US20110044979A1 - Domain antibody construct - Google Patents
Domain antibody construct Download PDFInfo
- Publication number
- US20110044979A1 US20110044979A1 US12/831,874 US83187410A US2011044979A1 US 20110044979 A1 US20110044979 A1 US 20110044979A1 US 83187410 A US83187410 A US 83187410A US 2011044979 A1 US2011044979 A1 US 2011044979A1
- Authority
- US
- United States
- Prior art keywords
- seq
- domain antibody
- antibody construct
- sequence
- domain
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 101000611183 Homo sapiens Tumor necrosis factor Proteins 0.000 claims abstract description 42
- 102000057041 human TNF Human genes 0.000 claims abstract description 35
- 241000288906 Primates Species 0.000 claims abstract description 29
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 claims abstract description 13
- 235000001014 amino acid Nutrition 0.000 claims abstract description 12
- 238000006467 substitution reaction Methods 0.000 claims abstract description 8
- 238000006664 bond formation reaction Methods 0.000 claims abstract description 6
- 238000012217 deletion Methods 0.000 claims abstract description 4
- 230000037430 deletion Effects 0.000 claims abstract description 4
- 108010047041 Complementarity Determining Regions Proteins 0.000 claims description 18
- 108060003951 Immunoglobulin Proteins 0.000 claims description 13
- 102000018358 immunoglobulin Human genes 0.000 claims description 13
- 150000001413 amino acids Chemical group 0.000 claims description 10
- 239000003085 diluting agent Substances 0.000 claims description 10
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 claims description 8
- 235000018417 cysteine Nutrition 0.000 claims description 8
- 229940024606 amino acid Drugs 0.000 claims description 7
- 239000003937 drug carrier Substances 0.000 claims description 6
- 239000008194 pharmaceutical composition Substances 0.000 claims description 6
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 claims description 5
- 239000000710 homodimer Substances 0.000 claims description 5
- 239000004474 valine Substances 0.000 claims description 5
- 239000000539 dimer Substances 0.000 claims description 4
- 125000002987 valine group Chemical group [H]N([H])C([H])(C(*)=O)C([H])(C([H])([H])[H])C([H])([H])[H] 0.000 claims description 4
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical group CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 claims description 3
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical group CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 claims description 3
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Chemical group CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 claims description 3
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 claims description 3
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Chemical group CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 claims description 3
- 229960000310 isoleucine Drugs 0.000 claims description 3
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 claims description 2
- 125000003275 alpha amino acid group Chemical group 0.000 abstract description 20
- 150000001875 compounds Chemical class 0.000 description 96
- 108090000623 proteins and genes Proteins 0.000 description 67
- 102000004169 proteins and genes Human genes 0.000 description 56
- 235000018102 proteins Nutrition 0.000 description 52
- 210000004027 cell Anatomy 0.000 description 50
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 42
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 41
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 37
- 229920001223 polyethylene glycol Polymers 0.000 description 31
- 230000027455 binding Effects 0.000 description 29
- 238000000034 method Methods 0.000 description 27
- 229920000642 polymer Polymers 0.000 description 18
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 16
- 150000007523 nucleic acids Chemical group 0.000 description 16
- 239000002202 Polyethylene glycol Substances 0.000 description 14
- 230000000694 effects Effects 0.000 description 14
- 238000000855 fermentation Methods 0.000 description 14
- 230000004151 fermentation Effects 0.000 description 14
- 239000000203 mixture Substances 0.000 description 14
- 238000003752 polymerase chain reaction Methods 0.000 description 14
- 239000002953 phosphate buffered saline Substances 0.000 description 13
- 239000000427 antigen Substances 0.000 description 12
- 102000036639 antigens Human genes 0.000 description 12
- 108091007433 antigens Proteins 0.000 description 12
- 241001515942 marmosets Species 0.000 description 12
- 208000035475 disorder Diseases 0.000 description 11
- 238000002965 ELISA Methods 0.000 description 10
- 108091028043 Nucleic acid sequence Proteins 0.000 description 10
- 238000004458 analytical method Methods 0.000 description 10
- 108020004707 nucleic acids Proteins 0.000 description 10
- 102000039446 nucleic acids Human genes 0.000 description 10
- 239000002773 nucleotide Substances 0.000 description 10
- 125000003729 nucleotide group Chemical group 0.000 description 10
- 241000282709 Aotus trivirgatus Species 0.000 description 9
- UHNRLQRZRNKOKU-UHFFFAOYSA-N CCN(CC1=NC2=C(N1)C1=CC=C(C=C1N=C2N)C1=NNC=C1)C(C)=O Chemical compound CCN(CC1=NC2=C(N1)C1=CC=C(C=C1N=C2N)C1=NNC=C1)C(C)=O UHNRLQRZRNKOKU-UHFFFAOYSA-N 0.000 description 9
