Inhibiting Il-17 Activity Download PDFInfo
- Publication number
- US20070269428A1 US20070269428A1 US10/580,164 US58016404A US2007269428A1 US 20070269428 A1 US20070269428 A1 US 20070269428A1 US 58016404 A US58016404 A US 58016404A US 2007269428 A1 US2007269428 A1 US 2007269428A1
- Authority
- US
- United States
- Prior art keywords
- antibody
- disease
- fab
- activity
- antibodies
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 238000000034 method Methods 0.000 title claims abstract description 78
- 230000000694 effects Effects 0.000 title claims abstract description 55
- 201000006417 multiple sclerosis Diseases 0.000 title claims abstract description 49
- 238000011282 treatment Methods 0.000 title claims abstract description 23
- 230000002401 inhibitory effect Effects 0.000 title description 4
- 102000013691 Interleukin-17 Human genes 0.000 claims abstract description 118
- 108050003558 Interleukin-17 Proteins 0.000 claims abstract description 118
- 239000003112 inhibitor Substances 0.000 claims abstract description 46
- 238000011321 prophylaxis Methods 0.000 claims abstract description 16
- 102000053460 interleukin-17 receptor activity proteins Human genes 0.000 claims description 49
- 108040001304 interleukin-17 receptor activity proteins Proteins 0.000 claims description 49
- 108020004707 nucleic acids Proteins 0.000 claims description 39
- 102000039446 nucleic acids Human genes 0.000 claims description 39
- 150000007523 nucleic acids Chemical group 0.000 claims description 39
- 239000012634 fragment Substances 0.000 claims description 21
- 102000008394 Immunoglobulin Fragments Human genes 0.000 claims description 17
- 108010021625 Immunoglobulin Fragments Proteins 0.000 claims description 17
- 239000012636 effector Substances 0.000 claims description 11
- 150000001875 compounds Chemical class 0.000 claims description 8
- 150000003384 small molecules Chemical group 0.000 claims description 5
- 108090000765 processed proteins & peptides Proteins 0.000 description 66
- 102000004196 processed proteins & peptides Human genes 0.000 description 63
- 229920001184 polypeptide Polymers 0.000 description 60
- 239000003795 chemical substances by application Substances 0.000 description 56
- 201000010099 disease Diseases 0.000 description 55
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 55
- 229920001223 polyethylene glycol Polymers 0.000 description 48
- 239000012071 phase Substances 0.000 description 43
- 235000018417 cysteine Nutrition 0.000 description 29
- 108090000623 proteins and genes Proteins 0.000 description 29
- 239000002202 Polyethylene glycol Substances 0.000 description 26
- 239000003814 drug Substances 0.000 description 24
- 230000001154 acute effect Effects 0.000 description 21
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 21
- 210000004027 cell Anatomy 0.000 description 20
- 102000004169 proteins and genes Human genes 0.000 description 19
- -1 DNA and RNA) Chemical class 0.000 description 18
- 235000018102 proteins Nutrition 0.000 description 18
- 230000009467 reduction Effects 0.000 description 17
- 238000006722 reduction reaction Methods 0.000 description 17
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 15
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 15
- 230000001186 cumulative effect Effects 0.000 description 15
- 239000008194 pharmaceutical composition Substances 0.000 description 15
- 206010033799 Paralysis Diseases 0.000 description 14
- 241001529936 Murinae Species 0.000 description 13
- 238000004458 analytical method Methods 0.000 description 13
- 229940079593 drug Drugs 0.000 description 13
- 239000013543 active substance Substances 0.000 description 12
- 239000000203 mixture Substances 0.000 description 12
- 241001465754 Metazoa Species 0.000 description 11
- 241000699670 Mus sp. Species 0.000 description 11
- 238000003556 assay Methods 0.000 description 11
- 239000003638 chemical reducing agent Substances 0.000 description 11
- 238000001415 gene therapy Methods 0.000 description 11
- 238000004519 manufacturing process Methods 0.000 description 10
- 102000004554 Interleukin-17 Receptors Human genes 0.000 description 9
- 108010017525 Interleukin-17 Receptors Proteins 0.000 description 9
- 238000000585 Mann–Whitney U test Methods 0.000 description 9
- 241000283973 Oryctolagus cuniculus Species 0.000 description 8
- 230000000692 anti-sense effect Effects 0.000 description 8
- 150000001945 cysteines Chemical class 0.000 description 8
- 201000002491 encephalomyelitis Diseases 0.000 description 8
- 239000007788 liquid Substances 0.000 description 8
- 229920000642 polymer Polymers 0.000 description 8
- 239000000243 solution Substances 0.000 description 8
- 208000024891 symptom Diseases 0.000 description 8
- 238000002560 therapeutic procedure Methods 0.000 description 8
- 102000004127 Cytokines Human genes 0.000 description 7
- 108090000695 Cytokines Proteins 0.000 description 7
- 102000004889 Interleukin-6 Human genes 0.000 description 7
- 108090001005 Interleukin-6 Proteins 0.000 description 7
- 241000699666 Mus <mouse, genus> Species 0.000 description 7
- 239000006071 cream Substances 0.000 description 7
- 229940100601 interleukin-6 Drugs 0.000 description 7
- 102000005962 receptors Human genes 0.000 description 7
- 108020003175 receptors Proteins 0.000 description 7
- 239000003826 tablet Substances 0.000 description 7
- 230000001225 therapeutic effect Effects 0.000 description 7
- 230000004580 weight loss Effects 0.000 description 7
- 108020004414 DNA Proteins 0.000 description 6
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 6
- 108010083674 Myelin Proteins Proteins 0.000 description 6
- 102000006386 Myelin Proteins Human genes 0.000 description 6
- 239000002674 ointment Substances 0.000 description 6
- 230000002829 reductive effect Effects 0.000 description 6
- 239000000725 suspension Substances 0.000 description 6
- 108060003951 Immunoglobulin Proteins 0.000 description 5
- 241000124008 Mammalia Species 0.000 description 5
- PZBFGYYEXUXCOF-UHFFFAOYSA-N TCEP Chemical compound OC(=O)CCP(CCC(O)=O)CCC(O)=O PZBFGYYEXUXCOF-UHFFFAOYSA-N 0.000 description 5
- 239000000427 antigen Substances 0.000 description 5
- 108091007433 antigens Proteins 0.000 description 5
- 102000036639 antigens Human genes 0.000 description 5
- 238000013459 approach Methods 0.000 description 5
- 239000000969 carrier Substances 0.000 description 5
- 210000002950 fibroblast Anatomy 0.000 description 5
- 102000018358 immunoglobulin Human genes 0.000 description 5
- 238000002347 injection Methods 0.000 description 5
- 239000007924 injection Substances 0.000 description 5
- 230000003993 interaction Effects 0.000 description 5
- 210000005012 myelin Anatomy 0.000 description 5
- 239000000843 powder Substances 0.000 description 5
- 238000002360 preparation method Methods 0.000 description 5
- 239000007787 solid Substances 0.000 description 5
- 239000002904 solvent Substances 0.000 description 5
- 238000012360 testing method Methods 0.000 description 5
- 150000003573 thiols Chemical class 0.000 description 5
- 210000001519 tissue Anatomy 0.000 description 5
- 239000013598 vector Substances 0.000 description 5
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 4
- 108020004705 Codon Proteins 0.000 description 4
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 4
- 238000000729 Fisher's exact test Methods 0.000 description 4
- RJURFGZVJUQBHK-UHFFFAOYSA-N actinomycin D Natural products CC1OC(=O)C(C(C)C)N(C)C(=O)CN(C)C(=O)C2CCCN2C(=O)C(C(C)C)NC(=O)C1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)NC4C(=O)NC(C(N5CCCC5C(=O)N(C)CC(=O)N(C)C(C(C)C)C(=O)OC4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-UHFFFAOYSA-N 0.000 description 4
- 239000002775 capsule Substances 0.000 description 4
- 238000000423 cell based assay Methods 0.000 description 4
- 239000003937 drug carrier Substances 0.000 description 4
- 238000012377 drug delivery Methods 0.000 description 4
- 238000002474 experimental method Methods 0.000 description 4
- 238000001727 in vivo Methods 0.000 description 4
- 230000006698 induction Effects 0.000 description 4
- 238000001802 infusion Methods 0.000 description 4
- 230000005764 inhibitory process Effects 0.000 description 4
- 229940047124 interferons Drugs 0.000 description 4
- 230000001404 mediated effect Effects 0.000 description 4
- 108020004999 messenger RNA Proteins 0.000 description 4
- 239000002773 nucleotide Substances 0.000 description 4
- 125000003729 nucleotide group Chemical group 0.000 description 4
- 239000003921 oil Substances 0.000 description 4
- 238000012552 review Methods 0.000 description 4
- YICAEXQYKBMDNH-UHFFFAOYSA-N 3-[bis(3-hydroxypropyl)phosphanyl]propan-1-ol Chemical compound OCCCP(CCCO)CCCO YICAEXQYKBMDNH-UHFFFAOYSA-N 0.000 description 3
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 3
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 3
- 208000032116 Autoimmune Experimental Encephalomyelitis Diseases 0.000 description 3
- 102100023995 Beta-nerve growth factor Human genes 0.000 description 3
- 108010092160 Dactinomycin Proteins 0.000 description 3
- 208000016192 Demyelinating disease Diseases 0.000 description 3
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 3
- 238000002965 ELISA Methods 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 102000004269 Granulocyte Colony-Stimulating Factor Human genes 0.000 description 3
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 description 3
- 241000282412 Homo Species 0.000 description 3
- 101000998146 Homo sapiens Interleukin-17A Proteins 0.000 description 3
- 206010021639 Incontinence Diseases 0.000 description 3
- 108010005716 Interferon beta-1a Proteins 0.000 description 3
- 102000000589 Interleukin-1 Human genes 0.000 description 3
- 108010002352 Interleukin-1 Proteins 0.000 description 3
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 3
- 108010025020 Nerve Growth Factor Proteins 0.000 description 3
- MUBZPKHOEPUJKR-UHFFFAOYSA-N Oxalic acid Chemical compound OC(=O)C(O)=O MUBZPKHOEPUJKR-UHFFFAOYSA-N 0.000 description 3
- 241000700159 Rattus Species 0.000 description 3
- 108020004511 Recombinant DNA Proteins 0.000 description 3
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 3
- 210000001744 T-lymphocyte Anatomy 0.000 description 3
- 239000002671 adjuvant Substances 0.000 description 3
- 125000003275 alpha amino acid group Chemical group 0.000 description 3
- 235000001014 amino acid Nutrition 0.000 description 3
- 150000001413 amino acids Chemical class 0.000 description 3
- 238000010171 animal model Methods 0.000 description 3
- 239000002246 antineoplastic agent Substances 0.000 description 3
- 210000003719 b-lymphocyte Anatomy 0.000 description 3
- 230000015572 biosynthetic process Effects 0.000 description 3
- 210000004369 blood Anatomy 0.000 description 3
- 239000008280 blood Substances 0.000 description 3
- 210000000601 blood cell Anatomy 0.000 description 3
- 210000003169 central nervous system Anatomy 0.000 description 3
- 230000008859 change Effects 0.000 description 3
- 230000001684 chronic effect Effects 0.000 description 3
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- 230000000295 complement effect Effects 0.000 description 3
- 239000002299 complementary DNA Substances 0.000 description 3
- 231100000599 cytotoxic agent Toxicity 0.000 description 3
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 3
- 230000003111 delayed effect Effects 0.000 description 3
- 208000012997 experimental autoimmune encephalomyelitis Diseases 0.000 description 3
- 210000003414 extremity Anatomy 0.000 description 3
- 238000000684 flow cytometry Methods 0.000 description 3
- 108020001507 fusion proteins Proteins 0.000 description 3
- 102000037865 fusion proteins Human genes 0.000 description 3
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 3
- 208000010726 hind limb paralysis Diseases 0.000 description 3
- 230000001965 increasing effect Effects 0.000 description 3
- 230000002757 inflammatory effect Effects 0.000 description 3
- 230000003902 lesion Effects 0.000 description 3
- 150000002632 lipids Chemical class 0.000 description 3
- 210000004698 lymphocyte Anatomy 0.000 description 3
- 210000002540 macrophage Anatomy 0.000 description 3
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 description 3
- 238000002703 mutagenesis Methods 0.000 description 3
- 231100000350 mutagenesis Toxicity 0.000 description 3
- 229940053128 nerve growth factor Drugs 0.000 description 3
- 230000003472 neutralizing effect Effects 0.000 description 3
- 210000004248 oligodendroglia Anatomy 0.000 description 3
- 230000036961 partial effect Effects 0.000 description 3
- 238000011084 recovery Methods 0.000 description 3
- 230000001177 retroviral effect Effects 0.000 description 3
- 230000028527 righting reflex Effects 0.000 description 3
- 201000008628 secondary progressive multiple sclerosis Diseases 0.000 description 3
- 230000028327 secretion Effects 0.000 description 3
- 210000003491 skin Anatomy 0.000 description 3
- 210000000130 stem cell Anatomy 0.000 description 3
- 125000003396 thiol group Chemical group [H]S* 0.000 description 3
- 238000011200 topical administration Methods 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- 108010088751 Albumins Proteins 0.000 description 2
- 102000009027 Albumins Human genes 0.000 description 2
- 108010001857 Cell Surface Receptors Proteins 0.000 description 2
- 102000000844 Cell Surface Receptors Human genes 0.000 description 2
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 2
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 2
- 206010012305 Demyelination Diseases 0.000 description 2
- 108091006020 Fc-tagged proteins Proteins 0.000 description 2
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 2
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 2
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 2
- 206010061218 Inflammation Diseases 0.000 description 2
- 108010005714 Interferon beta-1b Proteins 0.000 description 2
- 102100033461 Interleukin-17A Human genes 0.000 description 2
- 108010002350 Interleukin-2 Proteins 0.000 description 2
- 102000000588 Interleukin-2 Human genes 0.000 description 2
- 108090001007 Interleukin-8 Proteins 0.000 description 2
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 2
- GQYIWUVLTXOXAJ-UHFFFAOYSA-N Lomustine Chemical compound ClCCN(N=O)C(=O)NC1CCCCC1 GQYIWUVLTXOXAJ-UHFFFAOYSA-N 0.000 description 2
- SEQKRHFRPICQDD-UHFFFAOYSA-N N-tris(hydroxymethyl)methylglycine Chemical compound OCC(CO)(CO)[NH2+]CC([O-])=O SEQKRHFRPICQDD-UHFFFAOYSA-N 0.000 description 2
- 229910019142 PO4 Inorganic materials 0.000 description 2
- 241001494479 Pecora Species 0.000 description 2
- 239000004365 Protease Substances 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 238000000692 Student's t-test Methods 0.000 description 2
- 241000282887 Suidae Species 0.000 description 2
- VGQOVCHZGQWAOI-UHFFFAOYSA-N UNPD55612 Natural products N1C(O)C2CC(C=CC(N)=O)=CN2C(=O)C2=CC=C(C)C(O)=C12 VGQOVCHZGQWAOI-UHFFFAOYSA-N 0.000 description 2
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 2
- RJURFGZVJUQBHK-IIXSONLDSA-N actinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-IIXSONLDSA-N 0.000 description 2
- 238000012382 advanced drug delivery Methods 0.000 description 2
- 238000001042 affinity chromatography Methods 0.000 description 2
- VGQOVCHZGQWAOI-HYUHUPJXSA-N anthramycin Chemical compound N1[C@@H](O)[C@@H]2CC(\C=C\C(N)=O)=CN2C(=O)C2=CC=C(C)C(O)=C12 VGQOVCHZGQWAOI-HYUHUPJXSA-N 0.000 description 2
- 230000000890 antigenic effect Effects 0.000 description 2
- 210000003050 axon Anatomy 0.000 description 2
- 230000003376 axonal effect Effects 0.000 description 2
- 239000011324 bead Substances 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 230000008512 biological response Effects 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 150000001720 carbohydrates Chemical class 0.000 description 2
- 235000014633 carbohydrates Nutrition 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 239000012050 conventional carrier Substances 0.000 description 2
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 2
- 229940127089 cytotoxic agent Drugs 0.000 description 2
- 239000002254 cytotoxic agent Substances 0.000 description 2
- 229960000640 dactinomycin Drugs 0.000 description 2
- 229960000975 daunorubicin Drugs 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- CFCUWKMKBJTWLW-UHFFFAOYSA-N deoliosyl-3C-alpha-L-digitoxosyl-MTM Natural products CC=1C(O)=C2C(O)=C3C(=O)C(OC4OC(C)C(O)C(OC5OC(C)C(O)C(OC6OC(C)C(O)C(C)(O)C6)C5)C4)C(C(OC)C(=O)C(O)C(C)O)CC3=CC2=CC=1OC(OC(C)C1O)CC1OC1CC(O)C(O)C(C)O1 CFCUWKMKBJTWLW-UHFFFAOYSA-N 0.000 description 2
- 239000006185 dispersion Substances 0.000 description 2
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 2
- 229960004679 doxorubicin Drugs 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 210000002889 endothelial cell Anatomy 0.000 description 2
- 210000002919 epithelial cell Anatomy 0.000 description 2
- 239000013604 expression vector Substances 0.000 description 2
- OVBPIULPVIDEAO-LBPRGKRZSA-N folic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-LBPRGKRZSA-N 0.000 description 2
- 239000008187 granular material Substances 0.000 description 2
- 210000004408 hybridoma Anatomy 0.000 description 2
- 230000001900 immune effect Effects 0.000 description 2
- 229960003444 immunosuppressant agent Drugs 0.000 description 2
- 230000001861 immunosuppressant effect Effects 0.000 description 2
- 239000003018 immunosuppressive agent Substances 0.000 description 2
- 239000007943 implant Substances 0.000 description 2
- 230000006872 improvement Effects 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 230000004054 inflammatory process Effects 0.000 description 2
- 239000004615 ingredient Substances 0.000 description 2
- 210000002510 keratinocyte Anatomy 0.000 description 2
- 239000008101 lactose Substances 0.000 description 2
- 239000003446 ligand Substances 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 230000007774 longterm Effects 0.000 description 2
- 239000006210 lotion Substances 0.000 description 2
- 239000000314 lubricant Substances 0.000 description 2
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 2
- 229920001427 mPEG Polymers 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 125000005439 maleimidyl group Chemical group C1(C=CC(N1*)=O)=O 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 230000010534 mechanism of action Effects 0.000 description 2
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 2
- 239000011859 microparticle Substances 0.000 description 2
- CFCUWKMKBJTWLW-BKHRDMLASA-N mithramycin Chemical compound O([C@@H]1C[C@@H](O[C@H](C)[C@H]1O)OC=1C=C2C=C3C[C@H]([C@@H](C(=O)C3=C(O)C2=C(O)C=1C)O[C@@H]1O[C@H](C)[C@@H](O)[C@H](O[C@@H]2O[C@H](C)[C@H](O)[C@H](O[C@@H]3O[C@H](C)[C@@H](O)[C@@](C)(O)C3)C2)C1)[C@H](OC)C(=O)[C@@H](O)[C@@H](C)O)[C@H]1C[C@@H](O)[C@H](O)[C@@H](C)O1 CFCUWKMKBJTWLW-BKHRDMLASA-N 0.000 description 2
- 229960004857 mitomycin Drugs 0.000 description 2
- 229960001156 mitoxantrone Drugs 0.000 description 2
- 238000012544 monitoring process Methods 0.000 description 2
- 210000003007 myelin sheath Anatomy 0.000 description 2
- 230000004770 neurodegeneration Effects 0.000 description 2
- 210000000440 neutrophil Anatomy 0.000 description 2
- 230000003204 osmotic effect Effects 0.000 description 2
- 230000006320 pegylation Effects 0.000 description 2
- 239000000816 peptidomimetic Substances 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- 229960003171 plicamycin Drugs 0.000 description 2
- 229920001282 polysaccharide Polymers 0.000 description 2
- 239000005017 polysaccharide Substances 0.000 description 2
- 239000003755 preservative agent Substances 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 230000000750 progressive effect Effects 0.000 description 2
- 230000000770 proinflammatory effect Effects 0.000 description 2
- 230000035755 proliferation Effects 0.000 description 2
- 230000000069 prophylactic effect Effects 0.000 description 2
- AQHHHDLHHXJYJD-UHFFFAOYSA-N propranolol Chemical compound C1=CC=C2C(OCC(O)CNC(C)C)=CC=CC2=C1 AQHHHDLHHXJYJD-UHFFFAOYSA-N 0.000 description 2
- RXWNCPJZOCPEPQ-NVWDDTSBSA-N puromycin Chemical compound C1=CC(OC)=CC=C1C[C@H](N)C(=O)N[C@H]1[C@@H](O)[C@H](N2C3=NC=NC(=C3N=C2)N(C)C)O[C@@H]1CO RXWNCPJZOCPEPQ-NVWDDTSBSA-N 0.000 description 2
- 238000007493 shaping process Methods 0.000 description 2
- 239000000600 sorbitol Substances 0.000 description 2
- 235000010356 sorbitol Nutrition 0.000 description 2
- 210000000278 spinal cord Anatomy 0.000 description 2
- 238000010561 standard procedure Methods 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 238000006467 substitution reaction Methods 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- 239000000829 suppository Substances 0.000 description 2
- 239000000375 suspending agent Substances 0.000 description 2
- 229920001059 synthetic polymer Polymers 0.000 description 2
- 239000006188 syrup Substances 0.000 description 2
- 235000020357 syrup Nutrition 0.000 description 2
- WYWHKKSPHMUBEB-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 2
- 239000003053 toxin Substances 0.000 description 2
- 231100000765 toxin Toxicity 0.000 description 2
- 108700012359 toxins Proteins 0.000 description 2
- 230000014616 translation Effects 0.000 description 2
- DZQQRNFLQBSVBN-UHFFFAOYSA-N tri(butan-2-yl)phosphane Chemical compound CCC(C)P(C(C)CC)C(C)CC DZQQRNFLQBSVBN-UHFFFAOYSA-N 0.000 description 2
- 229960003048 vinblastine Drugs 0.000 description 2
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 2
- 229960004528 vincristine Drugs 0.000 description 2
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 2
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 2
- 239000013603 viral vector Substances 0.000 description 2
- 230000003442 weekly effect Effects 0.000 description 2
- VKZRWSNIWNFCIQ-WDSKDSINSA-N (2s)-2-[2-[[(1s)-1,2-dicarboxyethyl]amino]ethylamino]butanedioic acid Chemical compound OC(=O)C[C@@H](C(O)=O)NCCN[C@H](C(O)=O)CC(O)=O VKZRWSNIWNFCIQ-WDSKDSINSA-N 0.000 description 1
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 1
- ALSTYHKOOCGGFT-KTKRTIGZSA-N (9Z)-octadecen-1-ol Chemical compound CCCCCCCC\C=C/CCCCCCCCO ALSTYHKOOCGGFT-KTKRTIGZSA-N 0.000 description 1
- FDKXTQMXEQVLRF-ZHACJKMWSA-N (E)-dacarbazine Chemical compound CN(C)\N=N\c1[nH]cnc1C(N)=O FDKXTQMXEQVLRF-ZHACJKMWSA-N 0.000 description 1
- IAKHMKGGTNLKSZ-INIZCTEOSA-N (S)-colchicine Chemical compound C1([C@@H](NC(C)=O)CC2)=CC(=O)C(OC)=CC=C1C1=C2C=C(OC)C(OC)=C1OC IAKHMKGGTNLKSZ-INIZCTEOSA-N 0.000 description 1
- WUAPFZMCVAUBPE-NJFSPNSNSA-N 188Re Chemical compound [188Re] WUAPFZMCVAUBPE-NJFSPNSNSA-N 0.000 description 1
- 150000003923 2,5-pyrrolediones Chemical class 0.000 description 1
- PZIJUXHDLWNNRW-UHFFFAOYSA-N 2-[bis(2-hydroxyethyl)phosphanyl]ethanol Chemical compound OCCP(CCO)CCO PZIJUXHDLWNNRW-UHFFFAOYSA-N 0.000 description 1
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- CHZAMJVESILJGH-UHFFFAOYSA-N 3-[bis(2-cyanoethyl)phosphanyl]propanenitrile Chemical compound N#CCCP(CCC#N)CCC#N CHZAMJVESILJGH-UHFFFAOYSA-N 0.000 description 1
- 239000007988 ADA buffer Substances 0.000 description 1
- 108010066676 Abrin Proteins 0.000 description 1
- 229920000856 Amylose Polymers 0.000 description 1
- 102000012936 Angiostatins Human genes 0.000 description 1
- 108010079709 Angiostatins Proteins 0.000 description 1
- 108020005544 Antisense RNA Proteins 0.000 description 1
- 241000416162 Astragalus gummifer Species 0.000 description 1
- 206010003591 Ataxia Diseases 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 108010006654 Bleomycin Proteins 0.000 description 1
- 201000004569 Blindness Diseases 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 1
- 102100021943 C-C motif chemokine 2 Human genes 0.000 description 1
- 101710155857 C-C motif chemokine 2 Proteins 0.000 description 1
- 101100136727 Caenorhabditis elegans psd-1 gene Proteins 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 206010048610 Cardiotoxicity Diseases 0.000 description 1
- DLGOEMSEDOSKAD-UHFFFAOYSA-N Carmustine Chemical compound ClCCNC(=O)N(N=O)CCCl DLGOEMSEDOSKAD-UHFFFAOYSA-N 0.000 description 1
- 241000700198 Cavia Species 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 108091026890 Coding region Proteins 0.000 description 1
- 108020004635 Complementary DNA Proteins 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- FCKYPQBAHLOOJQ-UHFFFAOYSA-N Cyclohexane-1,2-diaminetetraacetic acid Chemical compound OC(=O)CN(CC(O)=O)C1CCCCC1N(CC(O)=O)CC(O)=O FCKYPQBAHLOOJQ-UHFFFAOYSA-N 0.000 description 1
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 229940123780 DNA topoisomerase I inhibitor Drugs 0.000 description 1
- WEAHRLBPCANXCN-UHFFFAOYSA-N Daunomycin Natural products CCC1(O)CC(OC2CC(N)C(O)C(C)O2)c3cc4C(=O)c5c(OC)cccc5C(=O)c4c(O)c3C1 WEAHRLBPCANXCN-UHFFFAOYSA-N 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 108010053187 Diphtheria Toxin Proteins 0.000 description 1
- 102000016607 Diphtheria Toxin Human genes 0.000 description 1
- MBYXEBXZARTUSS-QLWBXOBMSA-N Emetamine Natural products O(C)c1c(OC)cc2c(c(C[C@@H]3[C@H](CC)CN4[C@H](c5c(cc(OC)c(OC)c5)CC4)C3)ncc2)c1 MBYXEBXZARTUSS-QLWBXOBMSA-N 0.000 description 1
- 102400001047 Endostatin Human genes 0.000 description 1
- 108010079505 Endostatins Proteins 0.000 description 1
- 241000792859 Enema Species 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 241001302584 Escherichia coli str. K-12 substr. W3110 Species 0.000 description 1