- 108020004414 DNA Proteins 0.000 description 9
- 241000196324 Embryophyta Species 0.000 description 9
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 9
- 239000013604 expression vector Substances 0.000 description 9
- -1 heptaglobin Proteins 0.000 description 9
- 108090000765 processed proteins & peptides Proteins 0.000 description 9
- 239000013598 vector Substances 0.000 description 9
- 102100040247 Tumor necrosis factor Human genes 0.000 description 8
- 230000001580 bacterial effect Effects 0.000 description 8
- 230000001965 increasing effect Effects 0.000 description 8
- 239000000047 product Substances 0.000 description 8
- 102100035361 Cerebellar degeneration-related protein 2 Human genes 0.000 description 7
- 101000737796 Homo sapiens Cerebellar degeneration-related protein 2 Proteins 0.000 description 7
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 7
- 125000000539 amino acid group Chemical group 0.000 description 7
- 238000011534 incubation Methods 0.000 description 7
- 238000001890 transfection Methods 0.000 description 7
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 6
- 241001529936 Murinae Species 0.000 description 6
- 239000000178 monomer Substances 0.000 description 6
- 229920001184 polypeptide Polymers 0.000 description 6
- 102000004196 processed proteins & peptides Human genes 0.000 description 6
- 239000000243 solution Substances 0.000 description 6
- 241000282412 Homo Species 0.000 description 5
- 101001057956 Homo sapiens 55 kDa erythrocyte membrane protein Proteins 0.000 description 5
- 101000837415 Homo sapiens DNA polymerase subunit gamma-2, mitochondrial Proteins 0.000 description 5
- 101001065272 Homo sapiens EGF-containing fibulin-like extracellular matrix protein 1 Proteins 0.000 description 5
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 description 5
- 101001072202 Homo sapiens Protein disulfide-isomerase Proteins 0.000 description 5
- 101000801228 Homo sapiens Tumor necrosis factor receptor superfamily member 1A Proteins 0.000 description 5
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 5
- 210000001744 T-lymphocyte Anatomy 0.000 description 5
- 238000002835 absorbance Methods 0.000 description 5
- 206010003246 arthritis Diseases 0.000 description 5
- 229960000074 biopharmaceutical Drugs 0.000 description 5
- 239000000872 buffer Substances 0.000 description 5
- 238000006243 chemical reaction Methods 0.000 description 5
- 239000003795 chemical substances by application Substances 0.000 description 5
- 238000010367 cloning Methods 0.000 description 5
- 201000010099 disease Diseases 0.000 description 5
- 230000008030 elimination Effects 0.000 description 5
- 238000003379 elimination reaction Methods 0.000 description 5
- 102000057036 human EFEMP1 Human genes 0.000 description 5
- 238000001727 in vivo Methods 0.000 description 5
- 238000004519 manufacturing process Methods 0.000 description 5
- 239000000463 material Substances 0.000 description 5
- 239000008188 pellet Substances 0.000 description 5
- 102000005962 receptors Human genes 0.000 description 5
- 108020003175 receptors Proteins 0.000 description 5
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 5
- 230000009261 transgenic effect Effects 0.000 description 5
- 101000801232 Homo sapiens Tumor necrosis factor receptor superfamily member 1B Proteins 0.000 description 4
- 241000699670 Mus sp. Species 0.000 description 4
- 229920001213 Polysorbate 20 Polymers 0.000 description 4
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 4
- 206010040070 Septic Shock Diseases 0.000 description 4
- 230000009824 affinity maturation Effects 0.000 description 4
- 230000003321 amplification Effects 0.000 description 4
- 230000015572 biosynthetic process Effects 0.000 description 4
- 230000015556 catabolic process Effects 0.000 description 4
- 238000000576 coating method Methods 0.000 description 4
- 238000006731 degradation reaction Methods 0.000 description 4
- 238000005516 engineering process Methods 0.000 description 4
- 208000015181 infectious disease Diseases 0.000 description 4
- 230000003993 interaction Effects 0.000 description 4
- 238000001990 intravenous administration Methods 0.000 description 4
- 230000001404 mediated effect Effects 0.000 description 4
- 230000004048 modification Effects 0.000 description 4
- 238000012986 modification Methods 0.000 description 4
- 238000003199 nucleic acid amplification method Methods 0.000 description 4
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 4
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 4
- 230000000717 retained effect Effects 0.000 description 4
- 230000002441 reversible effect Effects 0.000 description 4
- 241000894007 species Species 0.000 description 4
- 239000000126 substance Substances 0.000 description 4
- 239000000725 suspension Substances 0.000 description 4
- 230000001225 therapeutic effect Effects 0.000 description 4
- 230000035899 viability Effects 0.000 description 4
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 3
- 241000288950 Callithrix jacchus Species 0.000 description 3
- 241000288943 Callitrichinae Species 0.000 description 3
- 241000282693 Cercopithecidae Species 0.000 description 3
- 102000004127 Cytokines Human genes 0.000 description 3
- 108090000695 Cytokines Proteins 0.000 description 3
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 3
- 102000004190 Enzymes Human genes 0.000 description 3
- 108090000790 Enzymes Proteins 0.000 description 3
- 206010061218 Inflammation Diseases 0.000 description 3
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 3
- 229930182816 L-glutamine Natural products 0.000 description 3
- 241000282567 Macaca fascicularis Species 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 3
- 244000061176 Nicotiana tabacum Species 0.000 description 3
- 235000002637 Nicotiana tabacum Nutrition 0.000 description 3
- 102000007238 Transferrin Receptors Human genes 0.000 description 3
- 108010033576 Transferrin Receptors Proteins 0.000 description 3
- 108010073929 Vascular Endothelial Growth Factor A Proteins 0.000 description 3
- 102100039037 Vascular endothelial growth factor A Human genes 0.000 description 3
- 238000000137 annealing Methods 0.000 description 3
- 238000013459 approach Methods 0.000 description 3
- 210000004369 blood Anatomy 0.000 description 3
- 239000008280 blood Substances 0.000 description 3
- 238000004113 cell culture Methods 0.000 description 3
- 239000011248 coating agent Substances 0.000 description 3
- 231100000135 cytotoxicity Toxicity 0.000 description 3
- 230000003013 cytotoxicity Effects 0.000 description 3
- 230000002526 effect on cardiovascular system Effects 0.000 description 3
- 239000000839 emulsion Substances 0.000 description 3
- 229940088598 enzyme Drugs 0.000 description 3
- 230000005847 immunogenicity Effects 0.000 description 3
- 230000001976 improved effect Effects 0.000 description 3
- 238000000338 in vitro Methods 0.000 description 3
- 208000027866 inflammatory disease Diseases 0.000 description 3
- 230000004054 inflammatory process Effects 0.000 description 3
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 3
- 208000002780 macular degeneration Diseases 0.000 description 3
- 210000004962 mammalian cell Anatomy 0.000 description 3
- 238000002703 mutagenesis Methods 0.000 description 3
- 231100000350 mutagenesis Toxicity 0.000 description 3
- 238000006386 neutralization reaction Methods 0.000 description 3
- 210000000056 organ Anatomy 0.000 description 3
- 238000002823 phage display Methods 0.000 description 3
- 230000002685 pulmonary effect Effects 0.000 description 3
- 239000000523 sample Substances 0.000 description 3
- 230000035939 shock Effects 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- 239000006228 supernatant Substances 0.000 description 3
- 238000005406 washing Methods 0.000 description 3
- 230000003442 weekly effect Effects 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 2
- VDJKJPMLWJWQIH-UHFFFAOYSA-M 5-ethylphenazin-5-ium;ethyl sulfate Chemical compound CCOS([O-])(=O)=O.C1=CC=C2[N+](CC)=C(C=CC=C3)C3=NC2=C1 VDJKJPMLWJWQIH-UHFFFAOYSA-M 0.000 description 2
- 206010001052 Acute respiratory distress syndrome Diseases 0.000 description 2
- 206010002556 Ankylosing Spondylitis Diseases 0.000 description 2
- 241001502973 Aotus nancymaae Species 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- 208000023275 Autoimmune disease Diseases 0.000 description 2
- 108010081589 Becaplermin Proteins 0.000 description 2
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 2
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 2
- 108010078791 Carrier Proteins Proteins 0.000 description 2
- 241000282513 Cebidae Species 0.000 description 2
- 108091026890 Coding region Proteins 0.000 description 2
- 206010009900 Colitis ulcerative Diseases 0.000 description 2
- 102000008186 Collagen Human genes 0.000 description 2
- 108010035532 Collagen Proteins 0.000 description 2
- 208000011231 Crohn disease Diseases 0.000 description 2
- 102000053602 DNA Human genes 0.000 description 2
- 102000000541 Defensins Human genes 0.000 description 2
- 108010002069 Defensins Proteins 0.000 description 2
- 108010049003 Fibrinogen Proteins 0.000 description 2
- 102000008946 Fibrinogen Human genes 0.000 description 2
- 102000018233 Fibroblast Growth Factor Human genes 0.000 description 2
- 108050007372 Fibroblast Growth Factor Proteins 0.000 description 2
- 208000009329 Graft vs Host Disease Diseases 0.000 description 2
- 102000002812 Heat-Shock Proteins Human genes 0.000 description 2
- 108010004889 Heat-Shock Proteins Proteins 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- 101000595923 Homo sapiens Placenta growth factor Proteins 0.000 description 2
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 2
- 102100039064 Interleukin-3 Human genes 0.000 description 2
- 108010002386 Interleukin-3 Proteins 0.000 description 2
- 102100026236 Interleukin-8 Human genes 0.000 description 2
- 108090001007 Interleukin-8 Proteins 0.000 description 2
- 206010028980 Neoplasm Diseases 0.000 description 2
- 108091034117 Oligonucleotide Proteins 0.000 description 2
- 241000282577 Pan troglodytes Species 0.000 description 2
- 102100035194 Placenta growth factor Human genes 0.000 description 2
- 239000004236 Ponceau SX Substances 0.000 description 2
- 108010076504 Protein Sorting Signals Proteins 0.000 description 2
- 201000004681 Psoriasis Diseases 0.000 description 2
- 102000014128 RANK Ligand Human genes 0.000 description 2