- 208000009386 Experimental Arthritis Diseases 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 108010072051 Glatiramer Acetate Proteins 0.000 description 1
- 206010061431 Glial scar Diseases 0.000 description 1
- 206010018341 Gliosis Diseases 0.000 description 1
- 108010024636 Glutathione Proteins 0.000 description 1
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 1
- 229920002527 Glycogen Polymers 0.000 description 1
- 108010026389 Gramicidin Proteins 0.000 description 1
- 206010019233 Headaches Diseases 0.000 description 1
- 102100031573 Hematopoietic progenitor cell antigen CD34 Human genes 0.000 description 1
- 101000777663 Homo sapiens Hematopoietic progenitor cell antigen CD34 Proteins 0.000 description 1
- 229920002153 Hydroxypropyl cellulose Polymers 0.000 description 1
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 1
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 1
- 108010064593 Intercellular Adhesion Molecule-1 Proteins 0.000 description 1
- 102100037877 Intercellular adhesion molecule 1 Human genes 0.000 description 1
- 102100037850 Interferon gamma Human genes 0.000 description 1
- 102000006992 Interferon-alpha Human genes 0.000 description 1
- 108010047761 Interferon-alpha Proteins 0.000 description 1
- 108090000467 Interferon-beta Proteins 0.000 description 1
- 102000003996 Interferon-beta Human genes 0.000 description 1
- 108010074328 Interferon-gamma Proteins 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- 235000010643 Leucaena leucocephala Nutrition 0.000 description 1
- 240000007472 Leucaena leucocephala Species 0.000 description 1
- NNJVILVZKWQKPM-UHFFFAOYSA-N Lidocaine Chemical compound CCN(CC)CC(=O)NC1=C(C)C=CC=C1C NNJVILVZKWQKPM-UHFFFAOYSA-N 0.000 description 1
- 102000043131 MHC class II family Human genes 0.000 description 1
- 108091054438 MHC class II family Proteins 0.000 description 1
- 235000019759 Maize starch Nutrition 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- VFKZTMPDYBFSTM-KVTDHHQDSA-N Mitobronitol Chemical compound BrC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CBr VFKZTMPDYBFSTM-KVTDHHQDSA-N 0.000 description 1
- 229930192392 Mitomycin Natural products 0.000 description 1
- 241000699660 Mus musculus Species 0.000 description 1
- 241000186359 Mycobacterium Species 0.000 description 1
- FSVCELGFZIQNCK-UHFFFAOYSA-N N,N-bis(2-hydroxyethyl)glycine Chemical compound OCCN(CCO)CC(O)=O FSVCELGFZIQNCK-UHFFFAOYSA-N 0.000 description 1
- QPCDCPDFJACHGM-UHFFFAOYSA-N N,N-bis{2-[bis(carboxymethyl)amino]ethyl}glycine Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(=O)O)CCN(CC(O)=O)CC(O)=O QPCDCPDFJACHGM-UHFFFAOYSA-N 0.000 description 1
- OVBPIULPVIDEAO-UHFFFAOYSA-N N-Pteroyl-L-glutaminsaeure Natural products C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)NC(CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-UHFFFAOYSA-N 0.000 description 1
- 238000005481 NMR spectroscopy Methods 0.000 description 1
- 108091061960 Naked DNA Proteins 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 208000012902 Nervous system disease Diseases 0.000 description 1
- 108091092724 Noncoding DNA Proteins 0.000 description 1
- 238000000636 Northern blotting Methods 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- 229930012538 Paclitaxel Natural products 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 108010067902 Peptide Library Proteins 0.000 description 1
- 206010034650 Peritoneal adhesions Diseases 0.000 description 1
- 108010081690 Pertussis Toxin Proteins 0.000 description 1
- 108010053210 Phycocyanin Proteins 0.000 description 1
- 108010004729 Phycoerythrin Proteins 0.000 description 1
- 108010038512 Platelet-Derived Growth Factor Proteins 0.000 description 1
- 102000010780 Platelet-Derived Growth Factor Human genes 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 101000762949 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) Exotoxin A Proteins 0.000 description 1
- 108010039491 Ricin Proteins 0.000 description 1
- AUVVAXYIELKVAI-UHFFFAOYSA-N SJ000285215 Natural products N1CCC2=CC(OC)=C(OC)C=C2C1CC1CC2C3=CC(OC)=C(OC)C=C3CCN2CC1CC AUVVAXYIELKVAI-UHFFFAOYSA-N 0.000 description 1
- 108020004459 Small interfering RNA Proteins 0.000 description 1
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 1
- 239000004141 Sodium laurylsulphate Substances 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- ZSJLQEPLLKMAKR-UHFFFAOYSA-N Streptozotocin Natural products O=NN(C)C(=O)NC1C(O)OC(CO)C(O)C1O ZSJLQEPLLKMAKR-UHFFFAOYSA-N 0.000 description 1
- UZMAPBJVXOGOFT-UHFFFAOYSA-N Syringetin Natural products COC1=C(O)C(OC)=CC(C2=C(C(=O)C3=C(O)C=C(O)C=C3O2)O)=C1 UZMAPBJVXOGOFT-UHFFFAOYSA-N 0.000 description 1
- 210000000447 Th1 cell Anatomy 0.000 description 1
- 102000003978 Tissue Plasminogen Activator Human genes 0.000 description 1
- 108090000373 Tissue Plasminogen Activator Proteins 0.000 description 1
- 239000000365 Topoisomerase I Inhibitor Substances 0.000 description 1
- 229920001615 Tragacanth Polymers 0.000 description 1
- 206010052779 Transplant rejections Diseases 0.000 description 1
- 239000007997 Tricine buffer Substances 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 1
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 1
- 108050007852 Tumour necrosis factor Proteins 0.000 description 1
- 102000018594 Tumour necrosis factor Human genes 0.000 description 1
- GBOGMAARMMDZGR-UHFFFAOYSA-N UNPD149280 Natural products N1C(=O)C23OC(=O)C=CC(O)CCCC(C)CC=CC3C(O)C(=C)C(C)C2C1CC1=CC=CC=C1 GBOGMAARMMDZGR-UHFFFAOYSA-N 0.000 description 1
- 206010047513 Vision blurred Diseases 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 229930183665 actinomycin Natural products 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 238000007792 addition Methods 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 230000001464 adherent effect Effects 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 238000011366 aggressive therapy Methods 0.000 description 1
- 208000037883 airway inflammation Diseases 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 229940100198 alkylating agent Drugs 0.000 description 1
- 239000002168 alkylating agent Substances 0.000 description 1
- 108010004469 allophycocyanin Proteins 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 239000004037 angiogenesis inhibitor Substances 0.000 description 1
- MWPLVEDNUUSJAV-UHFFFAOYSA-N anthracene Chemical compound C1=CC=CC2=CC3=CC=CC=C3C=C21 MWPLVEDNUUSJAV-UHFFFAOYSA-N 0.000 description 1
- 229940045799 anthracyclines and related substance Drugs 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 229940124650 anti-cancer therapies Drugs 0.000 description 1
- 230000000340 anti-metabolite Effects 0.000 description 1
- 230000005809 anti-tumor immunity Effects 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 238000011319 anticancer therapy Methods 0.000 description 1
- 210000000612 antigen-presenting cell Anatomy 0.000 description 1
- 229940100197 antimetabolite Drugs 0.000 description 1
- 239000002256 antimetabolite Substances 0.000 description 1
- 239000003080 antimitotic agent Substances 0.000 description 1
- 229940034982 antineoplastic agent Drugs 0.000 description 1
- 229940041181 antineoplastic drug Drugs 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 239000012062 aqueous buffer Substances 0.000 description 1
- 239000003125 aqueous solvent Substances 0.000 description 1
- FZCSTZYAHCUGEM-UHFFFAOYSA-N aspergillomarasmine B Natural products OC(=O)CNC(C(O)=O)CNC(C(O)=O)CC(O)=O FZCSTZYAHCUGEM-UHFFFAOYSA-N 0.000 description 1
- 230000002238 attenuated effect Effects 0.000 description 1
- 230000006470 autoimmune attack Effects 0.000 description 1
- 238000011888 autopsy Methods 0.000 description 1
- 229940003504 avonex Drugs 0.000 description 1
- 229960002170 azathioprine Drugs 0.000 description 1
- LMEKQMALGUDUQG-UHFFFAOYSA-N azathioprine Chemical compound CN1C=NC([N+]([O-])=O)=C1SC1=NC=NC2=C1NC=N2 LMEKQMALGUDUQG-UHFFFAOYSA-N 0.000 description 1
- 210000004082 barrier epithelial cell Anatomy 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 229940021459 betaseron Drugs 0.000 description 1
- 239000007998 bicine buffer Substances 0.000 description 1
- 102000023732 binding proteins Human genes 0.000 description 1
- 108091008324 binding proteins Proteins 0.000 description 1
- 238000004166 bioassay Methods 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 238000007413 biotinylation Methods 0.000 description 1
- 230000006287 biotinylation Effects 0.000 description 1
- JCXGWMGPZLAOME-RNFDNDRNSA-N bismuth-213 Chemical compound [213Bi] JCXGWMGPZLAOME-RNFDNDRNSA-N 0.000 description 1
- 229960001561 bleomycin Drugs 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- 230000008499 blood brain barrier function Effects 0.000 description 1
- 210000001218 blood-brain barrier Anatomy 0.000 description 1
- RSIHSRDYCUFFLA-DYKIIFRCSA-N boldenone Chemical compound O=C1C=C[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 RSIHSRDYCUFFLA-DYKIIFRCSA-N 0.000 description 1
- 229960002092 busulfan Drugs 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 229930195731 calicheamicin Natural products 0.000 description 1
- HGLDOAKPQXAFKI-OUBTZVSYSA-N californium-252 Chemical compound [252Cf] HGLDOAKPQXAFKI-OUBTZVSYSA-N 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 231100000259 cardiotoxicity Toxicity 0.000 description 1
- 229960005243 carmustine Drugs 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 210000001175 cerebrospinal fluid Anatomy 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- NDAYQJDHGXTBJL-MWWSRJDJSA-N chembl557217 Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@@H](CC(C)C)NC(=O)[C@H](CC=3C4=CC=CC=C4NC=3)NC(=O)[C@@H](CC(C)C)NC(=O)[C@H](CC=3C4=CC=CC=C4NC=3)NC(=O)[C@@H](CC(C)C)NC(=O)[C@H](CC=3C4=CC=CC=C4NC=3)NC(=O)[C@@H](C(C)C)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](C(C)C)NC(=O)[C@H](C)NC(=O)[C@H](NC(=O)CNC(=O)[C@@H](NC=O)C(C)C)CC(C)C)C(=O)NCCO)=CNC2=C1 NDAYQJDHGXTBJL-MWWSRJDJSA-N 0.000 description 1
- 235000013330 chicken meat Nutrition 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 229960004630 chlorambucil Drugs 0.000 description 1
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 229960004316 cisplatin Drugs 0.000 description 1
- 235000015165 citric acid Nutrition 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 238000012411 cloning technique Methods 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 229940110456 cocoa butter Drugs 0.000 description 1
- 235000019868 cocoa butter Nutrition 0.000 description 1
- 239000003184 complementary RNA Substances 0.000 description 1
- 238000007906 compression Methods 0.000 description 1
- 230000006835 compression Effects 0.000 description 1
- 230000001268 conjugating effect Effects 0.000 description 1
- 238000013270 controlled release Methods 0.000 description 1
- 239000000599 controlled substance Substances 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 229940038717 copaxone Drugs 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000011461 current therapy Methods 0.000 description 1
- UFULAYFCSOUIOV-UHFFFAOYSA-N cysteamine Chemical compound NCCS UFULAYFCSOUIOV-UHFFFAOYSA-N 0.000 description 1
- 150000001944 cysteine derivatives Chemical class 0.000 description 1
- 229960000684 cytarabine Drugs 0.000 description 1
- GBOGMAARMMDZGR-TYHYBEHESA-N cytochalasin B Chemical compound C([C@H]1[C@@H]2[C@@H](C([C@@H](O)[C@@H]3/C=C/C[C@H](C)CCC[C@@H](O)/C=C/C(=O)O[C@@]23C(=O)N1)=C)C)C1=CC=CC=C1 GBOGMAARMMDZGR-TYHYBEHESA-N 0.000 description 1
- GBOGMAARMMDZGR-JREHFAHYSA-N cytochalasin B Natural products C[C@H]1CCC[C@@H](O)C=CC(=O)O[C@@]23[C@H](C=CC1)[C@H](O)C(=C)[C@@H](C)[C@@H]2[C@H](Cc4ccccc4)NC3=O GBOGMAARMMDZGR-JREHFAHYSA-N 0.000 description 1
- 239000002619 cytotoxin Substances 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- RSIHSRDYCUFFLA-UHFFFAOYSA-N dehydrotestosterone Natural products O=C1C=CC2(C)C3CCC(C)(C(CC4)O)C4C3CCC2=C1 RSIHSRDYCUFFLA-UHFFFAOYSA-N 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 230000001627 detrimental effect Effects 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- KCFYHBSOLOXZIF-UHFFFAOYSA-N dihydrochrysin Natural products COC1=C(O)C(OC)=CC(C2OC3=CC(O)=CC(O)=C3C(=O)C2)=C1 KCFYHBSOLOXZIF-UHFFFAOYSA-N 0.000 description 1
- XEYBRNLFEZDVAW-ARSRFYASSA-N dinoprostone Chemical compound CCCCC[C@H](O)\C=C\[C@H]1[C@H](O)CC(=O)[C@@H]1C\C=C/CCCC(O)=O XEYBRNLFEZDVAW-ARSRFYASSA-N 0.000 description 1
- 229960002986 dinoprostone Drugs 0.000 description 1
- 238000011979 disease modifying therapy Methods 0.000 description 1
- 239000007884 disintegrant Substances 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 238000009509 drug development Methods 0.000 description 1
- 229960005501 duocarmycin Drugs 0.000 description 1
- 229930184221 duocarmycin Natural products 0.000 description 1
- 238000010410 dusting Methods 0.000 description 1
- 238000000804 electron spin resonance spectroscopy Methods 0.000 description 1
- AUVVAXYIELKVAI-CKBKHPSWSA-N emetine Chemical compound N1CCC2=CC(OC)=C(OC)C=C2[C@H]1C[C@H]1C[C@H]2C3=CC(OC)=C(OC)C=C3CCN2C[C@@H]1CC AUVVAXYIELKVAI-CKBKHPSWSA-N 0.000 description 1
- 229960002694 emetine Drugs 0.000 description 1
- AUVVAXYIELKVAI-UWBTVBNJSA-N emetine Natural products N1CCC2=CC(OC)=C(OC)C=C2[C@H]1C[C@H]1C[C@H]2C3=CC(OC)=C(OC)C=C3CCN2C[C@H]1CC AUVVAXYIELKVAI-UWBTVBNJSA-N 0.000 description 1
- 239000003974 emollient agent Substances 0.000 description 1
- 238000005538 encapsulation Methods 0.000 description 1
- 239000007920 enema Substances 0.000 description 1
- 229940079360 enema for constipation Drugs 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 229940088598 enzyme Drugs 0.000 description 1
- 210000003979 eosinophil Anatomy 0.000 description 1
- 210000002615 epidermis Anatomy 0.000 description 1
- 230000004890 epithelial barrier function Effects 0.000 description 1
- 210000003743 erythrocyte Anatomy 0.000 description 1
- ZMMJGEGLRURXTF-UHFFFAOYSA-N ethidium bromide Chemical compound [Br-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CC)=C1C1=CC=CC=C1 ZMMJGEGLRURXTF-UHFFFAOYSA-N 0.000 description 1
- 229960005542 ethidium bromide Drugs 0.000 description 1
- DEFVIWRASFVYLL-UHFFFAOYSA-N ethylene glycol bis(2-aminoethyl)tetraacetic acid Chemical compound OC(=O)CN(CC(O)=O)CCOCCOCCN(CC(O)=O)CC(O)=O DEFVIWRASFVYLL-UHFFFAOYSA-N 0.000 description 1
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 1
- 229960005420 etoposide Drugs 0.000 description 1
- 230000005713 exacerbation Effects 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 239000003889 eye drop Substances 0.000 description 1
- 229940012356 eye drops Drugs 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- ZFKJVJIDPQDDFY-UHFFFAOYSA-N fluorescamine Chemical compound C12=CC=CC=C2C(=O)OC1(C1=O)OC=C1C1=CC=CC=C1 ZFKJVJIDPQDDFY-UHFFFAOYSA-N 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 229960002949 fluorouracil Drugs 0.000 description 1
- 239000011724 folic acid Substances 0.000 description 1
- 229960000304 folic acid Drugs 0.000 description 1
- 235000019152 folic acid Nutrition 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 210000004602 germ cell Anatomy 0.000 description 1
- 239000003862 glucocorticoid Substances 0.000 description 1
- 229960003180 glutathione Drugs 0.000 description 1
- 150000004676 glycans Chemical class 0.000 description 1
- 125000005456 glyceride group Chemical group 0.000 description 1
- 229940096919 glycogen Drugs 0.000 description 1
- 239000003979 granulating agent Substances 0.000 description 1
- 210000003714 granulocyte Anatomy 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 210000004524 haematopoietic cell Anatomy 0.000 description 1
- 230000003394 haemopoietic effect Effects 0.000 description 1
- 231100000869 headache Toxicity 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 230000002949 hemolytic effect Effects 0.000 description 1
- 210000003494 hepatocyte Anatomy 0.000 description 1
- 239000008309 hydrophilic cream Substances 0.000 description 1
- 238000004191 hydrophobic interaction chromatography Methods 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 239000001863 hydroxypropyl cellulose Substances 0.000 description 1
- 235000010977 hydroxypropyl cellulose Nutrition 0.000 description 1
- 210000002865 immune cell Anatomy 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 238000002649 immunization Methods 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 230000008595 infiltration Effects 0.000 description 1
- 238000001764 infiltration Methods 0.000 description 1
- 230000028709 inflammatory response Effects 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 229960004461 interferon beta-1a Drugs 0.000 description 1
- 229960003161 interferon beta-1b Drugs 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 238000005342 ion exchange Methods 0.000 description 1
- GKOZUEZYRPOHIO-IGMARMGPSA-N iridium-192 Chemical compound [192Ir] GKOZUEZYRPOHIO-IGMARMGPSA-N 0.000 description 1
- 230000002427 irreversible effect Effects 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 229960004194 lidocaine Drugs 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 229960002247 lomustine Drugs 0.000 description 1
- 239000007937 lozenge Substances 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 229960004961 mechlorethamine Drugs 0.000 description 1
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical compound ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 1
- 229960001924 melphalan Drugs 0.000 description 1
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 1
- 210000003071 memory t lymphocyte Anatomy 0.000 description 1
- 229960001428 mercaptopurine Drugs 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 150000002739 metals Chemical class 0.000 description 1
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 125000000956 methoxy group Chemical group [H]C([H])([H])O* 0.000 description 1
- 238000010208 microarray analysis Methods 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 239000003094 microcapsule Substances 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 229960005485 mitobronitol Drugs 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 239000003607 modifier Substances 0.000 description 1
- 238000001823 molecular biology technique Methods 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- 210000005087 mononuclear cell Anatomy 0.000 description 1
- 238000000465 moulding Methods 0.000 description 1
- 239000002324 mouth wash Substances 0.000 description 1
- 210000000663 muscle cell Anatomy 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- 230000000926 neurological effect Effects 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- ZVEZMVFBMOOHAT-UHFFFAOYSA-N nonane-1-thiol Chemical group CCCCCCCCCS ZVEZMVFBMOOHAT-UHFFFAOYSA-N 0.000 description 1
- 238000009206 nuclear medicine Methods 0.000 description 1
- 239000007764 o/w emulsion Substances 0.000 description 1
- 235000014593 oils and fats Nutrition 0.000 description 1
- 239000003883 ointment base Substances 0.000 description 1
- 229940055577 oleyl alcohol Drugs 0.000 description 1
- XMLQWXUVTXCDDL-UHFFFAOYSA-N oleyl alcohol Natural products CCCCCCC=CCCCCCCCCCCO XMLQWXUVTXCDDL-UHFFFAOYSA-N 0.000 description 1
- 238000011275 oncology therapy Methods 0.000 description 1
- 238000001543 one-way ANOVA Methods 0.000 description 1
- 230000014207 opsonization Effects 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 235000006408 oxalic acid Nutrition 0.000 description 1
- 238000004806 packaging method and process Methods 0.000 description 1
- 229960001592 paclitaxel Drugs 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 239000006072 paste Substances 0.000 description 1
- 235000010603 pastilles Nutrition 0.000 description 1
- 230000008506 pathogenesis Effects 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 230000035515 penetration Effects 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 238000007540 photo-reduction reaction Methods 0.000 description 1
- ZWLUXSQADUDCSB-UHFFFAOYSA-N phthalaldehyde Chemical compound O=CC1=CC=CC=C1C=O ZWLUXSQADUDCSB-UHFFFAOYSA-N 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 229920000233 poly(alkylene oxides) Polymers 0.000 description 1
- 229920002859 polyalkenylene Polymers 0.000 description 1
- 229920001281 polyalkylene Polymers 0.000 description 1
- 229920001451 polypropylene glycol Polymers 0.000 description 1
- 229920002451 polyvinyl alcohol Polymers 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 229920001592 potato starch Polymers 0.000 description 1
- 229960005205 prednisolone Drugs 0.000 description 1
- OIGNJSKKLXVSLS-VWUMJDOOSA-N prednisolone Chemical compound O=C1C=C[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 OIGNJSKKLXVSLS-VWUMJDOOSA-N 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 238000009117 preventive therapy Methods 0.000 description 1
- 229960004919 procaine Drugs 0.000 description 1
- MFDFERRIHVXMIY-UHFFFAOYSA-N procaine Chemical compound CCN(CC)CCOC(=O)C1=CC=C(N)C=C1 MFDFERRIHVXMIY-UHFFFAOYSA-N 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 229960003712 propranolol Drugs 0.000 description 1
- XEYBRNLFEZDVAW-UHFFFAOYSA-N prostaglandin E2 Natural products CCCCCC(O)C=CC1C(O)CC(=O)C1CC=CCCCC(O)=O XEYBRNLFEZDVAW-UHFFFAOYSA-N 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 229950010131 puromycin Drugs 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 238000000163 radioactive labelling Methods 0.000 description 1
- 229940038850 rebif Drugs 0.000 description 1
- 230000010837 receptor-mediated endocytosis Effects 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 125000006853 reporter group Chemical group 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- 206010039073 rheumatoid arthritis Diseases 0.000 description 1
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 239000000377 silicon dioxide Substances 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 238000012868 site-directed mutagenesis technique Methods 0.000 description 1
- 238000003998 size exclusion chromatography high performance liquid chromatography Methods 0.000 description 1
- 235000019333 sodium laurylsulphate Nutrition 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 239000006104 solid solution Substances 0.000 description 1
- VIDRYROWYFWGSY-UHFFFAOYSA-N sotalol hydrochloride Chemical compound Cl.CC(C)NCC(O)C1=CC=C(NS(C)(=O)=O)C=C1 VIDRYROWYFWGSY-UHFFFAOYSA-N 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 239000007858 starting material Substances 0.000 description 1
- 238000007619 statistical method Methods 0.000 description 1
- 150000003431 steroids Chemical class 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 229960001052 streptozocin Drugs 0.000 description 1
- ZSJLQEPLLKMAKR-GKHCUFPYSA-N streptozocin Chemical compound O=NN(C)C(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O ZSJLQEPLLKMAKR-GKHCUFPYSA-N 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 125000001424 substituent group Chemical group 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- FIAFUQMPZJWCLV-UHFFFAOYSA-N suramin Chemical compound OS(=O)(=O)C1=CC(S(O)(=O)=O)=C2C(NC(=O)C3=CC=C(C(=C3)NC(=O)C=3C=C(NC(=O)NC=4C=C(C=CC=4)C(=O)NC=4C(=CC=C(C=4)C(=O)NC=4C5=C(C=C(C=C5C(=CC=4)S(O)(=O)=O)S(O)(=O)=O)S(O)(=O)=O)C)C=CC=3)C)=CC=C(S(O)(=O)=O)C2=C1 FIAFUQMPZJWCLV-UHFFFAOYSA-N 0.000 description 1
- 229960005314 suramin Drugs 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 229940037128 systemic glucocorticoids Drugs 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 1
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 1
- 229960001278 teniposide Drugs 0.000 description 1
- 229960002372 tetracaine Drugs 0.000 description 1
- GKCBAIGFKIBETG-UHFFFAOYSA-N tetracaine Chemical compound CCCCNC1=CC=C(C(=O)OCCN(C)C)C=C1 GKCBAIGFKIBETG-UHFFFAOYSA-N 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- 230000001732 thrombotic effect Effects 0.000 description 1
- 229960003087 tioguanine Drugs 0.000 description 1
- 229960000187 tissue plasminogen activator Drugs 0.000 description 1
- 229940100611 topical cream Drugs 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 229940100615 topical ointment Drugs 0.000 description 1
- 239000000196 tragacanth Substances 0.000 description 1
- 235000010487 tragacanth Nutrition 0.000 description 1
- 229940116362 tragacanth Drugs 0.000 description 1
- 238000011830 transgenic mouse model Methods 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 201000008827 tuberculosis Diseases 0.000 description 1
- WFKWXMTUELFFGS-RNFDNDRNSA-N tungsten-188 Chemical compound [188W] WFKWXMTUELFFGS-RNFDNDRNSA-N 0.000 description 1
- 230000003827 upregulation Effects 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
- C07K16/244—Interleukins [IL]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/56—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
- A61K47/59—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
- A61K47/60—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6845—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a cytokine, e.g. growth factors, VEGF, TNF, a lymphokine or an interferon
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
Definitions
- the present invention relates generally to methods of treating multiple sclerosis and more specifically to the use of inhibitors of IL-17 activity for the manufacture of a medicament for the treatment of multiple sclerosis.
- Interleukin 17 also known as CTLA-8 or IL-17A, is a pro-inflammatory cytokine which stimulates the secretion of a wide range of other cytokines from various non-immune cells.
- IL-17 is capable of inducing the secretion of IL-6, IL-8, PGE2, MCP-1 and G-CSF by adherent cells like fibroblasts, keratinocytes, epithelial and endothelial cells and is also able to induce ICAM-1 surface expression, proliferation of T cells, and growth and differentiation of CD34+human progenitors into neutrophils when cocultured in presence of irradiated fibroblasts (Fossiez et al., 1998, Int. Rev.
- IL-17 is predominantly produced by activated memory T cells and acts by binding to a ubiquitously distributed cell surface receptor (IL-17R) (Yao et al., 1997, Cytokine, 9, 794-800).
- IL-17R ubiquitously distributed cell surface receptor
- a number of homologues of IL-17 have been identified which have both similar and distinct roles in regulating inflammatory responses.
- IL-17 cytokine/receptor families see Dumont, 2003, Expert Opin. Ther. Patents, 13, 287-303.
- IL-17 may contribute to a number of diseases mediated by abnormal immune responses, such as rheumatoid arthritis and air-way inflammation, as well as organ transplant rejection and antitumour immunity.
- Inhibitors of IL-17 activity are well known in the art, for example an IL-17R:Fc fusion protein was used to demonstrate the role of IL-17 in collagen-induced arthritis (Lubberts et al., J. Immunol. 2001,167, 1004-1013) and neutralising polyclonal antibodies have been used to reduce peritoneal adhesion formation (Chung et al., 2002, J. Exp. Med., 195, 1471-1478). Neutralising monoclonal antibodies are commercially available (R&D Systems UK).
- MS Multiple sclerosis
- CNS central nervous system
- Immune mediated inflammatory lesions within the CNS are thought to result primarily from an infiltration of autoreactive CD4 + lymphocytes (Th1) which recognise myelin proteins presented on MHC class II molecules by antigen presenting cells.
- Th1 autoreactive CD4 + lymphocytes
- This interaction causes stimulation of Th1 cells which release proinflammatory cytokines (mainly TNF- ⁇ & IFN- ⁇ ) resulting in proliferation of T-cells, activation of B-cells and macrophages, upregulation of adhesion molecules and disruption of the blood-brain barrier.
- proinflammatory cytokines mainly TNF- ⁇ & IFN- ⁇
- the most important target antigen is suggested to be myelin oligodendrocyte protein (MOG), which is present on the surface of the myelin sheath. Destruction of antibody-opsonized myelin is then accomplished either by complement or activated macrophages. Axonal loss and neurodegeneration subsequent to inflammation are thought to be responsible for the accumulation of irreversible neurological impairment, characteristic of secondary progressive MS.
- MS telomere shortness telomere shortness telomere shortness telomere shortness telomere shortness telomere shortness telomere shortness telomere shortness telomere shortening
- SP-MS secondary progressive MS
- Interferon beta-1b Betaseron; Berlex
- Interferon beta-1a Avonex; Biogen, Rebif; Serono
- glatimer acetate Copaxone; Teva
- the anti-cancer agent mitoxantrone (Novantrone)
- Novantrone mitoxantrone
- azathioprine has also been used as an immunosuppressant.
- IL-17 plays any kind of role in the pathogenesis of MS is unknown.
- Microarray analysis of MS lesions obtained at autopsy have revealed increased transcripts of many different genes encoding inflammatory cytokines, including, IL-17 (Lock et al., 2002, Nature Medicine, 8, 500-508).
- An increased number of IL-17 expressing mononuclear cells have been detected in blood and cerebrospinal fluid from patients with MS (Matusevicius et al., 1999, Multiple Sclerosis, 5, 101-104) but as the authors point out cytokine mRNA expression is not necessarily identical to cytokine protein production.
- the present invention provides a method for the treatment and/or prophylaxis of MS comprising administering a therapeutically effective amount of an inhibitor of IL-17 activity.
- the invention also provides the use of an inhibitor of IL-17 activity for the manufacture of a medicament for the treatment and/or prophylaxis of multiple sclerosis.
- IL-17 activity refers to the spectrum of activity understood in the art for IL-17 for example, the induction of secretion of IL-6 or IL-8 from fibroblasts by IL-17 (Yao et al., 1995, Journal of Immunology, 155,5483-5486).
- An inhibitor of IL-17 activity according to the present invention is an agent that interferes with the activity of IL-17, in particular the activity of IL-17 in MS. Particularly preferred are agents which interfere with the activity of IL-17 in MS in humans.
- Inhibitors according to the present invention may partially or completely inhibit IL-17 activity.
- Inhibitors of use in the present invention include without limitation, inhibitors that are capable of interacting with (e.g. binding to, or recognising) IL-17 or the IL-17 receptor (L17 R) or a nucleic acid molecule encoding IL-17 or IL-17R, or are capable of inhibiting the expression of IL-17 or IL-17R or are capable of inhibiting the interaction between IL-17 and IL-17R.
- Such inhibitors may be, without limitation, antibodies, nucleic acids (e.g. DNA, RNA, antisense RNA and siRNA), carbohydrates, lipids, proteins, polypeptides, peptides, peptidomimetics, small molecules and other drugs.
- nucleic acids e.g. DNA, RNA, antisense RNA and siRNA
- Suitable inhibitors include, but are not limited to, a synthetic functional fragment of the IL-17 receptor that binds to IL-17 and interferes with binding to the native IL-17 receptor, an antibody that binds to IL-17 or to the IL-17 receptor and interferes with IL-17 receptor-ligand interaction, an antisense nucleic acid molecule that specifically hybridizes to mRNA encoding IL-17 or the IL-17 receptor or a small molecule or other drug which inhibits the activity of IL-17 or its receptor.
- Inhibitors of IL-17 activity are well known in the art as are methods of identifying and producing such inhibitors. Examples include, IL-17R:Fc fusion proteins (Lubberts et al., J. Immunol. 2001,167, 1004-1013) and neutralising antibodies (Chung et al., 2002, J. Exp. Med., 195, 1471-1478; Ferretti, 2003, Journal of Immunology, 170, 2106-2112).
- Agents that may be suitable inhibitors can be selected from a wide variety of candidate agents. Examples of candidate agents include but are not limited to, nucleic acids (e.g. DNA and RNA), carbohydrates, lipids, proteins, polypeptides, peptides, peptidomimetics, small molecules and other drugs.
- Agents can be obtained using any of the numerous approaches in combinatorial library methods known in the art, including: biological libraries; spatially addressable parallel solid phase or solution phase libraries; synthetic library methods requiring deconvolution; the “one-bead one-compound” library method; and synthetic library methods using affinity chromatography selection.
- biological libraries is suited to peptide libraries, while the other four approaches are applicable to peptide, non-peptide oligomer or small molecule libraries of compounds (Lam, 1997, Anticancer Drug Des. 12:145; U.S. Pat. No. 5,738,996; and U.S. Pat. No. 5,807,683).
- Libraries of compounds may be presented, for example, in solution (e.g. Houghten, 1992, Bio/Techniques 13:412-421), or on beads (Lam, 1991, Nature 354:82-84), chips (Fodor, 1993, Nature 364:555-556), bacteria (U.S. Pat. No. 5,223,409), spores (U.S. Pat. Nos. 5,571,698; 5,403,484; and 5,223,409), plasmids (Cull et al., 1992, Proc. Natl. Acad. Sci.
- the inhibitor for use in the present invention may be a nucleic acid.
- IL-17 or IL-17R nucleic acid molecules maybe used as anti-sense molecules, to alter the expression of their respective polypeptides by binding to complementary nucleic acids.
- IL-17 or IL-17R nucleic acids may be obtained using standard cloning techniques from for example genomic DNA or cDNA or can be synthesised using well known and commercially available techniques.
- the IL-17 or IL-17R nucleic acids may contain one or more nucleotide substitutions, additions or deletions into the nucleotide sequence of an IL-17 or IL-17R nucleic acid.
- An antisense nucleic acid according to the present invention includes a IL-17 or IL-17R nucleic acid capable of hybridising by virtue of some sequence complementarity to a portion of an RNA (preferably mRNA) encoding the respective polypeptide.
- the antisense nucleic acid can be complementary to a coding and/or non-coding region of an mRNA encoding such a polypeptide.
- the antisense nucleic acids result in inhibition of the expression of the IL-17 or IL-17R polypeptide.
- the present invention provides a method for the treatment and/or prophylaxis of MS comprising administering a therapeutically effective amount of an inhibitor of IL-17 activity wherein the inhibitor comprises at least eight nucleotides that are antisense to a gene or cDNA encoding a IL-17 or IL-17R polypeptide.
- the invention also provides the use of nucleic acids comprising at least eight nucleotides that are antisense to a gene or cDNA encoding a IL-17 or IL-17R polypeptide for the manufacture of a medicament for the treatment and/or prophylaxis of MS.
- an inhibitor for use in the treatment and/or prophylaxis of MS is an antibody that interacts with (i.e. binds to or recognises) IL-17 or its receptor and inhibits the activity of IL-17. Accordingly, there is provided the use of an antibody that inhibits the activity of IL-17 for the manufacture of a medicament for the treatment and/or prophylaxis of MS. Also provided is a method of treatment and/or prophylaxis of MS in a subject comprising administering to said subject a therapeutically effective amount of an antibody that inhibits the activity of IL-17.
- the antibodies selectively interact with IL-17.
- Selectively interacting with means that the antibodies have a greater affinity for IL-17 polypeptides than for other polypeptides.
- suitable antibodies are those that inhibit the activity of IL-17 by binding to IL-17 in such a manner as to prevent it being biologically active, for example by preventing the binding of IL-17 to its receptor. Accordingly, there is provided by the present invention the use of an anti-IL-17 antibody for the manufacture of a medicament for the treatment and/or prophylaxis of MS. Also provided is a method of treatment and/or prophylaxis of MS in a subject comprising administering to said subject a therapeutically effective amount of an anti-IL-17 antibody.
- the antibodies selectively interact with the IL-17 receptor.
- Selectively interacting with means that the antibodies have a greater affinity for the IL-17 receptor polypeptide than for other polypeptides.
- suitable antibodies are those that inhibit the activity of IL-17 by preventing IL-17 mediated signalling from the receptor, for example by preventing IL-17 from binding to the IL-17 receptor. Accordingly, there is provided by the present invention the use of an anti-IL-7R antibody for the manufacture of a medicament for the treatment and/or prophylaxis of MS. Also provided is a method of treatment and/or prophylaxis of MS in a subject comprising administering to said subject a therapeutically effective amount of an anti-IL-17R antibody.
- IL-17 or IL-17 receptor polypeptides or cells expressing said polypeptides can be used to produce antibodies which specifically recognise said polypeptides.
- the IL-17 and IL-17R polypeptides may be ‘mature’ polypeptides or biologically active fragments or derivatives thereof.
- IL-17 and IL-17R polypeptides may be prepared by processes well known in the art from genetically engineered host cells comprising expression systems or they may be recovered from natural biological sources.
- the term “polypeptides” includes peptides, polypeptides and proteins. These are used interchangeably unless otherwise specified.
- IL-17 or IL-17R polypeptides may in some instances be part of a larger protein such as a fusion protein for example fused to an affinity tag.
- Antibodies generated against these polypeptides may be obtained by administering the polypeptides to an animal, preferably a non-human animal, using well-known and routine protocols, see for example Handbook of Experimental Immunology, D. M. Weir (ed.), Vol 4, Blackwell Scientific Publishers, Oxford, England, 1986. Many warm-blooded animals, such as rabbits, mice, rats, sheep, chickens, cows or pigs may be immunised. However, mice, rabbits, pigs and rats are generally preferred.
- Anti-IL-17 and anti-IL-17 receptor antibodies for use in the present invention include whole antibodies and functionally active fragments or derivatives thereof and may be, but are not limited to, polyclonal, monoclonal, multi-valent, multi-specific, humanized or chimeric antibodies, single chain antibodies, Fab fragments, Fab′ and F(ab′) 2 fragments, fragments produced by a Fab expression library, anti-idiotypic (anti-Id) antibodies, and epitope-binding fragments of any of the above.
- Antibodies include immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, i.e. molecules that contain an antigen binding site that specifically binds an antigen.
- the immunoglobulin molecules of the invention can be of any class (e.g. IgG, IgE, IgM, IgD and IgA) or subclass of immunoglobulin molecule.
- Monoclonal antibodies may be prepared by any method known in the art such as the hybridoma technique (Kohler & Milstein, 1975, Nature, 256:495-497), the trioma technique, the human B-cell hybridoma technique (Kozbor et al., 1983, Immunology Today, 4:72) and the EBV-hybridoma technique (Cole et al., Monoclonal Antibodies and Cancer Therapy, pp 77-96, Alan R Liss, Inc., 1985).
- Antibodies for use in the invention may also be generated using single lymphocyte antibody methods by cloning and expressing immunoglobulin variable region cDNAs generated from single lymphocytes selected for the production of specific antibodies by for example the methods described by Babcook, J. et al., 1996, Proc. Natl. Acad. Sci. USA 93(15):7843-7848 and in WO92/02551.
- Humanized antibodies are antibody molecules from non-human species having one or more complementarity determining regions (CDRs) from the non-human species and a framework region from a human immunoglobulin molecule (see, e.g. U.S. Pat. No. 5,585,089).
- CDRs complementarity determining regions
- Chimeric antibodies are those antibodies encoded by immunoglobulin genes that have been genetically engineered so that the light and heavy chain genes are composed of immunoglobulin gene segments belonging to different species. These chimeric antibodies are likely to be less antigenic.
- Bivalent antibodies may be made by methods known in the art (Milstein et al., 1983, Nature 305:537-539; WO 93/08829, Traunecker et al., 1991, EMBO J. 10:3655-3659). Multi-valent antibodies may comprise multiple specificities or may be monospecific (see for example WO 92/22853).
- the antibodies for use in the present invention can also be generated using various phage display methods known in the art and include those disclosed by Brinkman et al. (in J. Immunol. Methods, 1995, 182: 41-50), Ames et al. (J. Immunol. Methods, 1995, 184:177-186), Kettleborough et al. (Eur. J. Immunol. 1994, 24:952-958), Persic et al. (Gene, 1997 187 9-18), Burton et al.
- Antibody fragments and methods of producing them are well known in the art, see for example Verma et al., 1998, Journal of Immunological Methods, 216, 165-181.
- antibody fragments for use in the present invention are Fab′ fragments which possess a native or a modified hinge region.
- modified hinge regions have already been described, for example, in U.S. Pat. No. 5,677,425, WO9915549, and WO9825971 and these are incorporated herein by reference
- antibody fragments for use in the present invention include those described in International patent applications PCT/GB2004/002810, PCT/GB2004/002870 and PCT/GB2004/002871 (all filed on 1 Jul. 2004).
- modified antibody Fab fragments described in International patent application PCT/GB2004/002810 are preferred.
- These Fab fragments comprise a heavy and light chain pair, V H /C H 1 and V L /C L covalently linked through interchain cysteines in the heavy and light chain constant regions and are characterised in that the heavy chain constant region terminates at the interchain cysteine of C H 1.
- interchain cysteine refers to a cysteine in the heavy or light chain constant region that would be disulphide linked to a cysteine in the corresponding heavy or light chain constant region encoded in a naturally occurring germline antibody gene.
- the interchain cysteines are a cysteine in the constant region of the light chain (C L ) and a cysteine in the first constant region of the heavy chain (C H 1) that are disulphide linked to each other in naturally occurring antibodies.
- cysteines may typically be found at position 214 of the light chain and position 233 of the heavy chain of human IgG1, position 127 of the heavy chain of human IgM, IgE, IgG2, IgG3, IgG4 and position 128 of the heavy chain of human IgD and IgA2B, as defined by Kabat et al., 1987, in Sequences of Proteins of Immunological Interest, US Department of Health and Human Services, NIH, USA.
- interchain cysteines may be found at position 214 of the light chain and position 235 of the heavy chain.
- these cysteines may vary from that of naturally occurring antibodies if any modifications, such as deletions, insertions and/or substitutions have been made to the antibody Fab fragment.
- These antibody Fab fragments may be prepared by any suitable method known in the art.
- the antibody Fab fragment may be obtained from any whole antibody, especially a whole monoclonal antibody, using any suitable enzymatic cleavage and/or digestion techniques, for example by treatment with pepsin or papain and c-terminal proteases.
- these antibody Fab fragments are prepared by the use of recombinant DNA techniques involving the manipulation and re-expression of DNA encoding antibody variable and constant regions.
- PCR is used to introduce a stop codon immediately following the codon encoding the interchain cysteine of C H 1, such that translation of the C H 1 domain stops at the interchain cysteine.
- Methods for designing suitable PCR primers are well known in the art and the sequences of antibody C H 1 domains are readily available (Kabat et al., supra).
- stop codons may be introduced using site-directed mutagenesis techniques such as those described in White (Ed.), PCR Protocols: Current Methods and Applications (1993).
- the constant regions in these fragments are derived from IgG1 and the interchain cysteine of C L is at position 214 of the light chain and the interchain cysteine of C H 1 is at position 233 of the heavy chain.
- Examples of human and murine constant region sequences for use in these fragments are provided in SEQ ID Nos 1-4 and FIG. 13 ; human heavy chain constant region C H 1 which terminates at the interchain cysteine (SEQ ID NO:1); human light chain constant region (SEQ ID NO:2); murine heavy chain constant region C H 1 which terminates at the interchain cysteine (SEQ ID NO:3); murine light chain constant region (SEQ ID NO:4).
- an antibody for use in the present invention may be conjugated to one or more effector molecule(s).
- effector molecule includes, for example, antineoplastic agents, drugs, toxins, biologically active proteins, for example enzymes, other antibody or antibody fragments, synthetic or naturally occurring polymers, nucleic acids and fragments thereof e.g. DNA, RNA and fragments thereof, radionuclides, particularly radioiodide, radioisotopes, chelated metals, nanoparticles and reporter groups such as fluorescent compounds or compounds which may be detected by NMR or ESR spectroscopy.
- anti-IL-17 or anti IL-17R antibodies can be conjugated to an effector molecule, such as a cytotoxic agent, a radionuclide or drug moiety to modify a given biological response.
- an effector molecule such as a cytotoxic agent, a radionuclide or drug moiety to modify a given biological response.
- the therapeutic agent may be a drug moiety which may be a protein or polypeptide possessing a desired biological activity.
- Such moieties may include, for example and without limitation, a toxin such as abrin, ricin A, pseudomonas exotoxin, or diphtheria toxin, a protein such as tumour necrosis factor, ⁇ -interferon, ⁇ -interferon, nerve growth factor, platelet derived growth factor or tissue plasminogen activator, a thrombotic agent or an anti-angiogenic agent, e.g.
- a toxin such as abrin, ricin A, pseudomonas exotoxin, or diphtheria toxin
- a protein such as tumour necrosis factor, ⁇ -interferon, ⁇ -interferon, nerve growth factor, platelet derived growth factor or tissue plasminogen activator, a thrombotic agent or an anti-angiogenic agent, e.g.
- angiostatin or endostatin or, a biological response modifier such as a lymphokine, interleukin-1 (IL-1), interleukin-2 (IL-2), interleukin-6 (IL-6), granulocyte macrophage colony stimulating factor (GM-CSF), granulocyte colony stimulating factor (G-CSF), nerve growth factor (NGF) or other growth factor.
- IL-1 interleukin-1
- IL-2 interleukin-2
- IL-6 interleukin-6
- GM-CSF granulocyte macrophage colony stimulating factor
- G-CSF granulocyte colony stimulating factor
- NGF nerve growth factor
- the effector molecules may be cytotoxins or cytotoxic agents including any agent that is detrimental to (e.g. kills) cells.
- cytotoxins include taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin and analogs or homologs thereof.
- Effector molecules also include, but are not limited to, antimetabolites (e.g. methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, 5-fluorouracil decarbazine), alkylating agents (e.g. mechlorethamine, thioepa chlorambucil, melphalan, carmustine (BSNU) and lomustine (CCNU), cyclothosphamide, busulfan, dibromomannitol, streptozotocin, mitomycin C, and cis-dichlorodiamine platinum (II) (DDP) cisplatin), anthracyclines (e.g.
- antimetabolites e.g. methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, 5-fluorouracil decarbazine
- alkylating agents e.g. mechlorethamine, thioepa chloramb
- daunorubicin (formerly daunomycin) and doxorubicin
- antibiotics e.g. dactinomycin (formerly actinomycin), bleomycin, mithramycin, anthramycin (AMC), calicheamicins or duocarmycins
- anti-mitotic agents e.g. vincristine and vinblastine
- effector molecules may include radionuclides such as 111 In and 90 Y, Lu 177 , Bismuth 213 , Californium 252 , Iridium 192 and Tungsten 188 /Rhenium 188 ; or drugs such as but not limited to, alkylphosphocholines, topoisomerase I inhibitors, taxoids and suramin. Techniques for conjugating such effector molecules to antibodies are well known in the art (see, Hellstrom et al., Controlled Drug Delivery, 2nd Ed., Robinson et al., eds., 1987, pp. 623-53; Thorpe et al., 1982, Immunol.
- the antibody or fragment thereof is fused via a covalent bond (e.g. a peptide bond), at optionally the N-terminus or the C-terminus, to an amino acid sequence of another protein (or portion thereof; preferably at least a 10, 20 or 50 amino acid portion of the protein).
- a covalent bond e.g. a peptide bond
- the antibody, or fragment thereof is linked to the other protein at the N-terminus of the constant domain of the antibody.
- Recombinant DNA procedures may be used to create such fusions, for example as described in WO 86/01533 and EP 0392745.
- the effector molecule may increase half-life in vivo, and/or decrease immunogenicity and/or enhance the delivery of an antibody across an epithelial barrier to the immune system.
- suitable effector molecules include polymers and proteins such as albumin and albumin binding proteins.
- suitable polymers include any synthetic or naturally occurring substantially water-soluble, substantially non-antigenic polymer including, for example, optionally substituted straight or branched chain polyalkylene, polyalkenylene, or polyoxyalkylene polymers or branched or unbranched polysaccharides, e.g. a homo- or hetero-polysaccharide such as lactose, amylose, dextran or glycogen.
- Particular optional substituents which may be present on the above-mentioned synthetic polymers include one or more hydroxy, methyl or methoxy groups.
- Particular examples of synthetic polymers include optionally substituted straight or branched chain poly(ethyleneglycol), poly(propyleneglycol), poly(vinylalcohol) or derivatives thereof, especially optionally substituted poly(ethyleneglycol) such as methoxypoly(ethyleneglycol).
- the polymer is a polyalkylene oxide such as polyethylene glycol (PEG).
- antibodies for use in the present invention are attached to poly(ethyleneglycol) (PEG) moieties.
- the antibody is an antibody fragment and the PEG molecules may be attached through any available amino acid side-chain or terminal amino acid functional group located in the antibody fragment, for example any free amino, imino, thiol, hydroxyl or carboxyl group.
- Such amino acids may occur naturally in the antibody fragment or may be engineered into the fragment using recombinant DNA methods. See for example U.S. Pat. No. 5,219,996. Multiple sites can be used to attach two or more PEG molecules.
- PEG molecules are covalently linked through a thiol group of at least one cysteine residue located in the antibody fragment. Where a thiol group is used as the point of attachment appropriately activated effector molecules, for example thiol selective derivatives such as maleimides and cysteine derivatives may be used.
- the antibody is a modified Fab fragment, such as a Fab′ which is PEGylated, i.e. has PEG (poly(ethyleneglycol)) covalently attached thereto, e.g. according to the method disclosed in EP 0948544 [see also “Poly(ethyleneglycol) Chemistry, Biotechnical and Biomedical Applications”, 1992, J. Milton Harris (ed), Plenum Press, New York, “Poly(ethyleneglycol) Chemistry and Biological Applications”, 1997, J. Milton Harris and S. Zalipsky (eds), American Chemical Society, Washington D.C. and “Bioconjugation Protein Coupling Techniques for the Biomedical Sciences”, 1998, M. Aslam and A.