- 108010025832 RANK Ligand Proteins 0.000 description 2
- 101000702488 Rattus norvegicus High affinity cationic amino acid transporter 1 Proteins 0.000 description 2
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 2
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 2
- 208000013616 Respiratory Distress Syndrome Diseases 0.000 description 2
- 206010040047 Sepsis Diseases 0.000 description 2
- 108010090804 Streptavidin Proteins 0.000 description 2
- 206010044248 Toxic shock syndrome Diseases 0.000 description 2
- 231100000650 Toxic shock syndrome Toxicity 0.000 description 2
- 102400001320 Transforming growth factor alpha Human genes 0.000 description 2
- 101800004564 Transforming growth factor alpha Proteins 0.000 description 2
- 201000006704 Ulcerative Colitis Diseases 0.000 description 2
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 2
- 240000008042 Zea mays Species 0.000 description 2
- 235000016383 Zea mays subsp huehuetenangensis Nutrition 0.000 description 2
- 235000002017 Zea mays subsp mays Nutrition 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- RJURFGZVJUQBHK-UHFFFAOYSA-N actinomycin D Natural products CC1OC(=O)C(C(C)C)N(C)C(=O)CN(C)C(=O)C2CCCN2C(=O)C(C(C)C)NC(=O)C1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)NC4C(=O)NC(C(N5CCCC5C(=O)N(C)CC(=O)N(C)C(C(C)C)C(=O)OC4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-UHFFFAOYSA-N 0.000 description 2
- 201000000028 adult respiratory distress syndrome Diseases 0.000 description 2
- 206010064930 age-related macular degeneration Diseases 0.000 description 2
- 102000015395 alpha 1-Antitrypsin Human genes 0.000 description 2
- 108010050122 alpha 1-Antitrypsin Proteins 0.000 description 2
- 229940024142 alpha 1-antitrypsin Drugs 0.000 description 2
- 230000003698 anagen phase Effects 0.000 description 2
- 230000002917 arthritic effect Effects 0.000 description 2
- 239000013584 assay control Substances 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 210000000988 bone and bone Anatomy 0.000 description 2
- PFKFTWBEEFSNDU-UHFFFAOYSA-N carbonyldiimidazole Chemical compound C1=CN=CN1C(=O)N1C=CN=C1 PFKFTWBEEFSNDU-UHFFFAOYSA-N 0.000 description 2
- 238000003570 cell viability assay Methods 0.000 description 2
- 238000005119 centrifugation Methods 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 230000001684 chronic effect Effects 0.000 description 2
- 229920001436 collagen Polymers 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 238000013270 controlled release Methods 0.000 description 2
- 238000002784 cytotoxicity assay Methods 0.000 description 2
- 231100000263 cytotoxicity test Toxicity 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 239000006185 dispersion Substances 0.000 description 2
- 238000010494 dissociation reaction Methods 0.000 description 2
- 230000005593 dissociations Effects 0.000 description 2
- 239000003814 drug Substances 0.000 description 2
- 210000002889 endothelial cell Anatomy 0.000 description 2
- 238000011156 evaluation Methods 0.000 description 2
- 230000007717 exclusion Effects 0.000 description 2
- 239000012894 fetal calf serum Substances 0.000 description 2
- 229940012952 fibrinogen Drugs 0.000 description 2
- 229940126864 fibroblast growth factor Drugs 0.000 description 2
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 2
- 238000009472 formulation Methods 0.000 description 2
- 230000004927 fusion Effects 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 150000004676 glycans Chemical class 0.000 description 2
- 208000024908 graft versus host disease Diseases 0.000 description 2
- 230000012010 growth Effects 0.000 description 2
- 230000001900 immune effect Effects 0.000 description 2
- 238000003018 immunoassay Methods 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 230000002757 inflammatory effect Effects 0.000 description 2
- 239000003112 inhibitor Substances 0.000 description 2
- 230000005764 inhibitory process Effects 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 229940076264 interleukin-3 Drugs 0.000 description 2
- 229940096397 interleukin-8 Drugs 0.000 description 2
- XKTZWUACRZHVAN-VADRZIEHSA-N interleukin-8 Chemical compound C([C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@@H](NC(C)=O)CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CCSC)C(=O)N1[C@H](CCC1)C(=O)N1[C@H](CCC1)C(=O)N[C@@H](C)C(=O)N[C@H](CC(O)=O)C(=O)N[C@H](CCC(O)=O)C(=O)N[C@H](CC(O)=O)C(=O)N[C@H](CC=1C=CC(O)=CC=1)C(=O)N[C@H](CO)C(=O)N1[C@H](CCC1)C(N)=O)C1=CC=CC=C1 XKTZWUACRZHVAN-VADRZIEHSA-N 0.000 description 2
- 239000007951 isotonicity adjuster Substances 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 239000002502 liposome Substances 0.000 description 2
- 210000004185 liver Anatomy 0.000 description 2
- 210000004698 lymphocyte Anatomy 0.000 description 2
- 235000009973 maize Nutrition 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 230000035772 mutation Effects 0.000 description 2
- 210000000440 neutrophil Anatomy 0.000 description 2
- 230000007310 pathophysiology Effects 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 230000000069 prophylactic effect Effects 0.000 description 2
- 238000003127 radioimmunoassay Methods 0.000 description 2
- 238000001525 receptor binding assay Methods 0.000 description 2
- 206010039073 rheumatoid arthritis Diseases 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 239000007790 solid phase Substances 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 238000010186 staining Methods 0.000 description 2
- 238000010561 standard procedure Methods 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 239000003826 tablet Substances 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 150000003573 thiols Chemical class 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- 238000011830 transgenic mouse model Methods 0.000 description 2
- 238000013519 translation Methods 0.000 description 2
- AASBXERNXVFUEJ-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) propanoate Chemical compound CCC(=O)ON1C(=O)CCC1=O AASBXERNXVFUEJ-UHFFFAOYSA-N 0.000 description 1
- NMWKYTGJWUAZPZ-WWHBDHEGSA-N (4S)-4-[[(4R,7S,10S,16S,19S,25S,28S,31R)-31-[[(2S)-2-[[(1R,6R,9S,12S,18S,21S,24S,27S,30S,33S,36S,39S,42R,47R,53S,56S,59S,62S,65S,68S,71S,76S,79S,85S)-47-[[(2S)-2-[[(2S)-4-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-amino-3-methylbutanoyl]amino]-3-methylbutanoyl]amino]-3-hydroxypropanoyl]amino]-3-(1H-imidazol-4-yl)propanoyl]amino]-3-phenylpropanoyl]amino]-4-oxobutanoyl]amino]-3-carboxypropanoyl]amino]-18-(4-aminobutyl)-27,68-bis(3-amino-3-oxopropyl)-36,71,76-tribenzyl-39-(3-carbamimidamidopropyl)-24-(2-carboxyethyl)-21,56-bis(carboxymethyl)-65,85-bis[(1R)-1-hydroxyethyl]-59-(hydroxymethyl)-62,79-bis(1H-imidazol-4-ylmethyl)-9-methyl-33-(2-methylpropyl)-8,11,17,20,23,26,29,32,35,38,41,48,54,57,60,63,66,69,72,74,77,80,83,86-tetracosaoxo-30-propan-2-yl-3,4,44,45-tetrathia-7,10,16,19,22,25,28,31,34,37,40,49,55,58,61,64,67,70,73,75,78,81,84,87-tetracosazatetracyclo[40.31.14.012,16.049,53]heptaoctacontane-6-carbonyl]amino]-3-methylbutanoyl]amino]-7-(3-carbamimidamidopropyl)-25-(hydroxymethyl)-19-[(4-hydroxyphenyl)methyl]-28-(1H-imidazol-4-ylmethyl)-10-methyl-6,9,12,15,18,21,24,27,30-nonaoxo-16-propan-2-yl-1,2-dithia-5,8,11,14,17,20,23,26,29-nonazacyclodotriacontane-4-carbonyl]amino]-5-[[(2S)-1-[[(2S)-1-[[(2S)-3-carboxy-1-[[(2S)-1-[[(2S)-1-[[(1S)-1-carboxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-3-(1H-imidazol-4-yl)-1-oxopropan-2-yl]amino]-5-oxopentanoic acid Chemical compound CC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H]1CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@@H]2CSSC[C@@H]3NC(=O)[C@H](Cc4ccccc4)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](Cc4c[nH]cn4)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H]4CCCN4C(=O)[C@H](CSSC[C@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](Cc4c[nH]cn4)NC(=O)[C@H](Cc4ccccc4)NC3=O)[C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc3ccccc3)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N3CCC[C@H]3C(=O)N[C@@H](C)C(=O)N2)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](Cc2c[nH]cn2)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@@H](N)C(C)C)C(C)C)[C@@H](C)O)C(C)C)C(=O)N[C@@H](Cc2c[nH]cn2)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](Cc2ccc(O)cc2)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1)C(=O)N[C@@H](C)C(O)=O NMWKYTGJWUAZPZ-WWHBDHEGSA-N 0.000 description 1
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- CXCHEKCRJQRVNG-UHFFFAOYSA-N 2,2,2-trifluoroethanesulfonyl chloride Chemical compound FC(F)(F)CS(Cl)(=O)=O CXCHEKCRJQRVNG-UHFFFAOYSA-N 0.000 description 1
- PAYROHWFGZADBR-UHFFFAOYSA-N 2-[[4-amino-5-(5-iodo-4-methoxy-2-propan-2-ylphenoxy)pyrimidin-2-yl]amino]propane-1,3-diol Chemical compound C1=C(I)C(OC)=CC(C(C)C)=C1OC1=CN=C(NC(CO)CO)N=C1N PAYROHWFGZADBR-UHFFFAOYSA-N 0.000 description 1
- UAIUNKRWKOVEES-UHFFFAOYSA-N 3,3',5,5'-tetramethylbenzidine Chemical compound CC1=C(N)C(C)=CC(C=2C=C(C)C(N)=C(C)C=2)=C1 UAIUNKRWKOVEES-UHFFFAOYSA-N 0.000 description 1
- APRZHQXAAWPYHS-UHFFFAOYSA-N 4-[5-[3-(carboxymethoxy)phenyl]-3-(4,5-dimethyl-1,3-thiazol-2-yl)tetrazol-3-ium-2-yl]benzenesulfonate Chemical compound S1C(C)=C(C)N=C1[N+]1=NC(C=2C=C(OCC(O)=O)C=CC=2)=NN1C1=CC=C(S([O-])(=O)=O)C=C1 APRZHQXAAWPYHS-UHFFFAOYSA-N 0.000 description 1
- 206010069754 Acquired gene mutation Diseases 0.000 description 1
- 102000007698 Alcohol dehydrogenase Human genes 0.000 description 1
- 108010021809 Alcohol dehydrogenase Proteins 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 241001062548 Alouatta guariba Species 0.000 description 1
- 102400001364 Alpha-1-microglobulin Human genes 0.000 description 1
- 101800001761 Alpha-1-microglobulin Proteins 0.000 description 1
- 102100033312 Alpha-2-macroglobulin Human genes 0.000 description 1
- 208000024827 Alzheimer disease Diseases 0.000 description 1
- 229920000856 Amylose Polymers 0.000 description 1
- 102100022987 Angiogenin Human genes 0.000 description 1
- 241000282672 Ateles sp. Species 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 208000027496 Behcet disease Diseases 0.000 description 1
- 102100037437 Beta-defensin 1 Human genes 0.000 description 1
- 101710125314 Beta-defensin 1 Proteins 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-M Bicarbonate Chemical compound OC([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-M 0.000 description 1
- 102000004506 Blood Proteins Human genes 0.000 description 1
- 108010017384 Blood Proteins Proteins 0.000 description 1