- PEG poly(ethyleneglycol)
- the total amount of PEG attached to the fragment may be varied as desired, but will generally be in an average molecular weight range from 250 to 100,000Da, preferably from 5,000 to 50,000Da, more preferably from 10,000 to 40,000Da and still more preferably from 20,000 to 40,000Da
- the size of PEG may in particular be selected on the basis of the intended use of the product, for example ability to localize to certain tissues such as tumors or extend circulating half-life (for review see Chapman, 2002, Advanced Drug Delivery Reviews, 54, 531-545).
- PEG is attached to a cysteine in the hinge region of a Fab′.
- a PEG modified Fab′ fragment has a maleimide group covalently linked to a single thiol group in a modified hinge region.
- a lysine residue may be covalently linked to the maleimide group and to each of the amine groups on the lysine residue may be attached a methoxypoly(ethyleneglycol)polymer having a molecular weight of approximately 20,000 Da.
- the total molecular weight of the PEG attached to the Fab′ fragment may therefore be approximately 40,000 Da.
- an antibody fragment for use in the present invention is a PEGylated (i.e. has PEG (poly(ethyleneglycol)) covalently attached thereto) Fab fragment as described in International Application Number PCT/GB2004/002810 (filed on 1 Jul. 2004).
- This PEGylated Fab fragment is a Fab fragment in which the heavy chain terminates at the interchain cysteine of C H 1 and the PEG attached to the fragment, preferably PEG-maleimide, is covalently linked to the interchain cysteine of C L and the interchain cysteine of C H 1.
- the interchain cysteine of C L is at position 214 of the light chain and the interchain cysteine of C H 1 is at position 233 of the heavy chain.
- each polymer attached to the Fab preferably has a molecular weight of approximately 20,000 Da.
- the molecular weight may be 15,000-25,000Da, or preferably 18,000-22,000Da, and even more preferably 19,000-21,000Da.
- the total molecular weight of the PEG attached to the antibody is therefore approximately 40,000 Da.
- PEG is attached to these fragments by first reducing the interchain disulphide bond between the interchain cysteines of C L and C H 1 and subsequently attaching the PEG to the free thiols. Once PEG is attached to the interchain cysteines there is no interchain disulphide linkage between the heavy and light chain.
- Suitable reducing agents for reducing the interchain disulphide bond are widely known in the art for example those described in Singh et al., 1995, Methods in Enzymology, 251, 167-73.
- thiol based reducing agents such as reduced glutathione (GSH), ⁇ -mercaptoethanol ( ⁇ -ME), ⁇ -mercaptoethylamine ( ⁇ -MA) and dithiothreitol (DTT).
- GSH reduced glutathione
- ⁇ -ME ⁇ -mercaptoethanol
- ⁇ -MA ⁇ -mercaptoethylamine
- DTT dithiothreitol
- electrolytic methods such as the method described in Leach et al., 1965, Div. Protein. Chem, 4, 23-27 and using photoreduction method such as the method described in Ellison et al., 2000, Biotechniques, 28 (2), 324-326.
- the reducing agent is a non-thiol based reducing agent, preferably one of the trialkylphosphine reducing agents (Ruegg U T and Rudinger, J., 1977, Methods in Enzymology, 47, 111-126; Burns J et al., 1991, J. Org. Chem, 56, 2648-2650; Getz et al., 1999, Analytical Biochemistry, 273, 73-80; Han and Han, 1994, Analytical Biochemistry, 220, 5-10; Seitz et al., 1999, Euro. J.
- the trialkylphosphine reducing agents Ruegg U T and Rudinger, J., 1977, Methods in Enzymology, 47, 111-126; Burns J et al., 1991, J. Org. Chem, 56, 2648-2650; Getz et al., 1999, Analytical Biochemistry, 273, 73-80; Han and Han, 1994, Analytical Biochemistry, 220, 5-10; Seit
- TCEP tris(2-carboxyethyl)phosphine
- TBP tris butyl phosphine
- THP tris-(2-cyanoethyl) phosphine
- THP tris-(3-hydroxypropyl)phosphine
- the reducing agents TCEP and THP are preferred.
- concentration of reducing agent can be determined empirically, for example, by varying the concentration of reducing agent and measuring the number of free thiols produced.
- the reducing agent is used in excess over the antibody fragment for example between 2 and 1000 fold molar excess.
- the reducing agent is in 2, 3, 4, 5, 10, 100 or 1000 fold excess.
- the reductant is used at between 2 and 5 mM.
- the reduction and PEGylation reactions may generally be performed in a solvent, for example an aqueous buffer solution such as acetate or phosphate, at around neutral pH, for example around pH 4.5 to around pH 8.5, typically pH 4.5 to 8, suitably pH6 to 7.
- the reactions may generally be performed at any suitable temperature, for example between about 5° C. and about 70° C., for example at room temperature.
- the solvent may optionally contain a chelating agent such as EDTA, EGTA, CDTA or DTPA.
- the solvent contains EDTA at between 1 and 5 mM, preferably 2 mM.
- the solvent may be a chelating buffer such as citric acid, oxalic acid, folic acid, bicine, tricine, tris or ADA.
- the PEG will generally be employed in excess concentration relative to the concentration of the antibody fragment. Typically the PEG is in between 2 and 100 fold molar excess, preferably 5, 10 or 50 fold excess.
- the desired product containing the desired number of PEG molecules may be separated from any starting materials or other product generated during the production process by conventional means, for example by chromatography techniques such as ion exchange, size exclusion, protein A, G or L affinity chromatography or hydrophobic interaction chromatography.
- chromatography techniques such as ion exchange, size exclusion, protein A, G or L affinity chromatography or hydrophobic interaction chromatography.
- inhibitors of IL-17 activity a number of different approaches may be taken by those skilled in the art.
- inhibitors are identified by first identifying agents that interact with IL-17 or IL-17R and subsequently testing those agents to identify those that inhibit IL-17 activity.
- the agent is an antibody.
- Agents that interact with IL-17 or IL-17R may be identified using any suitable method, for example by using a cell-free or cell-based assay system where the IL-17 or IL-17R polypeptide is contacted with a candidate agent and the ability of the candidate agent to interact with the polypeptide is determined.
- the ability of a candidate agent to interact with a IL-17 or IL-17R polypeptide is compared to a reference range or control. If desired, this assay may be used to screen a plurality (e.g. a library) of candidate agents using a plurality of IL-17 or IL-17R polypeptide samples.
- a first and second sample comprising native or recombinant IL-17 or IL-17R polypeptide are contacted with a candidate agent or a control agent and the ability of the candidate agent to interact with the polypeptide is determined by comparing the difference in interaction between the candidate agent and control agent.
- the polypeptide is first immobilized, by, for example, contacting the polypeptide with an immobilized antibody which specifically recognizes and binds it, or by contacting a purified preparation of polypeptide with a surface designed to bind proteins.
- the polypeptide may be partially or completely purified (e.g. partially or completely free of other polypeptides) or part of a cell lysate.
- polypeptide may be a fusion protein comprising the IL-17 or IL-17R polypeptide or a biologically active portion thereof and a domain such as glutathionine-S-transferase or the Fc region of IgG1.
- polypeptide can be biotinylated using techniques well known to those of skill in the art (e.g. biotinylation kit, Pierce Chemicals; Rockford, Ill.).
- biotinylation kit Pierce Chemicals; Rockford, Ill.
- the ability of the candidate agent to interact with the polypeptide can be determined by methods known to those of skill in the art for example, ELISA, BIAcoreTM, Flow cytometry or fluorescent microvolume assay technology (FMAT).
- a population of cells expressing IL-17 or IL-17R is contacted with a candidate agent and the ability of the candidate agent to interact with the polypeptide is determined.
- the ability of a candidate agent to interact with IL-17 or IL-17R is compared to a reference range or control.
- the cell for example, can be of eukaryotic origin (e.g. yeast or mammalian) and can express the IL-17 or IL-17R polypeptide endogenously or be genetically engineered to express the polypeptide.
- the IL-17 or IL-17R polypeptide or the candidate agent is labelled, for example with a radioactive label (such as 32 P, 35 S or 125 I) or a fluorescent label (such as fluorescein isothiocyanate, rhodamine, phycoerythrin, phycocyanin, allophycocyanin, o-phthaldehyde or fluorescamine) to enable detection of an interaction between a polypeptide and a candidate agent.
- a radioactive label such as 32 P, 35 S or 125 I
- a fluorescent label such as fluorescein isothiocyanate, rhodamine, phycoerythrin, phycocyanin, allophycocyanin, o-phthaldehyde or fluorescamine
- Alternative methods such as ELISA, flow cytometry and FMAT may also be used.
- Agents which inhibit IL-17 activity may be identified by any suitable method, for example by:
- Such assays can be used to screen candidate agents, in clinical monitoring or in drug development.
- agents may be pre-screened where appropriate to identify agents (e.g. an antibody) that interact with IL-17 or IL-17R prior to screening those agents which bind for their ability to inhibit IL-17 activity.
- agents e.g. an antibody
- a cell-based assay system is used to identify agents capable of inhibiting the activity of IL-17.
- the assay used to identify inhibitors of IL-17 activity is the standard IL-6 release assay from fibroblasts (Yao et al., 1995, Journal of Immunology, 155,5483-5486). Potential inhibitors are added to the assay and IL-6 release determined by ELISA. Inhibition is therefore measured as a reduction in IL-6 release compared to controls.
- inhibitors of IL-17 may down-regulate the expression of the IL-17 or IL-17R polypeptide, for example antisense inhibitors.
- Such inhibitors may be identified by any method known in the art.
- such inhibitors are identified in a cell-based assay system. Accordingly, a population of cells expressing a IL-17 or IL-17R polypeptide or nucleic acid are contacted with a candidate agent and the ability of the candidate agent to alter expression of the IL-17 or IL-17R polypeptide or nucleic acid is determined by comparison to a reference range or control.
- populations of cells expressing a IL-17 or IL-17R polypeptide are contacted with a candidate agent or a control agent and the ability of the candidate agent to alter the expression of the IL-17 or IL-17R polypeptides or nucleic acids is determined by comparing the difference in the level of expression of the IL-17 or IL-17R polypeptides or nucleic acids between the treated and control populations of cells. If desired, this assay may be used to screen a plurality (e.g. a library) of candidate agents.
- the cell for example, can be of eukaryotic origin (e.g.
- yeast or mammalian can express an IL-17 or IL-17R polypeptide endogenously or be genetically engineered to express a IL-17 or IL-17R polypeptide.
- the ability of the candidate agents to alter the expression of a said polypeptides or nucleic acids can be determined by methods known to those of skill in the art, for example and without limitation, by flow cytometry, radiolabelling, a scintillation assay, immunoprecipitation, Western blot analysis, Northern blot analysis or RT-PCR.
- Agents that inhibit the activity of IL-17 may be identified or further tested, for example to determine therapeutically effective amounts in one or more animal models.
- suitable animals include, but are not limited to, mice, rats, rabbits, monkeys, guinea pigs, dogs and cats.
- the animal used represents a model of MS.
- a first and second group of mammals are administered with a candidate agent or a control agent and the ability of the candidate agent to inhibit the expression of IL-17 or IL-17R polypeptide or nucleic acid is determined by comparing the difference in the level of expression between the first and second group of mammals.
- the expression levels of the IL-17 or IL-17R polypeptides or nucleic acid in the first and second groups of mammals can be compared to the level of IL-17 or IL-17R polypeptide or nucleic acid in a control group of mammals.
- the candidate agent or a control agent can be administered by means known in the art (e.g. orally, rectally or parenterally such as intraperitoneally or intravenously). Changes in the expression of a polypeptide or nucleic acid can be assessed by the methods outlined above.
- the inhibition of IL-17 activity can be determined by monitoring an amelioration or improvement in disease symptoms, a delayed onset or slow progression of the disease, for example but without limitation, a reduction in paralysis.
- Techniques known to physicians familiar with MS can be used to determine whether a candidate agent has altered one or more symptoms associated with the disease.
- inhibitors of IL-17 activity can be used in the treatment and/or prophylaxis of MS.
- the agents will generally be administered in the form of a pharmaceutical composition.
- composition comprising an inhibitor of IL-17 activity and a pharmaceutically acceptable carrier.
- treatment includes either therapeutic or prophylactic therapy.
- a reference is made herein to a method of treating or preventing a disease or condition using a particular inhibitor or combination of inhibitors, it is to be understood that such a reference is intended to include the use of that inhibitor or combination of inhibitors for the manufacture of a medicament for the treatment and/or prophylaxis of MS.
- composition will usually be supplied as part of a sterile, pharmaceutical composition that will normally include a pharmaceutically acceptable carrier.
- This composition may be in any suitable form (depending upon the desired method of administering it to a patient).
- the inhibitors of use in the invention are preferably administered to a subject by a variety of other routes such as orally, transdermally, subcutaneously, intranasally, intravenously, intramuscularly, intrathecally and intracerebroventricularly.
- routes such as orally, transdermally, subcutaneously, intranasally, intravenously, intramuscularly, intrathecally and intracerebroventricularly.
- the most suitable route for administration in any given case will depend on the particular inhibitor, the subject, and the nature and severity of the disease and the physical condition of the subject.
- inhibitors of use in the invention may be administered in combination, e.g. simultaneously, sequentially or separately, with one or more other therapeutically active compounds, which may be for example other anti-MS therapies or anti-cancer therapies.
- compositions may be conveniently presented in unit dose forms containing a predetermined amount of an active agent of the invention per dose.
- a unit may contain for example but without limitation, 750 mg/kg to 0.1 mg/kg depending on the condition being treated, the route of administration and the age, weight and condition of the subject.
- Pharmaceutically acceptable carriers for use in the invention may take a wide variety of forms depending, e.g. on the route of administration.
- compositions for oral administration may be liquid or solid.
- Oral liquid preparations may be in the form of, for example, aqueous or oily suspensions, solutions, emulsions, syrups or elixirs, or may be presented as a dry product for reconstitution with water or other suitable vehicle before use.
- Oral liquid preparations may contain suspending agents as known in the art.
- oral solid preparations such as powders, capsules and tablets
- carriers such as starches, sugars, microcrystalline cellulose granulating agents, lubricants, binders, disintegrating agents, and the like may be included. Because of their ease of administration, tablets and capsules represent the most advantageous oral dosage unit form in which case solid pharmaceutical carriers are generally employed.
- active agents of the invention may also be administered by controlled release means and/or delivery devices.
- Tablets and capsules may comprise conventional carriers or excipients such as binding agents for example, syrup, acacia, gelatin, sorbitol, tragacanth, or polyvinylpyrrolidone; fillers, for example lactose, sugar, maize-starch, calcium phosphate, sorbitol or glycine; tableting lubricants, for example magnesium stearate, talc, polyethylene glycol or silica; disintegrants, for example potato starch; or acceptable wetting agents such as sodium lauryl sulphate.
- the tablets may be coated by standard aqueous or non-aqueous techniques according to methods well known in normal pharmaceutical practice.
- compositions of the present invention suitable for oral administration may be presented as discrete units such as capsules, cachets or tablets, each containing a predetermined amount of the active agent, as a powder or granules, or as a solution or a suspension in an aqueous liquid, a non-aqueous liquid, an oil-in-water emulsion or a water-in-oil liquid emulsion.
- Such compositions may be prepared by any of the methods of pharmacy but all methods include the step of bringing into association the active agent with the carrier, which constitutes one or more necessary ingredients.
- the compositions are prepared by uniformly and intimately admixing the active agent with liquid carriers or finely divided solid carriers or both, and then, if necessary, shaping the product into the desired presentation.
- a tablet may be prepared by compression or moulding, optionally with one or more accessory ingredients.
- compositions suitable for parenteral administration may be prepared as solutions or suspensions of the active agents of the invention in water suitably mixed with a surfactant such as hydroxypropylcellulose.
- Dispersions can also be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof in oils. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms.
- the pharmaceutical forms suitable for injectable use include aqueous or non-aqueous sterile injection solutions which may contain anti-oxidants, buffers, bacteriostats and solutes which render the composition isotonic with the blood of the intended recipient, and aqueous and non-aqueous sterile suspensions which may include suspending agents and thickening agents.
- aqueous or non-aqueous sterile injection solutions which may contain anti-oxidants, buffers, bacteriostats and solutes which render the composition isotonic with the blood of the intended recipient
- aqueous and non-aqueous sterile suspensions which may include suspending agents and thickening agents.
- Extemporaneous injection solutions, dispersions and suspensions may be prepared from sterile powders, granules and tablets.
- compositions can be administered with medical devices known in the art.
- a pharmaceutical composition of the invention can be administered with a needleless hypodermic injection device, such as the devices disclosed in U.S. Pat. Nos. 5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824; or 4,596,556.
- a needleless hypodermic injection device such as the devices disclosed in U.S. Pat. Nos. 5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824; or 4,596,556.
- Examples of well-known implants and modules useful in the present invention include: U.S. Pat. No. 4,487,603, which discloses an implantable micro-infusion pump for dispensing medication at a controlled rate; U.S. Pat. No. 4,486,194, which discloses a therapeutic device for administering medicaments through the skin; U.S
- compositions adapted for topical administration may be formulated as ointments, creams, suspensions, lotions, powders, solutions, pastes, gels, impregnated dressings, sprays, aerosols or oils, transdermal devices, dusting powders, and the like.
- These compositions may be prepared via conventional methods containing the active agent.
- they may also comprise compatible conventional carriers and additives, such as preservatives, solvents to assist drug penetration, emollients in creams or ointments and ethanol or oleyl alcohol for lotions.
- Such carriers maybe present as from about 1% up to about 98% of the composition. More usually they will form up to about 80% of the composition.
- a cream or ointment is prepared by mixing sufficient quantities of hydrophilic material and water, containing from about 5-10% by weight of the compound, in sufficient quantities to produce a cream or ointment having the desired consistency.
- compositions adapted for transdermal administration may be presented as discrete patches intended to remain in intimate contact with the epidermis of the recipient for a prolonged period of time.
- the active agent may be delivered from the patch by iontophoresis.
- compositions are preferably applied as a topical ointment or cream
- the active agent may be employed with either a paraffinic or a water-miscible ointment base.
- the active agent may be formulated in a cream with an oil-in-water cream base or a water-in-oil base.
- compositions adapted for topical administration in the mouth include lozenges, pastilles and mouth washes.
- compositions adapted for topical administration to the eye include eye drops wherein the active agent is dissolved or suspended in a suitable carrier, especially an aqueous solvent. They also include topical ointments or creams as above.
- compositions suitable for rectal administration wherein the carrier is a solid are most preferably presented as unit dose suppositories.
- Suitable carriers include cocoa butter or other glyceride or materials commonly used in the art, and the suppositories may be conveniently formed by admixture of the combination with the softened or melted carrier(s) followed by chilling and shaping moulds. They may also be administered as enemas.
- compositions comprising antibodies can be administered to patients (e.g., human subjects) at therapeutically or prophylactically effective dosages (e.g. dosages which result in inhibition of MS and/or relief of MS symptoms) using any suitable route of administration, such as injection and other routes of administration known in the art for clinical products, such as antibody-based clinical products.
- compositions may contain from 0.1% by weight, preferably from 10-60%, or more, by weight, of the inhibitor of the invention, depending on the method of administration.
- the optimal quantity and spacing of individual dosages of an inhibitor of the invention will be determined by the nature and extent of the condition being treated, the form, route and site of administration, and the age and condition of the particular subject being treated, and that a physician will ultimately determine appropriate dosages to be used. This dosage may be repeated as often as appropriate. If side effects develop the amount and/or frequency of the dosage can be altered or reduced, in accordance with normal clinical practice.
- the inhibitor is a nucleic acid this may be administered via gene therapy (see for example Hoshida, T. et al., 2002, Pancreas, 25:111-121; Ikuno, Y. 2002, Invest. Ophthalmol. Vis. Sci. 2002 43:2406-2411; Bollard, C., 2002, Blood 99:3179-3187; Lee E., 2001, Mol. Med. 7:773-782).
- Gene therapy refers to administration to a subject of an expressed or expressible nucleic acid. In one example this is either the IL-17 or the IL-17R nucleic acid or portions thereof. Any of the methods for gene therapy available in the art can be used according to the present invention.
- Delivery of the therapeutic nucleic acid into a patient can be direct in vivo gene therapy (i.e. the patient is directly exposed to the nucleic acid or nucleic acid-containing vector) or indirect ex vivo gene therapy (i.e. cells are first transformed with the nucleic acid in vitro and then transplanted into the patient).
- direct in vivo gene therapy i.e. the patient is directly exposed to the nucleic acid or nucleic acid-containing vector
- indirect ex vivo gene therapy i.e. cells are first transformed with the nucleic acid in vitro and then transplanted into the patient.
- an expression vector containing the IL-17 or IL-17R nucleic acid may be administered in such a manner that it becomes intracellular, i.e. by infection using a defective or attenuated retroviral or other viral vectors as described, for example, in U.S. Pat. No. 4,980,286 or by Robbins et al., 1998, Pharmacol. Ther. 80:35-47.
- retroviral vectors that are known in the art are such as those described in Miller et al. (1993, Meth. Enzymol. 217:581-599) which have been modified to delete those retroviral sequences which are not required for packaging of the viral genome and subsequent integration into host cell DNA.
- adenoviral vectors can be used which are advantageous due to their ability to infect non-dividing cells and such high-capacity adenoviral vectors are described in Kochanek (1999, Human Gene Therapy, 10:2451-2459).
- Chimeric viral vectors that can be used are those described by Reynolds et al. (1999, Molecular Medicine Today, 1:25-31).
- Hybrid vectors can also be used and are described by Jacoby et al. (1997, Gene Therapy, 4:1282-1283).
- Direct injection of naked DNA or through the use of microparticle bombardment (e.g. Gene Gun®; Biolistic, Dupont) or by coating it with lipids can also be used in gene therapy.
- Cell-surface receptors/transfecting compounds or through encapsulation in liposomes, microparticles or microcapsules or by administering the nucleic acid in linkage to a peptide which is known to enter the nucleus or by administering it in linkage to a ligand predisposed to receptor-mediated endocytosis See Wu & Wu. 1987, J. Biol. Chem., 262:4429-4432) can be used to target cell types which specifically express the receptors of interest.
- a gene is transferred into cells in vitro using tissue culture and the cells are delivered to the patient by various methods such as injecting subcutaneously, application of the cells into a skin graft and the intravenous injection of recombinant blood cells such as haematopoietic stem or progenitor cells.
- Cells into which a IL-17 or IL-17R nucleic acid can be introduced for the purposes of gene therapy include, for example, epithelial cells, endothelial cells, keratinocytes, fibroblasts, muscle cells, hepatocytes and blood cells.
- the blood cells that can be used include, for example, T-lymphocytes, B-lymphocytes, monocytes, macrophages, neutrophils, eosinophils, megakaryotcytes, granulocytes, haematopoietic cells or progenitor cells, and the like.
- the pharmaceutical composition of the present invention comprises an IL-17 or IL-17R nucleic acid, said nucleic acid being part of an expression vector that expresses an IL-17 or IL-17R polypeptide or chimeric protein thereof in a suitable host.
- a nucleic acid has a promoter operably linked to the polypeptide coding region, said promoter being inducible or constitutive (and, optionally, tissue-specific).
- FIG. 1 Effect of Ab#13 mIgG1 on clinical disease when dosed from day—1 through the acute phase (black arrowheads, days—1, 6, 13, 20). Average clinical score ( ⁇ sd) plotted against day of disease induction (a) and average change in weight from day 0 (b).
- FIG. 2 Analysis of the acute phase of disease following dosing of Ab#13mIgG1 through the acute phase.
- FIG. 3 Analysis of the relapse phase of disease following dosing of Ab#13mIgG1 through the acute phase.
- FIG. 4 Effect of Ab#13mIgG1 on clinical disease when dosed through the relapse phase (days 28, 35, 42 and 49, black arrowheads). Average clinical score ( ⁇ sd) versus day of disease induction (a) and average change in weight from day 0 (b).
- FIG. 5 Analysis of the acute phase of disease following dosing of Ab#13mIgG1 through the reipase phase.
- FIG. 6 Analysis of the relapse phase of disease following dosing of Ab#13mIgG1 through the relapse phase.
- FIG. 7 Effect of Ab#13 Fab-di-PEG and Ab#13 mIgG1 on clinical disease when dosed through the relapse phase (black arrowheads represent dosing days). Average clinical score ( ⁇ sd) plotted against day of disease induction (a) and average change in weight from day 0 (b).
- FIG. 8 Analysis of acute phase prior to dosing with Ab#13 Fab-di-PEG and Ab#13 mIgG1.
- FIG. 9 Analysis of relapse phase following dosing with Ab#13 Fab-di-PEG and Ab#13 mIgG1 during remission.
- FIG. 10 Effect of Ab#13mIgG1 on clinical disease when dosed from day-1 (black arrowheads represent dosing days, prophylactically (a) and therapeutically (b).
- FIG. 11 Analysis of prohylactic dosing regime.
- FIG. 12 Analysis of therapeutic dosing regime.
- FIG. 13 Human and murine constant regions.
- m170013 All the antibodies in the panel neutralised murine IL-17 in this assay and one antibody, m170013 (Ab#13) was selected for in vivo testing.
- a chimeric IgG (Ab#13 mIgG1) was produced using the rabbit variable region from antibody m170013 and mouse constant regions.
- mice 8-10 weeks of age (Harlan) were immunised with mouse spinal cord homogenate (SCH, 3.33 mg/ml) in complete freund's adjuvant by subcutaneous immunisation in either flank (150 ⁇ l/site) on days 0 and 7.
- SCH mouse spinal cord homogenate
- mice were followed through the acute phase of disease and on day 27 analysis of the acute phase of disease was performed to select two groups with similar disease profiles in the acute phase (day of onset, peak disease score, cumulative clinical score and weight loss).
- Two groups of 12 mice were selected for dosing with antibody at 10 mg/kg, sc on days 28, 35, 42 and 49.
- One group was dosed with Ab#13 mIgG1) the other with 101.4 (isotype control).
- FIGS. 1, 2 and 3 A significant delay in the onset of the acute phase and a reduced severity and incidence of first relapse was observed ( FIGS. 1, 2 and 3 ).
- FIG. 1 A significant delay in the onset of the acute phase and a reduced severity and incidence of first relapse was observed ( FIGS. 1, 2 and 3 ).
- FIG. 2 shows that Ab#13 mIgG1dosed through the acute phase had no effect on the incidence of disease in the acute phase (Ab#13
- FIGS. 4, 5 and 6 show that the dose groups selected to have a similar acute phase profile, showed no significant differences in any of the parameters analysed.
- Ab#13 mIgG1 antibody was dosed in separate experiments over the acute phase of disease (prophylactic dosing) and over the relapse phase (therapeutic dosing). Effects were most pronounced on relapse with a significant reduction in the incidence and severity of the relapse phase for both dosing regimes.
- a Fab fragment termed Ab#13 Fab-Di-PEG was produced essentially as described in International Patent Application PCT/GB2004/002810 (filed on 1 Jul. 2004).
- the Fab consisted of the rabbit variable regions of antibody 13 from example 1 and mouse IgG1 constant regions. In contrast to other Fab fragments, the heavy chain constant region of this Fab terminates at the interchain cysteine of C H 1.
- PCR primers were designed based on the murine IgG1 CH1 region and PCR mutagenesis used to insert a stop codon immediately following the interchain cysteine of C H 1.
- the mouse constant regions are shown in FIG. 13 and in SEQ ID Nos 3 (heavy chain) and 4 (light chain).
- PCR mutagenesis was also used to replace the cysteine at position 80 of the rabbit light chain variable region with alanine.
- Murine CH1 (SEQ ID NO:3) KTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVH TFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD C * Murine Kappa (SEQ ID NO:4) DAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGV LNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSF NRGE C *
- the Fab fragments were produced in E. coli strain W3110 and purified using standard methods (Humphreys et al., 2002, Protein Expression and Purification, 26, 309-320).
- 2 ⁇ 20 kDa PEG was attached to the Fab fragment by attaching a linear 20 kDa PEG to each of the interchain cysteines (underlined in the sequences above). Reductions and PEGylations were performed in 50 mM Tris.HCl 5 mM EDTA pH 7.14 with Fab at 20.06 mg/ml. The Fab was reduced at room temperature ( ⁇ 24° C.) for 30 minutes using 10 mM tris(2-carboxyethyl)phosphine (TCEP) (final). The Fab was desalted on a PD-10 column (Pharmacia) and then mixed with 4 fold molar excess of linear 20 kDa PEG-maleimide over Fab.
- TCEP tris(2-carboxyethyl)phosphine
- the 20 kDa PEG was from Nippon Oils and Fats (NOF).
- PEGylated Fab was separated from unPEGylated Fab by size exclusion HPLC on analytical Zorbax GF-450 and GF-250 columns in series. These were developed with a 30 min isocratic gradient of 0.2M phosphate pH 7.0+10% ethanol at 1 ml/min and Fab detected using absorbance at 214 nm and 280 nm.
- mice 8-10 weeks of age were immunised with mouse spinal cord homogenate (SCH, 3.33 mg/ml) in complete Freund's adjuvant in two sites, sc, on the flanks (150 ⁇ l/site) on days 0 and 7.
- mouse spinal cord homogenate SCH, 3.33 mg/ml
- complete Freund's adjuvant in two sites, sc, on the flanks (150 ⁇ l/site) on days 0 and 7.
- FIG. 7 a shows the effect of anti-IL17 Ab#13 di Fab-PEG and Ab#13 mIgG1 on clinical disease when dosed from remission (black arrowheads represent dosing days). When dosed prior to first relapse all active doses showed a significant reduction in cumulative and maximum clinical score and incidence.
- FIG. 8 shows that during the acute phase, prior to antibody treatment, all assigned groups showed no significant differences in disease onset or clinical severity prior to antibody dosing.
- FIG. 9 shows that anti-mouse IL-17 antibodies dosed prior to relapse onset during remission showed a significant reduction in maximum clinical score (Ab#13 di Fab-PEG 100 mg/kg vs. PBS p ⁇ 0.05 and IL-17 Ab#13 mIgG1 vs. PBS p ⁇ 0.001),
- Anti-mouse IL17 antibodies (Ab#13 di Fab-PEG and Ab#13 mIgG1) were dosed in a dose dependent manner during the remission phase prior to onset of first relapse. Effects were pronounced with a significant reduction for both antibodies in relapse incidence and upon maximum and cumulative disease score in comparison to the PBS control group.
- the chronic EAE model used was essentially as described by Copray et al., 2004. Journal of Neuroimmunology, 148:41-53.
- mice Female C57B1/6 mice 6-8 weeks of age (Charles River) were immunised with Myelin Oligodendrocyte Protein (MOG 35-55, 0.66 mg/ml) in complete Freund's adjuvant (0.4 mg/ml Mycobacterium; 4:1 M.tuberculosis: M butyricum) in two sites, s.c, on the flanks (150 ⁇ l/site) on days 0 and 7. Mice were also administered pertussis toxin (1 ⁇ g/ml) on days 0,1,7,8; 200 ⁇ l i.p
- FIG. 10 shows that prophylactic dosing (a) of Ab#13 mIgG1 elicited significant delay in the onset of disease, cumulative and maximum clinical score.
- Anti-mouse IL17 antibody Ab#13 mIgG1 was dosed in separate experiments prophylactically and therapeutically. Effects were most pronounced prophylactically with a significant reduction in maximum and cumulative disease score, furthermore incidence of disease was significantly delayed. Therapeutic treatment showed a reduction in cumulative disease score.
Abstract
Description
- The present invention relates generally to methods of treating multiple sclerosis and more specifically to the use of inhibitors of IL-17 activity for the manufacture of a medicament for the treatment of multiple sclerosis.
- Interleukin 17 (IL-17), also known as CTLA-8 or IL-17A, is a pro-inflammatory cytokine which stimulates the secretion of a wide range of other cytokines from various non-immune cells. IL-17 is capable of inducing the secretion of IL-6, IL-8, PGE2, MCP-1 and G-CSF by adherent cells like fibroblasts, keratinocytes, epithelial and endothelial cells and is also able to induce ICAM-1 surface expression, proliferation of T cells, and growth and differentiation of CD34+human progenitors into neutrophils when cocultured in presence of irradiated fibroblasts (Fossiez et al., 1998, Int. Rev. Immunol. 16, 541-551). IL-17 is predominantly produced by activated memory T cells and acts by binding to a ubiquitously distributed cell surface receptor (IL-17R) (Yao et al., 1997, Cytokine, 9, 794-800). A number of homologues of IL-17 have been identified which have both similar and distinct roles in regulating inflammatory responses. For a review of IL-17 cytokine/receptor families see Dumont, 2003, Expert Opin. Ther. Patents, 13, 287-303.
- IL-17 may contribute to a number of diseases mediated by abnormal immune responses, such as rheumatoid arthritis and air-way inflammation, as well as organ transplant rejection and antitumour immunity. Inhibitors of IL-17 activity are well known in the art, for example an IL-17R:Fc fusion protein was used to demonstrate the role of IL-17 in collagen-induced arthritis (Lubberts et al., J. Immunol. 2001,167, 1004-1013) and neutralising polyclonal antibodies have been used to reduce peritoneal adhesion formation (Chung et al., 2002, J. Exp. Med., 195, 1471-1478). Neutralising monoclonal antibodies are commercially available (R&D Systems UK).
- Multiple sclerosis (MS) is a chronic, inflammatory, demyelinating disease of the central nervous system (CNS), which is believed to result from a coordinated autoimmune attack against myelin antigens. There is considerable clinical and pathological heterogeneity in MS patients and the sequence of events that initiate the disease remain largely unknown. The clinical progression of MS may be largely attributed to three disease processes; inflammation, demyelination and axonal loss/neurodegeneration.
- Immune mediated inflammatory lesions within the CNS are thought to result primarily from an infiltration of autoreactive CD4+ lymphocytes (Th1) which recognise myelin proteins presented on MHC class II molecules by antigen presenting cells. This interaction causes stimulation of Th1 cells which release proinflammatory cytokines (mainly TNF-α & IFN-γ) resulting in proliferation of T-cells, activation of B-cells and macrophages, upregulation of adhesion molecules and disruption of the blood-brain barrier. Such events ultimately lead to loss of oligodendrocytes & axons and the formation of a demyelinated plaque. This is the hallmark of MS and consists of a demarcated lesion where myelin sheaths are completely lost and demyelinated axons are embedded in glial scar tissue. Demyelination may also occur as a consequence of specific recognition and opsonization of myelin antigens by autoantibodies. The most important target antigen is suggested to be myelin oligodendrocyte protein (MOG), which is present on the surface of the myelin sheath. Destruction of antibody-opsonized myelin is then accomplished either by complement or activated macrophages. Axonal loss and neurodegeneration subsequent to inflammation are thought to be responsible for the accumulation of irreversible neurological impairment, characteristic of secondary progressive MS.
- The clinical features of MS vary from headaches and blurred vision to severe ataxia, blindness and paralysis. MS affects all ages but first symptoms generally occur between 18 and 50 years and disease duration has been estimated at >25 years with a significant proportion of patients dying from causes unrelated to MS. In the majority of patients (˜80%) the disease takes a relapsing-remitting (RR-MS) course with exacerbation of symptoms, which is rapid in onset (hours to days) followed by a slower recovery. The frequency and duration of relapses are unpredictable but average 1.5 per year and can be followed by complete recovery. With time, recovery from relapses may not be complete and a gradual worsening of disease occurs. This worsening of disease is independent of relapse rate and is classified as secondary progressive MS (SP-MS), accounting for approximately 10% of MS patients. The remaining 10% of MS patients have a primary progressive (PP-MS) course where disability worsens at a steadv rate from onset of the disease.
- Currently licensed therapies are the beta-interferons; Interferon beta-1b (Betaseron; Berlex), Interferon beta-1a (Avonex; Biogen, Rebif; Serono) and glatimer acetate (Copaxone; Teva). These agents have been shown to reduce relapse rate during the relapsing-remitting phase of the disease in approximately 30% of patients. There is currently no method available for identifying the responder population before therapy. Intravenous steroids (prednisolone is most commonly used) are used to hasten remission after relapse but do not have long term efficacy. The anti-cancer agent, mitoxantrone (Novantrone), is approved as an immunosuppressant in progressive-relapsing and secondary-progressive patients, but its use and dose is limited by cardiotoxicity. In Europe azathioprine has also been used as an immunosuppressant.
- Prescribing decisions seem to be driven by evidence-based medicine and a recent report by the American Association of Neurologists (Goodin D S et al; Neurology Jan. 22, 2002;58(2):169-78) is a key document. The consensus amongst many neurologists is that early, aggressive therapy with beta-interferons was desirable in increasing the time to first relapse and limiting the overall disease load, although it was recognised that there was no evidence that this approach showed long-term benefit on EDSS score (a measure of disease-related disability). Beta-interferons were seen as sub-optimal therapy and glatirimer acetate as having a different mechanism of action, which may allow it to be used (alone or in combination) in patients that do not respond to interferons. Individualised therapy based on mechanistic (MRI, genetic, neurological) markers of disease was seen as a worthwhile goal, as were therapies with a novel mechanism of action. There is currently no satisfactory diagnostic marker for multiple sclerosis.
- There is a clear need for disease modifying therapies. Agents with different mechanisms of action are needed and may allow therapy to be tailored to different stages of the disease. An orally active agent is yet to be licensed in the relapsing-remitting form of the disease and this would represent a clear improvement over current therapy if significant efficacy was associated with the mechanism. Furthermore, there is a clear requirement for therapies that show efficacy in the primary or secondary progressive phases of the disease and have a reasonable side-effect profile.
- Whether IL-17 plays any kind of role in the pathogenesis of MS is unknown. Microarray analysis of MS lesions obtained at autopsy have revealed increased transcripts of many different genes encoding inflammatory cytokines, including, IL-17 (Lock et al., 2002, Nature Medicine, 8, 500-508). An increased number of IL-17 expressing mononuclear cells have been detected in blood and cerebrospinal fluid from patients with MS (Matusevicius et al., 1999, Multiple Sclerosis, 5, 101-104) but as the authors point out cytokine mRNA expression is not necessarily identical to cytokine protein production.
- Surprisingly we have been able to demonstrate that inhibitors of IL-17 activity are active in an animal model of MS. Specifically we have been able to demonstrate that an anti-IL-17 antibody that inhibits IL-17 activity is active in animal models of MS. Hence, the present invention provides a method for the treatment and/or prophylaxis of MS comprising administering a therapeutically effective amount of an inhibitor of IL-17 activity. The invention also provides the use of an inhibitor of IL-17 activity for the manufacture of a medicament for the treatment and/or prophylaxis of multiple sclerosis.
- The term ‘IL-17 activity’ as used herein refers to the spectrum of activity understood in the art for IL-17 for example, the induction of secretion of IL-6 or IL-8 from fibroblasts by IL-17 (Yao et al., 1995, Journal of Immunology, 155,5483-5486).
- An inhibitor of IL-17 activity according to the present invention is an agent that interferes with the activity of IL-17, in particular the activity of IL-17 in MS. Particularly preferred are agents which interfere with the activity of IL-17 in MS in humans. Inhibitors according to the present invention may partially or completely inhibit IL-17 activity. Inhibitors of use in the present invention include without limitation, inhibitors that are capable of interacting with (e.g. binding to, or recognising) IL-17 or the IL-17 receptor (L17 R) or a nucleic acid molecule encoding IL-17 or IL-17R, or are capable of inhibiting the expression of IL-17 or IL-17R or are capable of inhibiting the interaction between IL-17 and IL-17R. Such inhibitors may be, without limitation, antibodies, nucleic acids (e.g. DNA, RNA, antisense RNA and siRNA), carbohydrates, lipids, proteins, polypeptides, peptides, peptidomimetics, small molecules and other drugs.
- Examples of suitable inhibitors include, but are not limited to, a synthetic functional fragment of the IL-17 receptor that binds to IL-17 and interferes with binding to the native IL-17 receptor, an antibody that binds to IL-17 or to the IL-17 receptor and interferes with IL-17 receptor-ligand interaction, an antisense nucleic acid molecule that specifically hybridizes to mRNA encoding IL-17 or the IL-17 receptor or a small molecule or other drug which inhibits the activity of IL-17 or its receptor.
- Inhibitors of IL-17 activity are well known in the art as are methods of identifying and producing such inhibitors. Examples include, IL-17R:Fc fusion proteins (Lubberts et al., J. Immunol. 2001,167, 1004-1013) and neutralising antibodies (Chung et al., 2002, J. Exp. Med., 195, 1471-1478; Ferretti, 2003, Journal of Immunology, 170, 2106-2112). Agents that may be suitable inhibitors can be selected from a wide variety of candidate agents. Examples of candidate agents include but are not limited to, nucleic acids (e.g. DNA and RNA), carbohydrates, lipids, proteins, polypeptides, peptides, peptidomimetics, small molecules and other drugs. Agents can be obtained using any of the numerous approaches in combinatorial library methods known in the art, including: biological libraries; spatially addressable parallel solid phase or solution phase libraries; synthetic library methods requiring deconvolution; the “one-bead one-compound” library method; and synthetic library methods using affinity chromatography selection. The biological library approach is suited to peptide libraries, while the other four approaches are applicable to peptide, non-peptide oligomer or small molecule libraries of compounds (Lam, 1997, Anticancer Drug Des. 12:145; U.S. Pat. No. 5,738,996; and U.S. Pat. No. 5,807,683).
- Examples of suitable methods based on the present description for the synthesis of molecular libraries can be found in the art, for example in: DeWitt et al., 1993, Proc. Natl. Acad. Sci. USA 90:6909; Erb et al., 1994, Proc. Natl. Acad. Sci. USA 91:11422; Zuckermann et al., 1994, J. Med. Chem. 37:2678; Cho et al., 1993, Science 261:1303; Carrell et al., 1994, Angew. Chem. Int. Ed. Engl. 33:2059; Carell et al., 1994, Angew. Chem. Int. Ed. Engl. 33:2061; and Gallop et al., 1994, J. Med. Chem. 37:1233.
- Libraries of compounds may be presented, for example, in solution (e.g. Houghten, 1992, Bio/Techniques 13:412-421), or on beads (Lam, 1991, Nature 354:82-84), chips (Fodor, 1993, Nature 364:555-556), bacteria (U.S. Pat. No. 5,223,409), spores (U.S. Pat. Nos. 5,571,698; 5,403,484; and 5,223,409), plasmids (Cull et al., 1992, Proc. Natl. Acad. Sci. USA 89:1865-1869) or phage (Scott and Smith, 1990, Science 249:386-390; Devlin, 1990, Science 249:404-406; Cwirla et al., 1990, Proc. Natl. Acad. Sci. USA 87:6378-6382; and Felici, 1991, J. Mol. Biol. 222:301-310).
- In one example, the inhibitor for use in the present invention may be a nucleic acid. In particular IL-17 or IL-17R nucleic acid molecules maybe used as anti-sense molecules, to alter the expression of their respective polypeptides by binding to complementary nucleic acids. IL-17 or IL-17R nucleic acids may be obtained using standard cloning techniques from for example genomic DNA or cDNA or can be synthesised using well known and commercially available techniques. The IL-17 or IL-17R nucleic acids may contain one or more nucleotide substitutions, additions or deletions into the nucleotide sequence of an IL-17 or IL-17R nucleic acid. Standard techniques known to those of skill in the art can be used to introduce mutations, including, for example, site-directed mutagenesis and PCR-mediated mutagenesis. An antisense nucleic acid according to the present invention includes a IL-17 or IL-17R nucleic acid capable of hybridising by virtue of some sequence complementarity to a portion of an RNA (preferably mRNA) encoding the respective polypeptide. The antisense nucleic acid can be complementary to a coding and/or non-coding region of an mRNA encoding such a polypeptide. Most preferably, the antisense nucleic acids result in inhibition of the expression of the IL-17 or IL-17R polypeptide. Thus, the present invention provides a method for the treatment and/or prophylaxis of MS comprising administering a therapeutically effective amount of an inhibitor of IL-17 activity wherein the inhibitor comprises at least eight nucleotides that are antisense to a gene or cDNA encoding a IL-17 or IL-17R polypeptide. The invention also provides the use of nucleic acids comprising at least eight nucleotides that are antisense to a gene or cDNA encoding a IL-17 or IL-17R polypeptide for the manufacture of a medicament for the treatment and/or prophylaxis of MS.
- Most preferably, an inhibitor for use in the treatment and/or prophylaxis of MS is an antibody that interacts with (i.e. binds to or recognises) IL-17 or its receptor and inhibits the activity of IL-17. Accordingly, there is provided the use of an antibody that inhibits the activity of IL-17 for the manufacture of a medicament for the treatment and/or prophylaxis of MS. Also provided is a method of treatment and/or prophylaxis of MS in a subject comprising administering to said subject a therapeutically effective amount of an antibody that inhibits the activity of IL-17.
- In one example the antibodies selectively interact with IL-17. Selectively interacting with (e.g. recognising or binding to) means that the antibodies have a greater affinity for IL-17 polypeptides than for other polypeptides. Examples of suitable antibodies are those that inhibit the activity of IL-17 by binding to IL-17 in such a manner as to prevent it being biologically active, for example by preventing the binding of IL-17 to its receptor. Accordingly, there is provided by the present invention the use of an anti-IL-17 antibody for the manufacture of a medicament for the treatment and/or prophylaxis of MS. Also provided is a method of treatment and/or prophylaxis of MS in a subject comprising administering to said subject a therapeutically effective amount of an anti-IL-17 antibody.
- In another example the antibodies selectively interact with the IL-17 receptor. Selectively interacting with (e.g. recognising or binding to) means that the antibodies have a greater affinity for the IL-17 receptor polypeptide than for other polypeptides. Examples of suitable antibodies are those that inhibit the activity of IL-17 by preventing IL-17 mediated signalling from the receptor, for example by preventing IL-17 from binding to the IL-17 receptor. Accordingly, there is provided by the present invention the use of an anti-IL-7R antibody for the manufacture of a medicament for the treatment and/or prophylaxis of MS. Also provided is a method of treatment and/or prophylaxis of MS in a subject comprising administering to said subject a therapeutically effective amount of an anti-IL-17R antibody.
- IL-17 or IL-17 receptor polypeptides or cells expressing said polypeptides can be used to produce antibodies which specifically recognise said polypeptides. The IL-17 and IL-17R polypeptides may be ‘mature’ polypeptides or biologically active fragments or derivatives thereof. IL-17 and IL-17R polypeptides may be prepared by processes well known in the art from genetically engineered host cells comprising expression systems or they may be recovered from natural biological sources. In the present application, the term “polypeptides” includes peptides, polypeptides and proteins. These are used interchangeably unless otherwise specified. IL-17 or IL-17R polypeptides may in some instances be part of a larger protein such as a fusion protein for example fused to an affinity tag. Antibodies generated against these polypeptides may be obtained by administering the polypeptides to an animal, preferably a non-human animal, using well-known and routine protocols, see for example Handbook of Experimental Immunology, D. M. Weir (ed.),
Vol 4, Blackwell Scientific Publishers, Oxford, England, 1986. Many warm-blooded animals, such as rabbits, mice, rats, sheep, chickens, cows or pigs may be immunised. However, mice, rabbits, pigs and rats are generally preferred. - Anti-IL-17 and anti-IL-17 receptor antibodies for use in the present invention include whole antibodies and functionally active fragments or derivatives thereof and may be, but are not limited to, polyclonal, monoclonal, multi-valent, multi-specific, humanized or chimeric antibodies, single chain antibodies, Fab fragments, Fab′ and F(ab′)2 fragments, fragments produced by a Fab expression library, anti-idiotypic (anti-Id) antibodies, and epitope-binding fragments of any of the above. Antibodies include immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, i.e. molecules that contain an antigen binding site that specifically binds an antigen. The immunoglobulin molecules of the invention can be of any class (e.g. IgG, IgE, IgM, IgD and IgA) or subclass of immunoglobulin molecule.
- Monoclonal antibodies may be prepared by any method known in the art such as the hybridoma technique (Kohler & Milstein, 1975, Nature, 256:495-497), the trioma technique, the human B-cell hybridoma technique (Kozbor et al., 1983, Immunology Today, 4:72) and the EBV-hybridoma technique (Cole et al., Monoclonal Antibodies and Cancer Therapy, pp 77-96, Alan R Liss, Inc., 1985).
- Antibodies for use in the invention may also be generated using single lymphocyte antibody methods by cloning and expressing immunoglobulin variable region cDNAs generated from single lymphocytes selected for the production of specific antibodies by for example the methods described by Babcook, J. et al., 1996, Proc. Natl. Acad. Sci. USA 93(15):7843-7848 and in WO92/02551.
- Humanized antibodies are antibody molecules from non-human species having one or more complementarity determining regions (CDRs) from the non-human species and a framework region from a human immunoglobulin molecule (see, e.g. U.S. Pat. No. 5,585,089).
- Chimeric antibodies are those antibodies encoded by immunoglobulin genes that have been genetically engineered so that the light and heavy chain genes are composed of immunoglobulin gene segments belonging to different species. These chimeric antibodies are likely to be less antigenic. Bivalent antibodies may be made by methods known in the art (Milstein et al., 1983, Nature 305:537-539; WO 93/08829, Traunecker et al., 1991, EMBO J. 10:3655-3659). Multi-valent antibodies may comprise multiple specificities or may be monospecific (see for example WO 92/22853).
- The antibodies for use in the present invention can also be generated using various phage display methods known in the art and include those disclosed by Brinkman et al. (in J. Immunol. Methods, 1995, 182: 41-50), Ames et al. (J. Immunol. Methods, 1995, 184:177-186), Kettleborough et al. (Eur. J. Immunol. 1994, 24:952-958), Persic et al. (Gene, 1997 187 9-18), Burton et al. (Advances in Immunology, 1994, 57:191-280) and WO 90/02809; WO 91/10737; WO 92/01047; WO 92/18619; WO 93/11236; WO 95/15982; WO 95/20401; and U.S. Pat. Nos. 5,698,426; 5,223,409; 5,403,484; 5,580,717; 5,427,908; 5,750,753; 5,821,047; 5,571,698; 5,427,908; 5,516,637; 5,780,225; 5,658,727; 5,733,743 and 5,969,108. Techniques for the production of single chain antibodies, such as those described in U.S. Pat. No. 4,946,778 can also be adapted to produce single chain antibodies to IL-17 or IL-17R polypeptides. Also, transgenic mice, or other organisms, including other mammals, may be used to express humanized antibodies.
- Antibody fragments and methods of producing them are well known in the art, see for example Verma et al., 1998, Journal of Immunological Methods, 216, 165-181.