- 108010049931 Bone Morphogenetic Protein 2 Proteins 0.000 description 1
- 208000020084 Bone disease Diseases 0.000 description 1
- 102100024506 Bone morphogenetic protein 2 Human genes 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 206010006895 Cachexia Diseases 0.000 description 1
- 241000282688 Callicebus Species 0.000 description 1
- 241000288951 Callithrix <genus> Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 208000020446 Cardiac disease Diseases 0.000 description 1
- 206010007559 Cardiac failure congestive Diseases 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 102000004225 Cathepsin B Human genes 0.000 description 1
- 108090000712 Cathepsin B Proteins 0.000 description 1
- 102000005600 Cathepsins Human genes 0.000 description 1
- 108010084457 Cathepsins Proteins 0.000 description 1
- 241001515796 Cebinae Species 0.000 description 1
- 108010078239 Chemokine CX3CL1 Proteins 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 102000004266 Collagen Type IV Human genes 0.000 description 1
- 108010042086 Collagen Type IV Proteins 0.000 description 1
- 208000035473 Communicable disease Diseases 0.000 description 1
- 108010061642 Cystatin C Proteins 0.000 description 1
- 102000012192 Cystatin C Human genes 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 230000006820 DNA synthesis Effects 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 108010092160 Dactinomycin Proteins 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 241000255581 Drosophila <fruit fly, genus> Species 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 108010041308 Endothelial Growth Factors Proteins 0.000 description 1
- 206010014824 Endotoxic shock Diseases 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 241000701959 Escherichia virus Lambda Species 0.000 description 1
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 description 1
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 description 1
- 108010014173 Factor X Proteins 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 108010073385 Fibrin Proteins 0.000 description 1
- 102000009123 Fibrin Human genes 0.000 description 1
- BWGVNKXGVNDBDI-UHFFFAOYSA-N Fibrin monomer Chemical compound CNC(=O)CNC(=O)CN BWGVNKXGVNDBDI-UHFFFAOYSA-N 0.000 description 1
- 102000003971 Fibroblast Growth Factor 1 Human genes 0.000 description 1
- 108090000386 Fibroblast Growth Factor 1 Proteins 0.000 description 1
- 102000003974 Fibroblast growth factor 2 Human genes 0.000 description 1
- 108090000379 Fibroblast growth factor 2 Proteins 0.000 description 1
- 102100037362 Fibronectin Human genes 0.000 description 1
- 108010067306 Fibronectins Proteins 0.000 description 1
- 102100020997 Fractalkine Human genes 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 208000007465 Giant cell arteritis Diseases 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 239000004366 Glucose oxidase Substances 0.000 description 1
- 108010015776 Glucose oxidase Proteins 0.000 description 1
- 229920002527 Glycogen Polymers 0.000 description 1
- 241000282575 Gorilla Species 0.000 description 1
- 201000005569 Gout Diseases 0.000 description 1
- 206010018634 Gouty Arthritis Diseases 0.000 description 1
- 206010019280 Heart failures Diseases 0.000 description 1
- 102100039165 Heat shock protein beta-1 Human genes 0.000 description 1
- 101710100504 Heat shock protein beta-1 Proteins 0.000 description 1
- 208000002250 Hematologic Neoplasms Diseases 0.000 description 1
- 102000009824 Hepatocyte Nuclear Factor 1-alpha Human genes 0.000 description 1
- 108010020382 Hepatocyte Nuclear Factor 1-alpha Proteins 0.000 description 1
- 101000780591 Homo sapiens AFG3-like protein 2 Proteins 0.000 description 1
- 101000599951 Homo sapiens Insulin-like growth factor I Proteins 0.000 description 1
- 101001076292 Homo sapiens Insulin-like growth factor II Proteins 0.000 description 1
- 101000629361 Homo sapiens Paraplegin Proteins 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- 206010020751 Hypersensitivity Diseases 0.000 description 1
- 101150088952 IGF1 gene Proteins 0.000 description 1
- 101150002416 Igf2 gene Proteins 0.000 description 1
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 1
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 1
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 1
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 1
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 1
- 102000004877 Insulin Human genes 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 102000003746 Insulin Receptor Human genes 0.000 description 1
- 108010001127 Insulin Receptor Proteins 0.000 description 1
- 102100037852 Insulin-like growth factor I Human genes 0.000 description 1
- 102100025947 Insulin-like growth factor II Human genes 0.000 description 1
- 102100024319 Intestinal-type alkaline phosphatase Human genes 0.000 description 1
- 101710184243 Intestinal-type alkaline phosphatase Proteins 0.000 description 1
- 208000003456 Juvenile Arthritis Diseases 0.000 description 1
- 206010059176 Juvenile idiopathic arthritis Diseases 0.000 description 1
- 206010023330 Keloid scar Diseases 0.000 description 1
- 108010076876 Keratins Proteins 0.000 description 1
- 102000011782 Keratins Human genes 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 241000282675 Lagothrix Species 0.000 description 1