- Particular examples of antibody fragments for use in the present invention are Fab′ fragments which possess a native or a modified hinge region. A number of modified hinge regions have already been described, for example, in U.S. Pat. No. 5,677,425, WO9915549, and WO9825971 and these are incorporated herein by reference
- Further examples of particular antibody fragments for use in the present invention include those described in International patent applications PCT/GB2004/002810, PCT/GB2004/002870 and PCT/GB2004/002871 (all filed on 1 Jul. 2004). In particular the modified antibody Fab fragments described in International patent application PCT/GB2004/002810 are preferred. These Fab fragments comprise a heavy and light chain pair, VH/
C H1 and VL/CL covalently linked through interchain cysteines in the heavy and light chain constant regions and are characterised in that the heavy chain constant region terminates at the interchain cysteine ofC H1. The term ‘interchain cysteine’ refers to a cysteine in the heavy or light chain constant region that would be disulphide linked to a cysteine in the corresponding heavy or light chain constant region encoded in a naturally occurring germline antibody gene. In particular the interchain cysteines are a cysteine in the constant region of the light chain (CL) and a cysteine in the first constant region of the heavy chain (CH1) that are disulphide linked to each other in naturally occurring antibodies. Examples of such cysteines may typically be found at position 214 of the light chain and position 233 of the heavy chain of human IgG1, position 127 of the heavy chain of human IgM, IgE, IgG2, IgG3, IgG4 and position 128 of the heavy chain of human IgD and IgA2B, as defined by Kabat et al., 1987, in Sequences of Proteins of Immunological Interest, US Department of Health and Human Services, NIH, USA. In murine IgG, interchain cysteines may be found at position 214 of the light chain and position 235 of the heavy chain. It will be appreciated that the exact positions of these cysteines may vary from that of naturally occurring antibodies if any modifications, such as deletions, insertions and/or substitutions have been made to the antibody Fab fragment. These antibody Fab fragments may be prepared by any suitable method known in the art. For example, the antibody Fab fragment may be obtained from any whole antibody, especially a whole monoclonal antibody, using any suitable enzymatic cleavage and/or digestion techniques, for example by treatment with pepsin or papain and c-terminal proteases. Preferably these antibody Fab fragments are prepared by the use of recombinant DNA techniques involving the manipulation and re-expression of DNA encoding antibody variable and constant regions. Standard molecular biology techniques may be used to modify, add or delete further amino acids or domains as desired. Any alterations to the variable or constant regions are still encompassed by the terms ‘variable’ and ‘constant’ regions as used herein. Preferably PCR is used to introduce a stop codon immediately following the codon encoding the interchain cysteine ofC H1, such that translation of theC H1 domain stops at the interchain cysteine. Methods for designing suitable PCR primers are well known in the art and the sequences ofantibody C H1 domains are readily available (Kabat et al., supra). Alternatively stop codons may be introduced using site-directed mutagenesis techniques such as those described in White (Ed.), PCR Protocols: Current Methods and Applications (1993). In one example the constant regions in these fragments are derived from IgG1 and the interchain cysteine of CL is at position 214 of the light chain and the interchain cysteine ofC H1 is at position 233 of the heavy chain. Examples of human and murine constant region sequences for use in these fragments are provided in SEQ ID Nos 1-4 andFIG. 13 ; human heavy chainconstant region C H1 which terminates at the interchain cysteine (SEQ ID NO:1); human light chain constant region (SEQ ID NO:2); murine heavy chainconstant region C H1 which terminates at the interchain cysteine (SEQ ID NO:3); murine light chain constant region (SEQ ID NO:4). - If desired an antibody for use in the present invention may be conjugated to one or more effector molecule(s). The term effector molecule as used herein includes, for example, antineoplastic agents, drugs, toxins, biologically active proteins, for example enzymes, other antibody or antibody fragments, synthetic or naturally occurring polymers, nucleic acids and fragments thereof e.g. DNA, RNA and fragments thereof, radionuclides, particularly radioiodide, radioisotopes, chelated metals, nanoparticles and reporter groups such as fluorescent compounds or compounds which may be detected by NMR or ESR spectroscopy. In one example, anti-IL-17 or anti IL-17R antibodies can be conjugated to an effector molecule, such as a cytotoxic agent, a radionuclide or drug moiety to modify a given biological response. For example, the therapeutic agent may be a drug moiety which may be a protein or polypeptide possessing a desired biological activity. Such moieties may include, for example and without limitation, a toxin such as abrin, ricin A, pseudomonas exotoxin, or diphtheria toxin, a protein such as tumour necrosis factor, α-interferon, β-interferon, nerve growth factor, platelet derived growth factor or tissue plasminogen activator, a thrombotic agent or an anti-angiogenic agent, e.g. angiostatin or endostatin, or, a biological response modifier such as a lymphokine, interleukin-1 (IL-1), interleukin-2 (IL-2), interleukin-6 (IL-6), granulocyte macrophage colony stimulating factor (GM-CSF), granulocyte colony stimulating factor (G-CSF), nerve growth factor (NGF) or other growth factor.
- In another example the effector molecules may be cytotoxins or cytotoxic agents including any agent that is detrimental to (e.g. kills) cells. Examples include taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin and analogs or homologs thereof. Effector molecules also include, but are not limited to, antimetabolites (e.g. methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, 5-fluorouracil decarbazine), alkylating agents (e.g. mechlorethamine, thioepa chlorambucil, melphalan, carmustine (BSNU) and lomustine (CCNU), cyclothosphamide, busulfan, dibromomannitol, streptozotocin, mitomycin C, and cis-dichlorodiamine platinum (II) (DDP) cisplatin), anthracyclines (e.g. daunorubicin (formerly daunomycin) and doxorubicin), antibiotics (e.g. dactinomycin (formerly actinomycin), bleomycin, mithramycin, anthramycin (AMC), calicheamicins or duocarmycins), and anti-mitotic agents (e.g. vincristine and vinblastine).
- Other effector molecules may include radionuclides such as 111In and 90Y, Lu177, Bismuth213, Californium252, Iridium192 and Tungsten188/Rhenium188; or drugs such as but not limited to, alkylphosphocholines, topoisomerase I inhibitors, taxoids and suramin. Techniques for conjugating such effector molecules to antibodies are well known in the art (see, Hellstrom et al., Controlled Drug Delivery, 2nd Ed., Robinson et al., eds., 1987, pp. 623-53; Thorpe et al., 1982, Immunol. Rev., 62:119-58 and Dubowchik et al., 1999, Pharmacology and Therapeutics, 83, 67-123). In one example, the antibody or fragment thereof is fused via a covalent bond (e.g. a peptide bond), at optionally the N-terminus or the C-terminus, to an amino acid sequence of another protein (or portion thereof; preferably at least a 10, 20 or 50 amino acid portion of the protein). Preferably the antibody, or fragment thereof, is linked to the other protein at the N-terminus of the constant domain of the antibody. Recombinant DNA procedures may be used to create such fusions, for example as described in WO 86/01533 and EP 0392745.
- In another example the effector molecule may increase half-life in vivo, and/or decrease immunogenicity and/or enhance the delivery of an antibody across an epithelial barrier to the immune system. Examples of suitable effector molecules include polymers and proteins such as albumin and albumin binding proteins. Examples of suitable polymers include any synthetic or naturally occurring substantially water-soluble, substantially non-antigenic polymer including, for example, optionally substituted straight or branched chain polyalkylene, polyalkenylene, or polyoxyalkylene polymers or branched or unbranched polysaccharides, e.g. a homo- or hetero-polysaccharide such as lactose, amylose, dextran or glycogen. Particular optional substituents which may be present on the above-mentioned synthetic polymers include one or more hydroxy, methyl or methoxy groups. Particular examples of synthetic polymers include optionally substituted straight or branched chain poly(ethyleneglycol), poly(propyleneglycol), poly(vinylalcohol) or derivatives thereof, especially optionally substituted poly(ethyleneglycol) such as methoxypoly(ethyleneglycol). Preferably the polymer is a polyalkylene oxide such as polyethylene glycol (PEG).
- In one example antibodies for use in the present invention are attached to poly(ethyleneglycol) (PEG) moieties. In one particular example the antibody is an antibody fragment and the PEG molecules may be attached through any available amino acid side-chain or terminal amino acid functional group located in the antibody fragment, for example any free amino, imino, thiol, hydroxyl or carboxyl group. Such amino acids may occur naturally in the antibody fragment or may be engineered into the fragment using recombinant DNA methods. See for example U.S. Pat. No. 5,219,996. Multiple sites can be used to attach two or more PEG molecules. Preferably PEG molecules are covalently linked through a thiol group of at least one cysteine residue located in the antibody fragment. Where a thiol group is used as the point of attachment appropriately activated effector molecules, for example thiol selective derivatives such as maleimides and cysteine derivatives may be used.
- Preferably, the antibody is a modified Fab fragment, such as a Fab′ which is PEGylated, i.e. has PEG (poly(ethyleneglycol)) covalently attached thereto, e.g. according to the method disclosed in EP 0948544 [see also “Poly(ethyleneglycol) Chemistry, Biotechnical and Biomedical Applications”, 1992, J. Milton Harris (ed), Plenum Press, New York, “Poly(ethyleneglycol) Chemistry and Biological Applications”, 1997, J. Milton Harris and S. Zalipsky (eds), American Chemical Society, Washington D.C. and “Bioconjugation Protein Coupling Techniques for the Biomedical Sciences”, 1998, M. Aslam and A. Dent, Grove Publishers, New York; Chapman, A. 2002, Advanced Drug Delivery Reviews 2002, 54:531-545]. The total amount of PEG attached to the fragment may be varied as desired, but will generally be in an average molecular weight range from 250 to 100,000Da, preferably from 5,000 to 50,000Da, more preferably from 10,000 to 40,000Da and still more preferably from 20,000 to 40,000Da The size of PEG may in particular be selected on the basis of the intended use of the product, for example ability to localize to certain tissues such as tumors or extend circulating half-life (for review see Chapman, 2002, Advanced Drug Delivery Reviews, 54, 531-545).
- In one embodiment PEG is attached to a cysteine in the hinge region of a Fab′. In one example, a PEG modified Fab′ fragment has a maleimide group covalently linked to a single thiol group in a modified hinge region. A lysine residue may be covalently linked to the maleimide group and to each of the amine groups on the lysine residue may be attached a methoxypoly(ethyleneglycol)polymer having a molecular weight of approximately 20,000 Da. The total molecular weight of the PEG attached to the Fab′ fragment may therefore be approximately 40,000 Da.
- In another preferred embodiment an antibody fragment for use in the present invention is a PEGylated (i.e. has PEG (poly(ethyleneglycol)) covalently attached thereto) Fab fragment as described in International Application Number PCT/GB2004/002810 (filed on 1 Jul. 2004). This PEGylated Fab fragment is a Fab fragment in which the heavy chain terminates at the interchain cysteine of
C H1 and the PEG attached to the fragment, preferably PEG-maleimide, is covalently linked to the interchain cysteine of CL and the interchain cysteine ofC H1. Preferably the interchain cysteine of CL is at position 214 of the light chain and the interchain cysteine ofC H1 is at position 233 of the heavy chain. As discussed above the total amount of PEG attached to the fragment may be varied as desired. In one example each polymer attached to the Fab preferably has a molecular weight of approximately 20,000 Da. For example, the molecular weight may be 15,000-25,000Da, or preferably 18,000-22,000Da, and even more preferably 19,000-21,000Da. The total molecular weight of the PEG attached to the antibody is therefore approximately 40,000 Da. - PEG is attached to these fragments by first reducing the interchain disulphide bond between the interchain cysteines of CL and
C H1 and subsequently attaching the PEG to the free thiols. Once PEG is attached to the interchain cysteines there is no interchain disulphide linkage between the heavy and light chain. Suitable reducing agents for reducing the interchain disulphide bond are widely known in the art for example those described in Singh et al., 1995, Methods in Enzymology, 251, 167-73. Particular examples include thiol based reducing agents such as reduced glutathione (GSH), β-mercaptoethanol (β-ME), β-mercaptoethylamine (β-MA) and dithiothreitol (DTT). Other methods include using electrolytic methods, such as the method described in Leach et al., 1965, Div. Protein. Chem, 4, 23-27 and using photoreduction method such as the method described in Ellison et al., 2000, Biotechniques, 28 (2), 324-326. Preferably however, the reducing agent is a non-thiol based reducing agent, preferably one of the trialkylphosphine reducing agents (Ruegg U T and Rudinger, J., 1977, Methods in Enzymology, 47, 111-126; Burns J et al., 1991, J. Org. Chem, 56, 2648-2650; Getz et al., 1999, Analytical Biochemistry, 273, 73-80; Han and Han, 1994, Analytical Biochemistry, 220, 5-10; Seitz et al., 1999, Euro. J. Nuclear Medicine, 26, 1265-1273), particular examples of which include tris(2-carboxyethyl)phosphine (TCEP), tris butyl phosphine (TBP), tris-(2-cyanoethyl) phosphine, tris-(3-hydroxypropyl)phosphine (THP) and tris-(2-hydroxyethyl)phosphine. Most preferred are the reducing agents TCEP and THP. It will be clear to a person skilled in the art that the concentration of reducing agent can be determined empirically, for example, by varying the concentration of reducing agent and measuring the number of free thiols produced. Typically the reducing agent is used in excess over the antibody fragment for example between 2 and 1000 fold molar excess. Preferably the reducing agent is in 2, 3, 4, 5, 10, 100 or 1000 fold excess. In one embodiment the reductant is used at between 2 and 5 mM. - The reduction and PEGylation reactions may generally be performed in a solvent, for example an aqueous buffer solution such as acetate or phosphate, at around neutral pH, for example around pH 4.5 to around pH 8.5, typically pH 4.5 to 8, suitably pH6 to 7. The reactions may generally be performed at any suitable temperature, for example between about 5° C. and about 70° C., for example at room temperature. The solvent may optionally contain a chelating agent such as EDTA, EGTA, CDTA or DTPA. Preferably the solvent contains EDTA at between 1 and 5 mM, preferably 2 mM. Alternatively or in addition the solvent may be a chelating buffer such as citric acid, oxalic acid, folic acid, bicine, tricine, tris or ADA. The PEG will generally be employed in excess concentration relative to the concentration of the antibody fragment. Typically the PEG is in between 2 and 100 fold molar excess, preferably 5, 10 or 50 fold excess.
- Where necessary, the desired product containing the desired number of PEG molecules may be separated from any starting materials or other product generated during the production process by conventional means, for example by chromatography techniques such as ion exchange, size exclusion, protein A, G or L affinity chromatography or hydrophobic interaction chromatography. To identify inhibitors of IL-17 activity a number of different approaches may be taken by those skilled in the art. In one example inhibitors are identified by first identifying agents that interact with IL-17 or IL-17R and subsequently testing those agents to identify those that inhibit IL-17 activity. In one such example the agent is an antibody.
- Agents that interact with IL-17 or IL-17R may be identified using any suitable method, for example by using a cell-free or cell-based assay system where the IL-17 or IL-17R polypeptide is contacted with a candidate agent and the ability of the candidate agent to interact with the polypeptide is determined. Preferably, the ability of a candidate agent to interact with a IL-17 or IL-17R polypeptide is compared to a reference range or control. If desired, this assay may be used to screen a plurality (e.g. a library) of candidate agents using a plurality of IL-17 or IL-17R polypeptide samples. In one example of a cell free assay, a first and second sample comprising native or recombinant IL-17 or IL-17R polypeptide are contacted with a candidate agent or a control agent and the ability of the candidate agent to interact with the polypeptide is determined by comparing the difference in interaction between the candidate agent and control agent. Preferably, the polypeptide is first immobilized, by, for example, contacting the polypeptide with an immobilized antibody which specifically recognizes and binds it, or by contacting a purified preparation of polypeptide with a surface designed to bind proteins. The polypeptide may be partially or completely purified (e.g. partially or completely free of other polypeptides) or part of a cell lysate. Further, the polypeptide may be a fusion protein comprising the IL-17 or IL-17R polypeptide or a biologically active portion thereof and a domain such as glutathionine-S-transferase or the Fc region of IgG1. Alternatively, the polypeptide can be biotinylated using techniques well known to those of skill in the art (e.g. biotinylation kit, Pierce Chemicals; Rockford, Ill.). The ability of the candidate agent to interact with the polypeptide can be determined by methods known to those of skill in the art for example, ELISA, BIAcore™, Flow cytometry or fluorescent microvolume assay technology (FMAT). In another example where a cell-based assay is used, a population of cells expressing IL-17 or IL-17R is contacted with a candidate agent and the ability of the candidate agent to interact with the polypeptide is determined. Preferably, the ability of a candidate agent to interact with IL-17 or IL-17R is compared to a reference range or control. The cell, for example, can be of eukaryotic origin (e.g. yeast or mammalian) and can express the IL-17 or IL-17R polypeptide endogenously or be genetically engineered to express the polypeptide. In some instances, the IL-17 or IL-17R polypeptide or the candidate agent is labelled, for example with a radioactive label (such as 32P, 35S or 125I) or a fluorescent label (such as fluorescein isothiocyanate, rhodamine, phycoerythrin, phycocyanin, allophycocyanin, o-phthaldehyde or fluorescamine) to enable detection of an interaction between a polypeptide and a candidate agent. Alternative methods such as ELISA, flow cytometry and FMAT may also be used.
- Agents which inhibit IL-17 activity may be identified by any suitable method, for example by:
-
- (i) comparing the activity of IL-17 in the presence of a candidate agent with the activity of said polypeptide in the absence of the candidate agent or in the presence of a control agent; and
- (ii) determining whether the candidate agent inhibits activity of IL-17.
- Such assays can be used to screen candidate agents, in clinical monitoring or in drug development.
- As described above, agents may be pre-screened where appropriate to identify agents (e.g. an antibody) that interact with IL-17 or IL-17R prior to screening those agents which bind for their ability to inhibit IL-17 activity.
- In one example a cell-based assay system is used to identify agents capable of inhibiting the activity of IL-17. In one particular example the assay used to identify inhibitors of IL-17 activity is the standard IL-6 release assay from fibroblasts (Yao et al., 1995, Journal of Immunology, 155,5483-5486). Potential inhibitors are added to the assay and IL-6 release determined by ELISA. Inhibition is therefore measured as a reduction in IL-6 release compared to controls.
- In another example inhibitors of IL-17 may down-regulate the expression of the IL-17 or IL-17R polypeptide, for example antisense inhibitors. Such inhibitors may be identified by any method known in the art. In one example such inhibitors are identified in a cell-based assay system. Accordingly, a population of cells expressing a IL-17 or IL-17R polypeptide or nucleic acid are contacted with a candidate agent and the ability of the candidate agent to alter expression of the IL-17 or IL-17R polypeptide or nucleic acid is determined by comparison to a reference range or control. In one example, populations of cells expressing a IL-17 or IL-17R polypeptide are contacted with a candidate agent or a control agent and the ability of the candidate agent to alter the expression of the IL-17 or IL-17R polypeptides or nucleic acids is determined by comparing the difference in the level of expression of the IL-17 or IL-17R polypeptides or nucleic acids between the treated and control populations of cells. If desired, this assay may be used to screen a plurality (e.g. a library) of candidate agents. The cell, for example, can be of eukaryotic origin (e.g. yeast or mammalian) and can express an IL-17 or IL-17R polypeptide endogenously or be genetically engineered to express a IL-17 or IL-17R polypeptide. The ability of the candidate agents to alter the expression of a said polypeptides or nucleic acids can be determined by methods known to those of skill in the art, for example and without limitation, by flow cytometry, radiolabelling, a scintillation assay, immunoprecipitation, Western blot analysis, Northern blot analysis or RT-PCR.
- Agents that inhibit the activity of IL-17 may be identified or further tested, for example to determine therapeutically effective amounts in one or more animal models. Examples of suitable animals include, but are not limited to, mice, rats, rabbits, monkeys, guinea pigs, dogs and cats. Preferably, the animal used represents a model of MS.
- In one example where the agent inhibits the expression of IL-17 or IL-17R, a first and second group of mammals are administered with a candidate agent or a control agent and the ability of the candidate agent to inhibit the expression of IL-17 or IL-17R polypeptide or nucleic acid is determined by comparing the difference in the level of expression between the first and second group of mammals. Where desired, the expression levels of the IL-17 or IL-17R polypeptides or nucleic acid in the first and second groups of mammals can be compared to the level of IL-17 or IL-17R polypeptide or nucleic acid in a control group of mammals. The candidate agent or a control agent can be administered by means known in the art (e.g. orally, rectally or parenterally such as intraperitoneally or intravenously). Changes in the expression of a polypeptide or nucleic acid can be assessed by the methods outlined above.
- In another example, the inhibition of IL-17 activity can be determined by monitoring an amelioration or improvement in disease symptoms, a delayed onset or slow progression of the disease, for example but without limitation, a reduction in paralysis. Techniques known to physicians familiar with MS can be used to determine whether a candidate agent has altered one or more symptoms associated with the disease.
- A number of different models of MS are known in the art ('t Hart and Amor 2003, Current Opinion in Neurology 16:375-83). In particular, experimental autoimmune encephalomyelitis (EAE) in ABH mice is considered to be a relevant model for MS in humans (Baker et al., 1990. Journal of Neuroimmunology, 28:261-270). Both acute and relapsing-remitting models have been developed.
- As discussed herein, inhibitors of IL-17 activity can be used in the treatment and/or prophylaxis of MS. For such use the agents will generally be administered in the form of a pharmaceutical composition.
- Also provided is a pharmaceutical composition comprising an inhibitor of IL-17 activity and a pharmaceutically acceptable carrier.
- The term ‘treatment’ includes either therapeutic or prophylactic therapy. When a reference is made herein to a method of treating or preventing a disease or condition using a particular inhibitor or combination of inhibitors, it is to be understood that such a reference is intended to include the use of that inhibitor or combination of inhibitors for the manufacture of a medicament for the treatment and/or prophylaxis of MS.
- The composition will usually be supplied as part of a sterile, pharmaceutical composition that will normally include a pharmaceutically acceptable carrier. This composition may be in any suitable form (depending upon the desired method of administering it to a patient).
- The inhibitors of use in the invention are preferably administered to a subject by a variety of other routes such as orally, transdermally, subcutaneously, intranasally, intravenously, intramuscularly, intrathecally and intracerebroventricularly. The most suitable route for administration in any given case will depend on the particular inhibitor, the subject, and the nature and severity of the disease and the physical condition of the subject.
- The inhibitors of use in the invention may be administered in combination, e.g. simultaneously, sequentially or separately, with one or more other therapeutically active compounds, which may be for example other anti-MS therapies or anti-cancer therapies.
- Pharmaceutical compositions may be conveniently presented in unit dose forms containing a predetermined amount of an active agent of the invention per dose. Such a unit may contain for example but without limitation, 750 mg/kg to 0.1 mg/kg depending on the condition being treated, the route of administration and the age, weight and condition of the subject.
- Pharmaceutically acceptable carriers for use in the invention may take a wide variety of forms depending, e.g. on the route of administration.
- Compositions for oral administration may be liquid or solid. Oral liquid preparations may be in the form of, for example, aqueous or oily suspensions, solutions, emulsions, syrups or elixirs, or may be presented as a dry product for reconstitution with water or other suitable vehicle before use. Oral liquid preparations may contain suspending agents as known in the art.
- In the case of oral solid preparations such as powders, capsules and tablets, carriers such as starches, sugars, microcrystalline cellulose granulating agents, lubricants, binders, disintegrating agents, and the like may be included. Because of their ease of administration, tablets and capsules represent the most advantageous oral dosage unit form in which case solid pharmaceutical carriers are generally employed. In addition to the common dosage forms set out above, active agents of the invention may also be administered by controlled release means and/or delivery devices. Tablets and capsules may comprise conventional carriers or excipients such as binding agents for example, syrup, acacia, gelatin, sorbitol, tragacanth, or polyvinylpyrrolidone; fillers, for example lactose, sugar, maize-starch, calcium phosphate, sorbitol or glycine; tableting lubricants, for example magnesium stearate, talc, polyethylene glycol or silica; disintegrants, for example potato starch; or acceptable wetting agents such as sodium lauryl sulphate. The tablets may be coated by standard aqueous or non-aqueous techniques according to methods well known in normal pharmaceutical practice.
- Pharmaceutical compositions of the present invention suitable for oral administration may be presented as discrete units such as capsules, cachets or tablets, each containing a predetermined amount of the active agent, as a powder or granules, or as a solution or a suspension in an aqueous liquid, a non-aqueous liquid, an oil-in-water emulsion or a water-in-oil liquid emulsion. Such compositions may be prepared by any of the methods of pharmacy but all methods include the step of bringing into association the active agent with the carrier, which constitutes one or more necessary ingredients. In general, the compositions are prepared by uniformly and intimately admixing the active agent with liquid carriers or finely divided solid carriers or both, and then, if necessary, shaping the product into the desired presentation. For example, a tablet may be prepared by compression or moulding, optionally with one or more accessory ingredients.
- Pharmaceutical compositions suitable for parenteral administration may be prepared as solutions or suspensions of the active agents of the invention in water suitably mixed with a surfactant such as hydroxypropylcellulose. Dispersions can also be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof in oils. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms.
- The pharmaceutical forms suitable for injectable use include aqueous or non-aqueous sterile injection solutions which may contain anti-oxidants, buffers, bacteriostats and solutes which render the composition isotonic with the blood of the intended recipient, and aqueous and non-aqueous sterile suspensions which may include suspending agents and thickening agents. Extemporaneous injection solutions, dispersions and suspensions may be prepared from sterile powders, granules and tablets.