- 102000007547 Laminin Human genes 0.000 description 1
- 108010085895 Laminin Proteins 0.000 description 1
- 239000012097 Lipofectamine 2000 Substances 0.000 description 1
- 208000019693 Lung disease Diseases 0.000 description 1
- PEEHTFAAVSWFBL-UHFFFAOYSA-N Maleimide Chemical compound O=C1NC(=O)C=C1 PEEHTFAAVSWFBL-UHFFFAOYSA-N 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 102000004378 Melanocortin Receptors Human genes 0.000 description 1
- 108090000950 Melanocortin Receptors Proteins 0.000 description 1
- 102000005741 Metalloproteases Human genes 0.000 description 1
- 108010006035 Metalloproteases Proteins 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- 102100030335 Midkine Human genes 0.000 description 1
- 108010092801 Midkine Proteins 0.000 description 1
- 102000016943 Muramidase Human genes 0.000 description 1
- 108010014251 Muramidase Proteins 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 241000699660 Mus musculus Species 0.000 description 1
- 241000238367 Mya arenaria Species 0.000 description 1
- 208000000112 Myalgia Diseases 0.000 description 1
- 108010083674 Myelin Proteins Proteins 0.000 description 1
- 102000006386 Myelin Proteins Human genes 0.000 description 1
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 1
- 238000011887 Necropsy Methods 0.000 description 1
- 206010029113 Neovascularisation Diseases 0.000 description 1
- 206010029164 Nephrotic syndrome Diseases 0.000 description 1
- 206010067482 No adverse event Diseases 0.000 description 1
- 208000022873 Ocular disease Diseases 0.000 description 1
- 102000007990 Organic Anion Transporters Human genes 0.000 description 1
- 108010089503 Organic Anion Transporters Proteins 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 206010034277 Pemphigoid Diseases 0.000 description 1
- 102000003992 Peroxidases Human genes 0.000 description 1
- 241000009328 Perro Species 0.000 description 1
- 108010004729 Phycoerythrin Proteins 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 102000013566 Plasminogen Human genes 0.000 description 1
- 108010051456 Plasminogen Proteins 0.000 description 1
- 229920002732 Polyanhydride Polymers 0.000 description 1
- 206010036030 Polyarthritis Diseases 0.000 description 1
- 229920000954 Polyglycolide Polymers 0.000 description 1
- 229920001710 Polyorthoester Polymers 0.000 description 1
- 241000282405 Pongo abelii Species 0.000 description 1
- 108010015078 Pregnancy-Associated alpha 2-Macroglobulins Proteins 0.000 description 1
- 206010037660 Pyrexia Diseases 0.000 description 1
- 239000012979 RPMI medium Substances 0.000 description 1
- 108091036333 Rapid DNA Proteins 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 206010063837 Reperfusion injury Diseases 0.000 description 1
- 241000282695 Saimiri Species 0.000 description 1
- 208000008765 Sciatica Diseases 0.000 description 1
- 102400001107 Secretory component Human genes 0.000 description 1
- 206010053879 Sepsis syndrome Diseases 0.000 description 1
- 108010071390 Serum Albumin Proteins 0.000 description 1
- 102000007562 Serum Albumin Human genes 0.000 description 1
- 102000054727 Serum Amyloid A Human genes 0.000 description 1
- 108700028909 Serum Amyloid A Proteins 0.000 description 1
- 201000010001 Silicosis Diseases 0.000 description 1
- 208000021386 Sjogren Syndrome Diseases 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- 244000061456 Solanum tuberosum Species 0.000 description 1
- 235000002595 Solanum tuberosum Nutrition 0.000 description 1
- 241000282898 Sus scrofa Species 0.000 description 1
- 206010051379 Systemic Inflammatory Response Syndrome Diseases 0.000 description 1
- 108010004408 TRPP Cation Channels Proteins 0.000 description 1
- 108010006785 Taq Polymerase Proteins 0.000 description 1
- 241000011102 Thera Species 0.000 description 1
- 102100031372 Thymidine phosphorylase Human genes 0.000 description 1
- 108700023160 Thymidine phosphorylases Proteins 0.000 description 1
- 206010052779 Transplant rejections Diseases 0.000 description 1
- GLNADSQYFUSGOU-GPTZEZBUSA-J Trypan blue Chemical compound [Na+].[Na+].[Na+].[Na+].C1=C(S([O-])(=O)=O)C=C2C=C(S([O-])(=O)=O)C(/N=N/C3=CC=C(C=C3C)C=3C=C(C(=CC=3)\N=N\C=3C(=CC4=CC(=CC(N)=C4C=3O)S([O-])(=O)=O)S([O-])(=O)=O)C)=C(O)C2=C1N GLNADSQYFUSGOU-GPTZEZBUSA-J 0.000 description 1
- 108060008683 Tumor Necrosis Factor Receptor Proteins 0.000 description 1
- 101710187830 Tumor necrosis factor receptor superfamily member 1B Proteins 0.000 description 1
- 101710165473 Tumor necrosis factor receptor superfamily member 4 Proteins 0.000 description 1
- 102100022153 Tumor necrosis factor receptor superfamily member 4 Human genes 0.000 description 1
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 1
- 108090000848 Ubiquitin Proteins 0.000 description 1
- 102000044159 Ubiquitin Human genes 0.000 description 1
- 206010046851 Uveitis Diseases 0.000 description 1
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 239000003070 absorption delaying agent Substances 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- RJURFGZVJUQBHK-IIXSONLDSA-N actinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-IIXSONLDSA-N 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 208000011341 adult acute respiratory distress syndrome Diseases 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 238000003314 affinity selection Methods 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 238000013019 agitation Methods 0.000 description 1
- 208000026935 allergic disease Diseases 0.000 description 1
- 230000007815 allergy Effects 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 230000033115 angiogenesis Effects 0.000 description 1
- 230000002491 angiogenic effect Effects 0.000 description 1
- 108010072788 angiogenin Proteins 0.000 description 1
- 210000003423 ankle Anatomy 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 230000003110 anti-inflammatory effect Effects 0.000 description 1
- 230000005875 antibody response Effects 0.000 description 1
- 229940121375 antifungal agent Drugs 0.000 description 1
- 239000003429 antifungal agent Substances 0.000 description 1
- 239000008346 aqueous phase Substances 0.000 description 1
- PYMYPHUHKUWMLA-WDCZJNDASA-N arabinose Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)C=O PYMYPHUHKUWMLA-WDCZJNDASA-N 0.000 description 1
- PYMYPHUHKUWMLA-UHFFFAOYSA-N arabinose Natural products OCC(O)C(O)C(O)C=O PYMYPHUHKUWMLA-UHFFFAOYSA-N 0.000 description 1
- 229940072107 ascorbate Drugs 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 208000006673 asthma Diseases 0.000 description 1
- 239000012298 atmosphere Substances 0.000 description 1
- 201000004982 autoimmune uveitis Diseases 0.000 description 1
- OHDRQQURAXLVGJ-HLVWOLMTSA-N azane;(2e)-3-ethyl-2-[(e)-(3-ethyl-6-sulfo-1,3-benzothiazol-2-ylidene)hydrazinylidene]-1,3-benzothiazole-6-sulfonic acid Chemical compound [NH4+].[NH4+].S/1C2=CC(S([O-])(=O)=O)=CC=C2N(CC)C\1=N/N=C1/SC2=CC(S([O-])(=O)=O)=CC=C2N1CC OHDRQQURAXLVGJ-HLVWOLMTSA-N 0.000 description 1
- OHDRQQURAXLVGJ-UHFFFAOYSA-N azane;3-ethyl-2-[(3-ethyl-6-sulfo-1,3-benzothiazol-2-ylidene)hydrazinylidene]-1,3-benzothiazole-6-sulfonic acid Chemical compound [NH4+].[NH4+].S1C2=CC(S([O-])(=O)=O)=CC=C2N(CC)C1=NN=C1SC2=CC(S([O-])(=O)=O)=CC=C2N1CC OHDRQQURAXLVGJ-UHFFFAOYSA-N 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 238000010923 batch production Methods 0.000 description 1
- 230000003542 behavioural effect Effects 0.000 description 1
- 108010081355 beta 2-Microglobulin Proteins 0.000 description 1
- 102000015736 beta 2-Microglobulin Human genes 0.000 description 1
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 239000013060 biological fluid Substances 0.000 description 1
- 239000012472 biological sample Substances 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 230000008499 blood brain barrier function Effects 0.000 description 1
- 210000001218 blood-brain barrier Anatomy 0.000 description 1
- 229940098773 bovine serum albumin Drugs 0.000 description 1
- 210000004781 brain capillary Anatomy 0.000 description 1
- DQXBYHZEEUGOBF-UHFFFAOYSA-N but-3-enoic acid;ethene Chemical compound C=C.OC(=O)CC=C DQXBYHZEEUGOBF-UHFFFAOYSA-N 0.000 description 1
- 244000309466 calf Species 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000003833 cell viability Effects 0.000 description 1
- 208000015114 central nervous system disease Diseases 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 239000013043 chemical agent Substances 0.000 description 1
- 238000012412 chemical coupling Methods 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- BFPSDSIWYFKGBC-UHFFFAOYSA-N chlorotrianisene Chemical compound C1=CC(OC)=CC=C1C(Cl)=C(C=1C=CC(OC)=CC=1)C1=CC=C(OC)C=C1 BFPSDSIWYFKGBC-UHFFFAOYSA-N 0.000 description 1
- 239000007979 citrate buffer Substances 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 230000015271 coagulation Effects 0.000 description 1
- 238000005345 coagulation Methods 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 230000000139 costimulatory effect Effects 0.000 description 1
- 229940127089 cytotoxic agent Drugs 0.000 description 1
- 239000002254 cytotoxic agent Substances 0.000 description 1
- 231100000599 cytotoxic agent Toxicity 0.000 description 1
- 229960000640 dactinomycin Drugs 0.000 description 1
- 230000002074 deregulated effect Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 208000037765 diseases and disorders Diseases 0.000 description 1
- 239000002612 dispersion medium Substances 0.000 description 1
- AFOSIXZFDONLBT-UHFFFAOYSA-N divinyl sulfone Chemical compound C=CS(=O)(=O)C=C AFOSIXZFDONLBT-UHFFFAOYSA-N 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 230000001516 effect on protein Effects 0.000 description 1
- 239000012636 effector Substances 0.000 description 1
- 239000012039 electrophile Substances 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 230000008519 endogenous mechanism Effects 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- 239000000262 estrogen Substances 0.000 description 1
- 239000005038 ethylene vinyl acetate Substances 0.000 description 1
- 210000002744 extracellular matrix Anatomy 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 229950003499 fibrin Drugs 0.000 description 1
- 210000002950 fibroblast Anatomy 0.000 description 1
- 238000011049 filling Methods 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 239000012909 foetal bovine serum Substances 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- 101150054895 ftsH gene Proteins 0.000 description 1