- Pharmaceutical compositions can be administered with medical devices known in the art. For example, in a preferred embodiment, a pharmaceutical composition of the invention can be administered with a needleless hypodermic injection device, such as the devices disclosed in U.S. Pat. Nos. 5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824; or 4,596,556. Examples of well-known implants and modules useful in the present invention include: U.S. Pat. No. 4,487,603, which discloses an implantable micro-infusion pump for dispensing medication at a controlled rate; U.S. Pat. No. 4,486,194, which discloses a therapeutic device for administering medicaments through the skin; U.S. Pat. No. 4,447,233, which discloses a medication infusion pump for delivering medication at a precise infusion rate; U.S. Pat. No. 4,447,224, which, discloses a variable flow implantable infusion apparatus for continuous drug delivery, U.S. Pat. No. 4,439,196, which discloses an osmotic drug delivery system having multi-chamber compartments; and U.S. Pat. No. 4,475,196, which discloses an osmotic drug delivery system. Many other such implants, delivery systems, and modules are known to those skilled in the art.
- Pharmaceutical compositions adapted for topical administration may be formulated as ointments, creams, suspensions, lotions, powders, solutions, pastes, gels, impregnated dressings, sprays, aerosols or oils, transdermal devices, dusting powders, and the like. These compositions may be prepared via conventional methods containing the active agent. Thus, they may also comprise compatible conventional carriers and additives, such as preservatives, solvents to assist drug penetration, emollients in creams or ointments and ethanol or oleyl alcohol for lotions. Such carriers maybe present as from about 1% up to about 98% of the composition. More usually they will form up to about 80% of the composition. As an illustration only, a cream or ointment is prepared by mixing sufficient quantities of hydrophilic material and water, containing from about 5-10% by weight of the compound, in sufficient quantities to produce a cream or ointment having the desired consistency.
- Pharmaceutical compositions adapted for transdermal administration may be presented as discrete patches intended to remain in intimate contact with the epidermis of the recipient for a prolonged period of time. For example, the active agent may be delivered from the patch by iontophoresis.
- For applications to external tissues, for example the mouth and skin, the compositions are preferably applied as a topical ointment or cream When formulated in an ointment, the active agent may be employed with either a paraffinic or a water-miscible ointment base. Alternatively, the active agent may be formulated in a cream with an oil-in-water cream base or a water-in-oil base.
- Pharmaceutical compositions adapted for topical administration in the mouth include lozenges, pastilles and mouth washes.
- Pharmaceutical compositions adapted for topical administration to the eye include eye drops wherein the active agent is dissolved or suspended in a suitable carrier, especially an aqueous solvent. They also include topical ointments or creams as above.
- Pharmaceutical compositions suitable for rectal administration wherein the carrier is a solid are most preferably presented as unit dose suppositories. Suitable carriers include cocoa butter or other glyceride or materials commonly used in the art, and the suppositories may be conveniently formed by admixture of the combination with the softened or melted carrier(s) followed by chilling and shaping moulds. They may also be administered as enemas.
- The dosage to be administered of an inhibitor of IL-17 activity will vary according to the particular inhibitor, the type of MS, the subject, and the nature and severity of the disease and the physical condition of the subject, and the selected route of administration; the appropriate dosage can be readily determined by a person skilled in the art. For the treatment and/or prophylaxis of MS in humans and animals pharmaceutical compositions comprising antibodies can be administered to patients (e.g., human subjects) at therapeutically or prophylactically effective dosages (e.g. dosages which result in inhibition of MS and/or relief of MS symptoms) using any suitable route of administration, such as injection and other routes of administration known in the art for clinical products, such as antibody-based clinical products.
- The compositions may contain from 0.1% by weight, preferably from 10-60%, or more, by weight, of the inhibitor of the invention, depending on the method of administration.
- It will be recognized by one of skill in the art that the optimal quantity and spacing of individual dosages of an inhibitor of the invention will be determined by the nature and extent of the condition being treated, the form, route and site of administration, and the age and condition of the particular subject being treated, and that a physician will ultimately determine appropriate dosages to be used. This dosage may be repeated as often as appropriate. If side effects develop the amount and/or frequency of the dosage can be altered or reduced, in accordance with normal clinical practice.
- In another example, where the inhibitor is a nucleic acid this may be administered via gene therapy (see for example Hoshida, T. et al., 2002, Pancreas, 25:111-121; Ikuno, Y. 2002, Invest. Ophthalmol. Vis. Sci. 2002 43:2406-2411; Bollard, C., 2002, Blood 99:3179-3187; Lee E., 2001, Mol. Med. 7:773-782). Gene therapy refers to administration to a subject of an expressed or expressible nucleic acid. In one example this is either the IL-17 or the IL-17R nucleic acid or portions thereof. Any of the methods for gene therapy available in the art can be used according to the present invention.
- Delivery of the therapeutic nucleic acid into a patient can be direct in vivo gene therapy (i.e. the patient is directly exposed to the nucleic acid or nucleic acid-containing vector) or indirect ex vivo gene therapy (i.e. cells are first transformed with the nucleic acid in vitro and then transplanted into the patient).
- For example for in vivo gene therapy, an expression vector containing the IL-17 or IL-17R nucleic acid may be administered in such a manner that it becomes intracellular, i.e. by infection using a defective or attenuated retroviral or other viral vectors as described, for example, in U.S. Pat. No. 4,980,286 or by Robbins et al., 1998, Pharmacol. Ther. 80:35-47.
- The various retroviral vectors that are known in the art are such as those described in Miller et al. (1993, Meth. Enzymol. 217:581-599) which have been modified to delete those retroviral sequences which are not required for packaging of the viral genome and subsequent integration into host cell DNA. Also adenoviral vectors can be used which are advantageous due to their ability to infect non-dividing cells and such high-capacity adenoviral vectors are described in Kochanek (1999, Human Gene Therapy, 10:2451-2459). Chimeric viral vectors that can be used are those described by Reynolds et al. (1999, Molecular Medicine Today, 1:25-31). Hybrid vectors can also be used and are described by Jacoby et al. (1997, Gene Therapy, 4:1282-1283).
- Direct injection of naked DNA or through the use of microparticle bombardment (e.g. Gene Gun®; Biolistic, Dupont) or by coating it with lipids can also be used in gene therapy. Cell-surface receptors/transfecting compounds or through encapsulation in liposomes, microparticles or microcapsules or by administering the nucleic acid in linkage to a peptide which is known to enter the nucleus or by administering it in linkage to a ligand predisposed to receptor-mediated endocytosis (See Wu & Wu. 1987, J. Biol. Chem., 262:4429-4432) can be used to target cell types which specifically express the receptors of interest.
- In ex vivo gene therapy, a gene is transferred into cells in vitro using tissue culture and the cells are delivered to the patient by various methods such as injecting subcutaneously, application of the cells into a skin graft and the intravenous injection of recombinant blood cells such as haematopoietic stem or progenitor cells.
- Cells into which a IL-17 or IL-17R nucleic acid can be introduced for the purposes of gene therapy include, for example, epithelial cells, endothelial cells, keratinocytes, fibroblasts, muscle cells, hepatocytes and blood cells. The blood cells that can be used include, for example, T-lymphocytes, B-lymphocytes, monocytes, macrophages, neutrophils, eosinophils, megakaryotcytes, granulocytes, haematopoietic cells or progenitor cells, and the like.
- In a one aspect, the pharmaceutical composition of the present invention comprises an IL-17 or IL-17R nucleic acid, said nucleic acid being part of an expression vector that expresses an IL-17 or IL-17R polypeptide or chimeric protein thereof in a suitable host. In particular, such a nucleic acid has a promoter operably linked to the polypeptide coding region, said promoter being inducible or constitutive (and, optionally, tissue-specific).
- The invention will now be described with reference to the following examples, which are merely illustrative and should not in any way be construed as limiting the scope of the present invention.
-
FIG. 1 . Effect ofAb# 13 mIgG1 on clinical disease when dosed from day—1 through the acute phase (black arrowheads, days—1, 6, 13, 20). Average clinical score (±sd) plotted against day of disease induction (a) and average change in weight from day 0 (b). -
FIG. 2 . Analysis of the acute phase of disease following dosing of Ab#13mIgG1 through the acute phase. -
FIG. 3 . Analysis of the relapse phase of disease following dosing of Ab#13mIgG1 through the acute phase. -
FIG. 4 . Effect of Ab#13mIgG1 on clinical disease when dosed through the relapse phase (days 28, 35, 42 and 49, black arrowheads). Average clinical score (±sd) versus day of disease induction (a) and average change in weight from day 0 (b). -
FIG. 5 . Analysis of the acute phase of disease following dosing of Ab#13mIgG1 through the reipase phase. -
FIG. 6 . Analysis of the relapse phase of disease following dosing of Ab#13mIgG1 through the relapse phase. -
FIG. 7 . Effect ofAb# 13 Fab-di-PEG andAb# 13 mIgG1 on clinical disease when dosed through the relapse phase (black arrowheads represent dosing days). Average clinical score (±sd) plotted against day of disease induction (a) and average change in weight from day 0 (b). -
FIG. 8 . Analysis of acute phase prior to dosing withAb# 13 Fab-di-PEG andAb# 13 mIgG1. -
FIG. 9 . Analysis of relapse phase following dosing withAb# 13 Fab-di-PEG andAb# 13 mIgG1 during remission. -
FIG. 10 . Effect of Ab#13mIgG1 on clinical disease when dosed from day-1 (black arrowheads represent dosing days, prophylactically (a) and therapeutically (b). -
FIG. 11 . Analysis of prohylactic dosing regime. -
FIG. 12 . Analysis of therapeutic dosing regime. -
FIG. 13 . Human and murine constant regions. - Rabbits were immunised three times with human IL-17 and then twice with mouse IL-1 7. Using a haemolytic plaque assay with biotinylated sheep red blood cells coated with murine IL-17 via streptavidin, 9 antibody genes were isolated using the methods described by Babcook et al., 1996, Proc. Natl. Acad. Sci, 93,7843-7848 and in WO92/02551. The antibody genes were expressed in CHO cells and the recombinant antibodies screened for their ability to neutralise murine IL-17 in a bioassay using mouse 3T3-NIH cells (Yao et al., 1995, Immunity, 3:811-821). All the antibodies in the panel neutralised murine IL-17 in this assay and one antibody, m170013 (Ab#13) was selected for in vivo testing. For testing the efficacy of the antibody in EAE, a chimeric IgG (
Ab# 13 mIgG1) was produced using the rabbit variable region from antibody m170013 and mouse constant regions. - The MS model, experimental autoimmune encephalomyelitis (EAE), was used essentially as described by Baker et al., 1990. Journal of Neuroimmunology, 28:261-270. Female ABH mice 8-10 weeks of age (Harlan) were immunised with mouse spinal cord homogenate (SCH, 3.33 mg/ml) in complete freund's adjuvant by subcutaneous immunisation in either flank (150 μl/site) on
days - i) Dosing Over the Acute Phase
- Two groups were dosed with antibody at 10 mg/kg, sc on days—1, 6, 13 and 20. One group (n=14) was dosed with
Ab# 13 mIgG1 the other (n=13) with 101.4 (isotype control). - ii) Dosing Over the Relapsing Phase
- A total of 30 mice were followed through the acute phase of disease and on day 27 analysis of the acute phase of disease was performed to select two groups with similar disease profiles in the acute phase (day of onset, peak disease score, cumulative clinical score and weight loss). Two groups of 12 mice were selected for dosing with antibody at 10 mg/kg, sc on days 28, 35, 42 and 49. One group was dosed with
Ab# 13 mIgG1) the other with 101.4 (isotype control). - Weights and clinical scores were recorded daily by an assessor blinded to treatment and terminal EDTA-Plasma collected.
Clinical score scale 0 Normal 0.25 Tail dragging 0.5 Partial tail paralysis 1 Complete tail paralysis 2 Incomplete hind limb paralysis 3 Complete hind paralysis/ incontinence 4 Front limb paralysis/loss of righting reflex - Statistics
- Pairwise comparisons of clinical scores and day of onset were performed using Mann-Whitney U test, analysis of incidence was performed with Fishers exact test, analysis of maximum weight loss was performed using Students' T test.
- Results
- i) Dosing during acute phase: A significant delay in the onset of the acute phase and a reduced severity and incidence of first relapse was observed (
FIGS. 1, 2 and 3).FIG. 2 shows thatAb# 13 mIgG1dosed through the acute phase had no effect on the incidence of disease in the acute phase (Ab# 13 mIgG1, 13/14 with disease vs 13/13 for isotype control, 101.4). The only statistically significant effect was a delay in the onset of the acute phase of diseaseFIG. 2 a, p=0.0039, Mann-Whitney U test. No effects were seen on weight loss (b), maximum clinical score (c) or cumulative clinical score (d) in the acute phase.FIG. 3 shows thatAb# 13 mIgG1dosed through the acute phase caused a significant reduction in the incidence of the relapse phase of disease (Ab# 13 mIgG1, 6/14 with disease vs 11/11 for isotype control, 101.4, p=0.0029, Fishers exact test). There was no statistically significant delay in the onset of the relapse phase of disease for those animals which entered relapse (a). A significant reduction in weight loss (b, p=0.0001, Student's T test), maximum clinical score (c, p=0.0028, Mann-Whitney U test) ) and cumulative clinical score (d, p=0.0001, Mann-Whitney U test) were observed during the relapse phase. - ii) Dosing through the relapsing phase: A reduced incidence, delayed onset and reduced severity of the relapse phase was observed (see
FIGS. 4, 5 and 6).FIG. 5 shows that the dose groups selected to have a similar acute phase profile, showed no significant differences in any of the parameters analysed.FIG. 6 shows thatAb# 13 mIgG1dosed through the relapse phase caused a significant reduction in the incidence of the relapse phase of disease (Ab# 13 mIgG1, 5/12 with disease vs 12/12 for isotype control, 101.4, p=0.0046, Fishers exact test). There was also a statistically significant delay in the onset of the relapse phase of disease for those animals which entered relapse (a, p=0.0061). A significant reduction in weight loss (b, p<0.000l, Student's T test), maximum clinical score (c, p=0.001 1, Mann-Whitney U test)) and cumulative clinical score (d, p=0.0023, Mann-Whitney U test) were also observed during the relapse phase. - Summary
-
Ab# 13 mIgG1 antibody was dosed in separate experiments over the acute phase of disease (prophylactic dosing) and over the relapse phase (therapeutic dosing). Effects were most pronounced on relapse with a significant reduction in the incidence and severity of the relapse phase for both dosing regimes. - A Fab fragment, termed
Ab# 13 Fab-Di-PEG was produced essentially as described in International Patent Application PCT/GB2004/002810 (filed on 1 Jul. 2004). The Fab consisted of the rabbit variable regions ofantibody 13 from example 1 and mouse IgG1 constant regions. In contrast to other Fab fragments, the heavy chain constant region of this Fab terminates at the interchain cysteine ofC H1. PCR primers were designed based on the murine IgG1 CH1 region and PCR mutagenesis used to insert a stop codon immediately following the interchain cysteine ofC H1. The mouse constant regions are shown inFIG. 13 and in SEQ ID Nos 3 (heavy chain) and 4 (light chain). PCR mutagenesis was also used to replace the cysteine at position 80 of the rabbit light chain variable region with alanine.Murine CH1 (SEQ ID NO:3) KTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVH TFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD C* Murine Kappa (SEQ ID NO:4) DAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGV LNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSF NRGEC* - The Fab fragments were produced in E. coli strain W3110 and purified using standard methods (Humphreys et al., 2002, Protein Expression and Purification, 26, 309-320).
- 2×20 kDa PEG was attached to the Fab fragment by attaching a linear 20 kDa PEG to each of the interchain cysteines (underlined in the sequences above). Reductions and PEGylations were performed in 50
mM Tris.HCl 5 mM EDTA pH 7.14 with Fab at 20.06 mg/ml. The Fab was reduced at room temperature (˜24° C.) for 30 minutes using 10 mM tris(2-carboxyethyl)phosphine (TCEP) (final). The Fab was desalted on a PD-10 column (Pharmacia) and then mixed with 4 fold molar excess of linear 20 kDa PEG-maleimide over Fab. The 20 kDa PEG was from Nippon Oils and Fats (NOF). PEGylated Fab was separated from unPEGylated Fab by size exclusion HPLC on analytical Zorbax GF-450 and GF-250 columns in series. These were developed with a 30 min isocratic gradient of 0.2M phosphate pH 7.0+10% ethanol at 1 ml/min and Fab detected using absorbance at 214 nm and 280 nm. - The MS model, experimental autoimmune encephalomyelitis (EAE), was used essentially as described by Baker et al., 1990. Journal of Neuroimmunology, 28:261-270.
- Female ABH mice 8-10 weeks of age (Harlan) were immunised with mouse spinal cord homogenate (SCH, 3.33 mg/ml) in complete Freund's adjuvant in two sites, sc, on the flanks (150 μl/site) on
days - Four groups were dosed prior to onset of first relapse (during remission). Groups were assigned as follows
- Group 1 (n=11) anti-mouse IL-17
Ab# 13 Fab-di-PEG (100 mg/kg, s.c, weekly) - Group 2 (n=11) anti-mouse IL-17
Ab# 13 Fab-di-PEG (30 mg/kg, s.c, weekly) - Group 3 (n=9) anti-mouse IL-17
Ab# 13 mIgG1 (10 mg/kg, sc) - Group 4 (n=9) PBS control
- Weights and clinical scores were recorded daily and terminal EDTA-Plasma collected.
Clinical score scale 0 Normal 0.25 Tail dragging 0.5 Partial tail paralysis 1 Complete tail paralysis 2 Incomplete hind limb paralysis/loss of righting reflex 3 Complete hind paralysis/ incontinence 4 Front limb paralysis/moribund - Statistics
- Pair wise comparisons of maximum and cumulative clinical scores and day of onset were performed using Mann-Whitney U test. Cumulative clinical score is defined as the sum of clinical scores throughout the disease course for each animal (area under the curve). Comparisons of disease incidence were performed using Fishers Exact Test. Maximum weight loss was analysed using one-way Anova with Bonferroni post test.
- Results
-
FIG. 7 a shows the effect ofanti-IL17 Ab# 13 di Fab-PEG andAb# 13 mIgG1 on clinical disease when dosed from remission (black arrowheads represent dosing days). When dosed prior to first relapse all active doses showed a significant reduction in cumulative and maximum clinical score and incidence. -
FIG. 8 shows that during the acute phase, prior to antibody treatment, all assigned groups showed no significant differences in disease onset or clinical severity prior to antibody dosing. -
FIG. 9 shows that anti-mouse IL-17 antibodies dosed prior to relapse onset during remission showed a significant reduction in maximum clinical score (Ab# 13 di Fab-PEG 100 mg/kg vs. PBS p<0.05 and IL-17Ab# 13 mIgG1 vs. PBS p<0.001), - There was also a reduction in cumulative score (
Ab# 13 di Fab-PEG (100 mg/kg and 30 mg/kg) andAb# 13 mIgG1 vs. PBS p<0.01, p<0.05 and p<0.001 respectively). Furthermore there was a reduction in maximum weight loss (Ab# 13 di Fab-PEG 100 mg/kg andAb# 13 mIgG1 vs. PBS both p<0.05). - Actual incidence of relapse is summarised in table 1, with all actively treated groups having significantly lower incidence than the PBS control group.
TABLE 1 Ab# 13Ab# 13Ab# 13di Fab-PEG di Fab- PEG IgG1 100 mg/kg*** 30 mg/kg* 10 mg/kg*** PBS Animals 0 2 0 7 entering relapse Animals not 11 9 11 2 entering relapse Total number 11 11 11 9 of animals
***P = 0.005
*p = 0.0216
***P = 0.005
- Summary
- Anti-mouse IL17 antibodies (
Ab# 13 di Fab-PEG andAb# 13 mIgG1) were dosed in a dose dependent manner during the remission phase prior to onset of first relapse. Effects were pronounced with a significant reduction for both antibodies in relapse incidence and upon maximum and cumulative disease score in comparison to the PBS control group. - The chronic EAE model used was essentially as described by Copray et al., 2004. Journal of Neuroimmunology, 148:41-53.
- Female C57B1/6 mice 6-8 weeks of age (Charles River) were immunised with Myelin Oligodendrocyte Protein (MOG 35-55, 0.66 mg/ml) in complete Freund's adjuvant (0.4 mg/ml Mycobacterium; 4:1 M.tuberculosis: M butyricum) in two sites, s.c, on the flanks (150 μl/site) on
days days - Two groups were dosed prophylactically (10 mg/kg; s.c; commencing on PSD—1 until the end of experiment). One group (n=15) was dosed with
Ab# 13 mIgG1, (chimeric rabbit V region, Murine constant region IgG-1, as described in Example 1), the other (n=15) with 101.4 (Murine IgG-1 isotype control, 101.4). - Two groups were dosed therapeutically (upon 50% incidence) with
Ab# 13 mIgG1 and control antibody 101.4 (10 mg/kg;s.c commencing PSD 16 till end of experiment) Weights and clinical scores were recorded daily and terminal EDTA-Plasma collected.Clinical score scale 0 Normal 0.25 Tail dragging 0.5 Partial tail paralysis 1 Complete tail paralysis 2 Incomplete hind limb paralysis/loss of righting reflex 3 Complete hind paralysis/ incontinence 4 Front limb paralysis/moribund - Statistics
- Statistical analysis was performed as described in Example 3.
- Results
-
FIG. 10 shows that prophylactic dosing (a) ofAb# 13 mIgG1 elicited significant delay in the onset of disease, cumulative and maximum clinical score. Therapeutic dosing (b) significantly reduced cumulative clinical score. Further analysis showedAb# 13 mIgG1 dosed prophylactically had significant effects in reducing cumulative score (p=0.0006), delay of onset (p=0.0184) and maximum clinical score (p=0.0032, all Mann-Whitney U test) (FIG. 11 ).Ab# 13 mIgG1 dosed therapeutically also showed a significant reduction in cumulative score (b, p=0.0229, Mann-Whitney U test;FIG. 12 ). - Summary
- Anti-mouse IL17
antibody Ab# 13 mIgG1 was dosed in separate experiments prophylactically and therapeutically. Effects were most pronounced prophylactically with a significant reduction in maximum and cumulative disease score, furthermore incidence of disease was significantly delayed. Therapeutic treatment showed a reduction in cumulative disease score.
Claims (11)
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US12/277,030 US7931900B2 (en) | 2003-11-21 | 2008-11-24 | Method for the treatment of multiple sclerosis by inhibiting IL-17 activity |
Applications Claiming Priority (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
GB0327181A GB0327181D0 (en) | 2003-11-21 | 2003-11-21 | Biological products |
GB0327181.4 | 2003-11-21 | ||
GB0417115A GB0417115D0 (en) | 2004-07-30 | 2004-07-30 | Biological products |
GB0417115.3 | 2004-07-30 | ||
PCT/GB2004/004850 WO2005051422A1 (en) | 2003-11-21 | 2004-11-16 | Method for the treatment of multiple sclerosis by inhibiting il-17 activity |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/GB2004/004850 A-371-Of-International WO2005051422A1 (en) | 2003-11-21 | 2004-11-16 | Method for the treatment of multiple sclerosis by inhibiting il-17 activity |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US12/277,030 Continuation US7931900B2 (en) | 2003-11-21 | 2008-11-24 | Method for the treatment of multiple sclerosis by inhibiting IL-17 activity |
Publications (1)
Publication Number | Publication Date |
---|---|
US20070269428A1 true US20070269428A1 (en) | 2007-11-22 |
Family
ID=34635441
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US10/580,164 Abandoned US20070269428A1 (en) | 2003-11-21 | 2004-11-16 | Method for the Treatment of Multiple Sclerosis by Inhibiting Il-17 Activity |
US12/277,030 Expired - Fee Related US7931900B2 (en) | 2003-11-21 | 2008-11-24 | Method for the treatment of multiple sclerosis by inhibiting IL-17 activity |
Family Applications After (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US12/277,030 Expired - Fee Related US7931900B2 (en) | 2003-11-21 | 2008-11-24 | Method for the treatment of multiple sclerosis by inhibiting IL-17 activity |
Country Status (16)
Country | Link |
---|---|
US (2) | US20070269428A1 (en) |
EP (3) | EP1983000B1 (en) |
JP (1) | JP4833850B2 (en) |
AT (1) | ATE395083T1 (en) |
AU (1) | AU2004292393C1 (en) |
CA (1) | CA2544920C (en) |
CY (1) | CY1116992T1 (en) |
DE (1) | DE602004013825D1 (en) |
DK (1) | DK1983000T3 (en) |
ES (2) | ES2305879T3 (en) |
HR (1) | HRP20151210T1 (en) |
HU (1) | HUE026260T2 (en) |
PL (1) | PL1983000T3 (en) |
PT (1) | PT1983000E (en) |
SI (1) | SI1983000T1 (en) |
WO (1) | WO2005051422A1 (en) |
Cited By (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20080299129A1 (en) * | 2006-03-10 | 2008-12-04 | Lewis Katherine E | Antagonists to il-17a, il-17f, and il-23p19 and methods of use |
US20090092604A1 (en) * | 2003-02-06 | 2009-04-09 | Schering Corporation | Method for the Treatment of Multiple Sclerosis by Inhibiting IL-17 Activity |
WO2011100567A1 (en) * | 2010-02-11 | 2011-08-18 | The Board Of Trustees Of The Leland Stanford Junior University | Therapeutic inhibition of granulocyte function in demyelinating disease |
US20110223169A1 (en) * | 2008-11-26 | 2011-09-15 | Stern Michael E | Il-17 antibody inhibitor for treating dry eye |
US20110223170A1 (en) * | 2008-11-26 | 2011-09-15 | Allergan, Inc | Klk-13 antibody inhibitor for treating dry eye |
US11453717B2 (en) | 2016-04-29 | 2022-09-27 | Joint Stock Company “Biocad” | Trispecific antibodies against IL-17A, IL-17F and other pro-inflammatory molecule |
Families Citing this family (34)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
GB1013141A (en) * | 1960-12-30 | 1965-12-15 | Secr Aviation | Improvements in or relating to the stabilisation of electronic oscillators |
US20060270003A1 (en) | 2003-07-08 | 2006-11-30 | Genentech, Inc. | IL-17A/F heterologous polypeptides and therapeutic uses thereof |
US20070160576A1 (en) * | 2001-06-05 | 2007-07-12 | Genentech, Inc. | IL-17A/F heterologous polypeptides and therapeutic uses thereof |
GB0417487D0 (en) | 2004-08-05 | 2004-09-08 | Novartis Ag | Organic compound |
GB0425569D0 (en) | 2004-11-19 | 2004-12-22 | Celltech R&D Ltd | Biological products |
SI1963368T1 (en) | 2005-12-13 | 2012-11-30 | Lilly Co Eli | Anti-il-17 antibodies |
CA2632435A1 (en) * | 2005-12-22 | 2007-06-28 | Laboratoires Serono S.A. | Soluble il-17rc variant and uses thereof |
US7790163B2 (en) | 2006-03-10 | 2010-09-07 | Zymogenetics, Inc. | Antibodies that bind both IL-17A and IL-17F and methods of using the same |
AU2007226627B2 (en) | 2006-03-10 | 2012-09-20 | Zymogenetics, Inc. | Antibodies that bind both IL-17A and IL-17F and methods of using the same |
GB0612928D0 (en) * | 2006-06-29 | 2006-08-09 | Ucb Sa | Biological products |
ES2373069T3 (en) | 2006-08-11 | 2012-01-31 | Schering Corporation | ANTIBODIES FOR IL-17A. |
GB0620729D0 (en) | 2006-10-18 | 2006-11-29 | Ucb Sa | Biological products |
JPWO2009054454A1 (en) | 2007-10-24 | 2011-03-03 | 国立大学法人 東京医科歯科大学 | Modulator of signal transduction of Toll-like receptor containing cathepsin inhibitor as an active ingredient |
WO2009082624A2 (en) * | 2007-12-10 | 2009-07-02 | Zymogenetics, Inc. | Antagonists of il-17a, il-17f, and il-23 and methods of using the same |
US20090162359A1 (en) | 2007-12-21 | 2009-06-25 | Christian Klein | Bivalent, bispecific antibodies |
GB0807413D0 (en) | 2008-04-23 | 2008-05-28 | Ucb Pharma Sa | Biological products |
MX2010012090A (en) | 2008-05-05 | 2011-04-11 | Novimmune Sa | Anti-il-17a/il-17f cross-reactive antibodies and methods of use thereof. |
ES2493042T3 (en) | 2008-09-29 | 2014-09-11 | Roche Glycart Ag | Antibodies against human IL-17 and their uses |
EP2427203B1 (en) | 2009-05-05 | 2018-10-17 | Novimmune S.A. | Anti-il-17f antibodies and use thereof |
US9676845B2 (en) | 2009-06-16 | 2017-06-13 | Hoffmann-La Roche, Inc. | Bispecific antigen binding proteins |
NZ598351A (en) | 2009-08-27 | 2014-08-29 | Covagen Ag | Il-17 binding compounds and medical uses thereof |
GB201100282D0 (en) | 2011-01-07 | 2011-02-23 | Ucb Pharma Sa | Biological methods |
US10208349B2 (en) | 2011-01-07 | 2019-02-19 | Ucb Biopharma Sprl | Lipocalin 2 as a biomarker for IL-17 inhibitor therapy efficacy |
AU2012206431B2 (en) | 2011-01-14 | 2015-04-30 | UCB Biopharma SRL | Antibody molecules which bind IL-17A and IL-17F |
BR112013019975A2 (en) | 2011-02-28 | 2017-08-01 | Hoffmann La Roche | "Antigen binding proteins, pharmaceutical composition, use of an antigen binding protein, method for treating a patient and method for preparing an antigen binding protein, nucleic acid, vector and host cell" |
EP2681240B1 (en) | 2011-02-28 | 2017-08-16 | F. Hoffmann-La Roche AG | Monovalent antigen binding proteins |
KR101674784B1 (en) | 2012-04-05 | 2016-11-09 | 에프. 호프만-라 로슈 아게 | Bispecific antibodies against human tweak and human il17 and uses thereof |
WO2014155278A2 (en) * | 2013-03-26 | 2014-10-02 | Novartis Ag | Methods of treating autoimmune diseases using il-17 antagonists |
WO2014161570A1 (en) | 2013-04-03 | 2014-10-09 | Roche Glycart Ag | Antibodies against human il17 and uses thereof |
WO2015052230A1 (en) | 2013-10-11 | 2015-04-16 | F. Hoffmann-La Roche Ag | Multispecific domain exchanged common variable light chain antibodies |
UA117289C2 (en) | 2014-04-02 | 2018-07-10 | Ф. Хоффманн-Ля Рош Аг | Multispecific antibodies |
WO2017041001A2 (en) * | 2015-09-04 | 2017-03-09 | The California Institute For Biomedical Research | Insulin immunoglobulin fusion proteins |
EP3150637A1 (en) | 2015-10-02 | 2017-04-05 | F. Hoffmann-La Roche AG | Multispecific antibodies |
GB2561352B (en) * | 2017-04-10 | 2023-01-18 | Genome Res Ltd | Animal models and therapeutic molecules |
Citations (30)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4439196A (en) * | 1982-03-18 | 1984-03-27 | Merck & Co., Inc. | Osmotic drug delivery system |
US4447233A (en) * | 1981-04-10 | 1984-05-08 | Parker-Hannifin Corporation | Medication infusion pump |
US4447224A (en) * | 1982-09-20 | 1984-05-08 | Infusaid Corporation | Variable flow implantable infusion apparatus |
US4475196A (en) * | 1981-03-06 | 1984-10-02 | Zor Clair G | Instrument for locating faults in aircraft passenger reading light and attendant call control system |
US4486194A (en) * | 1983-06-08 | 1984-12-04 | James Ferrara | Therapeutic device for administering medicaments through the skin |
US4487603A (en) * | 1982-11-26 | 1984-12-11 | Cordis Corporation | Implantable microinfusion pump system |
US4596556A (en) * | 1985-03-25 | 1986-06-24 | Bioject, Inc. | Hypodermic injection apparatus |
US4790824A (en) * | 1987-06-19 | 1988-12-13 | Bioject, Inc. | Non-invasive hypodermic injection device |
US4941880A (en) * | 1987-06-19 | 1990-07-17 | Bioject, Inc. | Pre-filled ampule and non-invasive hypodermic injection device assembly |
US4946778A (en) * | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
US4980286A (en) * | 1985-07-05 | 1990-12-25 | Whitehead Institute For Biomedical Research | In vivo introduction and expression of foreign genetic material in epithelial cells |
US5064413A (en) * | 1989-11-09 | 1991-11-12 | Bioject, Inc. | Needleless hypodermic injection device |
US5219996A (en) * | 1987-09-04 | 1993-06-15 | Celltech Limited | Recombinant antibodies and methods for their production in which surface residues are altered to cysteine residues for attachment of effector or receptor molecules |
US5223409A (en) * | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
US5312335A (en) * | 1989-11-09 | 1994-05-17 | Bioject Inc. | Needleless hypodermic injection device |
US5383851A (en) * | 1992-07-24 | 1995-01-24 | Bioject Inc. | Needleless hypodermic injection device |
US5427908A (en) * | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
US5516637A (en) * | 1994-06-10 | 1996-05-14 | Dade International Inc. | Method involving display of protein binding pairs on the surface of bacterial pili and bacteriophage |
US5585089A (en) * | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
US5658727A (en) * | 1991-04-10 | 1997-08-19 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
US5677425A (en) * | 1987-09-04 | 1997-10-14 | Celltech Therapeutics Limited | Recombinant antibody |
US5698426A (en) * | 1990-09-28 | 1997-12-16 | Ixsys, Incorporated | Surface expression libraries of heteromeric receptors |
US5733743A (en) * | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
US5738996A (en) * | 1994-06-15 | 1998-04-14 | Pence, Inc. | Combinational library composition and method |
US5750753A (en) * | 1996-01-24 | 1998-05-12 | Chisso Corporation | Method for manufacturing acryloxypropysilane |
US5780225A (en) * | 1990-01-12 | 1998-07-14 | Stratagene | Method for generating libaries of antibody genes comprising amplification of diverse antibody DNAs and methods for using these libraries for the production of diverse antigen combining molecules |
US5807683A (en) * | 1992-11-19 | 1998-09-15 | Combichem, Inc. | Combinatorial libraries and methods for their use |
US5821047A (en) * | 1990-12-03 | 1998-10-13 | Genentech, Inc. | Monovalent phage display |
US5969108A (en) * | 1990-07-10 | 1999-10-19 | Medical Research Council | Methods for producing members of specific binding pairs |
US6274711B1 (en) * | 1993-06-14 | 2001-08-14 | Inserm, Institut National De La Sante Et De La Recherche Medicale | Purified mammalian CTLA-8 antigens and related reagents |
Family Cites Families (25)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
GB8422238D0 (en) | 1984-09-03 | 1984-10-10 | Neuberger M S | Chimeric proteins |
DE68927933T2 (en) | 1988-09-02 | 1997-08-14 | Dyax Corp | PRODUCTION AND SELECTION OF RECOMBINANT PROTEINS WITH DIFFERENT BINDING POINTS |
GB8907617D0 (en) | 1989-04-05 | 1989-05-17 | Celltech Ltd | Drug delivery system |
AU7247191A (en) | 1990-01-11 | 1991-08-05 | Molecular Affinities Corporation | Production of antibodies using gene libraries |
CA2090126C (en) | 1990-08-02 | 2002-10-22 | John W. Schrader | Methods for the production of proteins with a desired function |
GB9113120D0 (en) | 1991-06-18 | 1991-08-07 | Kodak Ltd | Photographic processing apparatus |
WO1993008829A1 (en) | 1991-11-04 | 1993-05-13 | The Regents Of The University Of California | Compositions that mediate killing of hiv-infected cells |
ATE275198T1 (en) | 1991-12-02 | 2004-09-15 | Medical Res Council | PRODUCTION OF ANTIBODIES ON PHAGE SURFACES BASED ON ANTIBODIES SEGMENT LIBRARIES. |
US6562333B1 (en) | 1993-06-14 | 2003-05-13 | Schering Corporation | Purified mammalian CTLA-8 antigens and related reagents |
WO1995015982A2 (en) | 1993-12-08 | 1995-06-15 | Genzyme Corporation | Process for generating specific antibodies |
PT1231268E (en) | 1994-01-31 | 2005-11-30 | Univ Boston | BANKS OF POLYCLONE ANTIBODIES |
US6074849A (en) | 1995-07-19 | 2000-06-13 | Genetics Institute, Inc. | Polynucleotides encoding human CTLA-8 related proteins |
PT839196E (en) | 1995-07-19 | 2005-09-30 | Inst Genetics Llc | CTLA-8 HUMAN AND CTLA-8 RELATED PROTEIN UTILIZATIONS |
GB9625640D0 (en) | 1996-12-10 | 1997-01-29 | Celltech Therapeutics Ltd | Biological products |
GB9720054D0 (en) | 1997-09-19 | 1997-11-19 | Celltech Therapeutics Ltd | Biological products |
ATE537258T1 (en) | 1999-12-23 | 2011-12-15 | Genentech Inc | IL-17 HOMOLOGUE POLYPEPTIDES AND THEIR THERAPEUTIC USE |
US20070160576A1 (en) | 2001-06-05 | 2007-07-12 | Genentech, Inc. | IL-17A/F heterologous polypeptides and therapeutic uses thereof |
WO2003014309A2 (en) | 2001-08-07 | 2003-02-20 | Immunex Corporation | Interleukin-1 receptors in the treatment of diseases |
US7510709B2 (en) * | 2002-10-30 | 2009-03-31 | Genentech, Inc. | Method of treating inflammatory disease by inhibition of IL-17 production |
JP4914209B2 (en) | 2003-03-14 | 2012-04-11 | ワイス | Antibody against human IL-21 receptor and use of the antibody |
ATE490275T1 (en) | 2003-06-23 | 2010-12-15 | Genetics Inst Llc | ANTIBODIES TO INTERLEUKIN-22 AND USES THEREOF |
GB0315457D0 (en) | 2003-07-01 | 2003-08-06 | Celltech R&D Ltd | Biological products |
GB0315450D0 (en) | 2003-07-01 | 2003-08-06 | Celltech R&D Ltd | Biological products |
CA2527020A1 (en) | 2003-07-01 | 2005-01-13 | Celltech R & D Limited | Modified antibody fab fragments |
SI1963368T1 (en) | 2005-12-13 | 2012-11-30 | Lilly Co Eli | Anti-il-17 antibodies |
-
2004
- 2004-11-16 PL PL08008814T patent/PL1983000T3/en unknown
- 2004-11-16 CA CA2544920A patent/CA2544920C/en not_active Expired - Fee Related
- 2004-11-16 EP EP08008814.9A patent/EP1983000B1/en active Active
- 2004-11-16 DE DE602004013825T patent/DE602004013825D1/en active Active
- 2004-11-16 AU AU2004292393A patent/AU2004292393C1/en not_active Ceased
- 2004-11-16 PT PT80088149T patent/PT1983000E/en unknown
- 2004-11-16 ES ES04798568T patent/ES2305879T3/en active Active
- 2004-11-16 US US10/580,164 patent/US20070269428A1/en not_active Abandoned
- 2004-11-16 ES ES08008814.9T patent/ES2554645T3/en active Active
- 2004-11-16 HU HUE08008814A patent/HUE026260T2/en unknown
- 2004-11-16 WO PCT/GB2004/004850 patent/WO2005051422A1/en active IP Right Grant
- 2004-11-16 AT AT04798568T patent/ATE395083T1/en not_active IP Right Cessation
- 2004-11-16 EP EP15183030.4A patent/EP2974742A1/en not_active Withdrawn
- 2004-11-16 JP JP2006540587A patent/JP4833850B2/en not_active Expired - Fee Related
- 2004-11-16 EP EP04798568A patent/EP1687026B1/en not_active Revoked
- 2004-11-16 SI SI200432278T patent/SI1983000T1/en unknown
- 2004-11-16 DK DK08008814.9T patent/DK1983000T3/en active
-
2008
- 2008-11-24 US US12/277,030 patent/US7931900B2/en not_active Expired - Fee Related
-
2015
- 2015-11-11 HR HRP20151210TT patent/HRP20151210T1/en unknown
- 2015-11-30 CY CY20151101086T patent/CY1116992T1/en unknown
Patent Citations (34)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4475196A (en) * | 1981-03-06 | 1984-10-02 | Zor Clair G | Instrument for locating faults in aircraft passenger reading light and attendant call control system |
US4447233A (en) * | 1981-04-10 | 1984-05-08 | Parker-Hannifin Corporation | Medication infusion pump |
US4439196A (en) * | 1982-03-18 | 1984-03-27 | Merck & Co., Inc. | Osmotic drug delivery system |
US4447224A (en) * | 1982-09-20 | 1984-05-08 | Infusaid Corporation | Variable flow implantable infusion apparatus |
US4487603A (en) * | 1982-11-26 | 1984-12-11 | Cordis Corporation | Implantable microinfusion pump system |
US4486194A (en) * | 1983-06-08 | 1984-12-04 | James Ferrara | Therapeutic device for administering medicaments through the skin |
US4596556A (en) * | 1985-03-25 | 1986-06-24 | Bioject, Inc. | Hypodermic injection apparatus |
US4980286A (en) * | 1985-07-05 | 1990-12-25 | Whitehead Institute For Biomedical Research | In vivo introduction and expression of foreign genetic material in epithelial cells |
US4790824A (en) * | 1987-06-19 | 1988-12-13 | Bioject, Inc. | Non-invasive hypodermic injection device |
US4941880A (en) * | 1987-06-19 | 1990-07-17 | Bioject, Inc. | Pre-filled ampule and non-invasive hypodermic injection device assembly |
US5677425A (en) * | 1987-09-04 | 1997-10-14 | Celltech Therapeutics Limited | Recombinant antibody |
US5219996A (en) * | 1987-09-04 | 1993-06-15 | Celltech Limited | Recombinant antibodies and methods for their production in which surface residues are altered to cysteine residues for attachment of effector or receptor molecules |
US4946778A (en) * | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
US5571698A (en) * | 1988-09-02 | 1996-11-05 | Protein Engineering Corporation | Directed evolution of novel binding proteins |
US5403484A (en) * | 1988-09-02 | 1995-04-04 | Protein Engineering Corporation | Viruses expressing chimeric binding proteins |
US5223409A (en) * | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
US5585089A (en) * | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
US5312335A (en) * | 1989-11-09 | 1994-05-17 | Bioject Inc. | Needleless hypodermic injection device |
US5064413A (en) * | 1989-11-09 | 1991-11-12 | Bioject, Inc. | Needleless hypodermic injection device |
US5780225A (en) * | 1990-01-12 | 1998-07-14 | Stratagene | Method for generating libaries of antibody genes comprising amplification of diverse antibody DNAs and methods for using these libraries for the production of diverse antigen combining molecules |
US5427908A (en) * | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
US5580717A (en) * | 1990-05-01 | 1996-12-03 | Affymax Technologies N.V. | Recombinant library screening methods |
US5969108A (en) * | 1990-07-10 | 1999-10-19 | Medical Research Council | Methods for producing members of specific binding pairs |
US5698426A (en) * | 1990-09-28 | 1997-12-16 | Ixsys, Incorporated | Surface expression libraries of heteromeric receptors |
US5821047A (en) * | 1990-12-03 | 1998-10-13 | Genentech, Inc. | Monovalent phage display |
US5658727A (en) * | 1991-04-10 | 1997-08-19 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
US5733743A (en) * | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
US5399163A (en) * | 1992-07-24 | 1995-03-21 | Bioject Inc. | Needleless hypodermic injection methods and device |
US5383851A (en) * | 1992-07-24 | 1995-01-24 | Bioject Inc. | Needleless hypodermic injection device |
US5807683A (en) * | 1992-11-19 | 1998-09-15 | Combichem, Inc. | Combinatorial libraries and methods for their use |
US6274711B1 (en) * | 1993-06-14 | 2001-08-14 | Inserm, Institut National De La Sante Et De La Recherche Medicale | Purified mammalian CTLA-8 antigens and related reagents |
US5516637A (en) * | 1994-06-10 | 1996-05-14 | Dade International Inc. | Method involving display of protein binding pairs on the surface of bacterial pili and bacteriophage |
US5738996A (en) * | 1994-06-15 | 1998-04-14 | Pence, Inc. | Combinational library composition and method |
US5750753A (en) * | 1996-01-24 | 1998-05-12 | Chisso Corporation | Method for manufacturing acryloxypropysilane |
Cited By (19)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20090092604A1 (en) * | 2003-02-06 | 2009-04-09 | Schering Corporation | Method for the Treatment of Multiple Sclerosis by Inhibiting IL-17 Activity |
US20100143357A1 (en) * | 2003-02-06 | 2010-06-10 | Schering Corporation | Uses of Mammalian Cytokine; Related Reagents |
US8496936B2 (en) | 2006-03-10 | 2013-07-30 | Zymogenetics, Inc. | Antagonists of IL-17A, IL-17F, and IL-23P19 |
US7910703B2 (en) | 2006-03-10 | 2011-03-22 | Zymogenetics, Inc. | Antagonists to IL-17A, IL-17F, and IL-23P19 and methods of use |
US20110159589A1 (en) * | 2006-03-10 | 2011-06-30 | Zymogenetics, Inc. | Methods of inhibiting inflammation with antagonists to il-17a, il-17f, and il-23p19 |
US10562967B2 (en) | 2006-03-10 | 2020-02-18 | Zymogenetics, Inc. | Treating inflammation with IL-17/IL-23 bispecific antibodies |
US9994634B2 (en) | 2006-03-10 | 2018-06-12 | Zymogenetics, Inc. | Use of an IL-17/IL-23 bispecific antibody for treating inflammation |
US9464134B2 (en) | 2006-03-10 | 2016-10-11 | Zymogenetics, Inc. | Polynucleotides encoding antagonists of IL-17A, IL-17F, and IL-23p19 |
US20080299129A1 (en) * | 2006-03-10 | 2008-12-04 | Lewis Katherine E | Antagonists to il-17a, il-17f, and il-23p19 and methods of use |
US8333968B2 (en) | 2006-03-10 | 2012-12-18 | Zymogenetics, Inc. | Methods of inhibiting inflammation with antagonists to IL-17A, IL-17F, and IL-23P19 |
US8992922B2 (en) | 2006-03-10 | 2015-03-31 | Zymogenetics, Inc. | Antagonists of IL-17A, IL-17F, and IL-23P19 |
US8211434B2 (en) | 2008-11-26 | 2012-07-03 | Allergan, Inc. | KLK-13 antibody inhibitor for treating dry eye |
US8821874B2 (en) | 2008-11-26 | 2014-09-02 | Allergan, Inc. | KLK-13 antibody inhibitor for treating dry eye |
US8491905B2 (en) | 2008-11-26 | 2013-07-23 | Allergan, Inc. | KLK-13 antibody inhibitor for treating dry eye |
US20110223170A1 (en) * | 2008-11-26 | 2011-09-15 | Allergan, Inc | Klk-13 antibody inhibitor for treating dry eye |
US20110223169A1 (en) * | 2008-11-26 | 2011-09-15 | Stern Michael E | Il-17 antibody inhibitor for treating dry eye |
US8828668B2 (en) | 2010-02-11 | 2014-09-09 | The Board Of Trustees Of The Leland Stanford Junior University | Markers for determination of patient responsiveness |
WO2011100567A1 (en) * | 2010-02-11 | 2011-08-18 | The Board Of Trustees Of The Leland Stanford Junior University | Therapeutic inhibition of granulocyte function in demyelinating disease |
US11453717B2 (en) | 2016-04-29 | 2022-09-27 | Joint Stock Company “Biocad” | Trispecific antibodies against IL-17A, IL-17F and other pro-inflammatory molecule |
Also Published As
Publication number | Publication date |
---|---|
ATE395083T1 (en) | 2008-05-15 |
EP2974742A1 (en) | 2016-01-20 |
SI1983000T1 (en) | 2015-12-31 |
US7931900B2 (en) | 2011-04-26 |
EP1983000B1 (en) | 2015-09-02 |
ES2554645T3 (en) | 2015-12-22 |
ES2305879T3 (en) | 2008-11-01 |
EP1687026B1 (en) | 2008-05-14 |
HRP20151210T1 (en) | 2015-12-04 |
JP4833850B2 (en) | 2011-12-07 |
EP1687026A1 (en) | 2006-08-09 |
WO2005051422A1 (en) | 2005-06-09 |
US20090191200A1 (en) | 2009-07-30 |
JP2007511593A (en) | 2007-05-10 |
CY1116992T1 (en) | 2017-04-05 |
PL1983000T3 (en) | 2016-02-29 |
AU2004292393C1 (en) | 2011-08-04 |
HUE026260T2 (en) | 2016-06-28 |
AU2004292393A1 (en) | 2005-06-09 |
CA2544920A1 (en) | 2005-06-09 |
EP1983000A2 (en) | 2008-10-22 |
EP1983000A3 (en) | 2011-07-27 |
PT1983000E (en) | 2015-12-30 |
AU2004292393B2 (en) | 2009-10-08 |
CA2544920C (en) | 2012-09-11 |
DE602004013825D1 (en) | 2008-06-26 |
DK1983000T3 (en) | 2015-12-07 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US7931900B2 (en) | Method for the treatment of multiple sclerosis by inhibiting IL-17 activity | |
US8304200B2 (en) | Methods for obtaining antibodies | |
AU2004289098B2 (en) | Use of an inhibitor of CSF-1 activity for the treatment of inflammatory bowel disease | |
KR20160113113A (en) | Pd-1 antibody, antigen-binding fragment thereof, and medical use thereof | |
JP6851322B2 (en) | How to treat neurological disorders | |
US9840556B2 (en) | Anti-TNF alpha antibodies which selectively inhibit TNF alpha signalling through the p55R | |
CN111918878A (en) | anti-GITR antibodies and uses thereof | |
EP4041767A1 (en) | Antibodies specific to glycosylated ctla-4 and methods of use thereof | |
US7771969B2 (en) | Methods for obtaining antibodies | |
CN115947855B (en) | Preparation of anti-CD 24 antibodies and uses thereof | |
US20240117066A1 (en) | Anti-upar antibodies and uses thereof | |
CN116574189A (en) | Multiple antibodies against human IL-36R and/or human IL-1R3 and uses thereof | |
CA3229503A1 (en) | Pharmaceutical composition containing fusion protein | |
EP4041768A1 (en) | Antibodies specific to glycosylated lag3 and methods of use thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: CELLTECH R & D LIMITED, UNITED KINGDOM Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:CHRISTIE, MARK IAN;MEAD, RICHARD JAMES;ROBINSON, MARTYN KIM;AND OTHERS;REEL/FRAME:019517/0155;SIGNING DATES FROM 20061220 TO 20070220 |
|
AS | Assignment |
Owner name: UCB PHARMA S.A., BELGIUM Free format text: CON;ASSIGNOR:CELLTECH R&D LIMITED;REEL/FRAME:021478/0274 Effective date: 20080529 Owner name: UCB PHARMA S.A.,BELGIUM Free format text: CON;ASSIGNOR:CELLTECH R&D LIMITED;REEL/FRAME:021478/0274 Effective date: 20080529 |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |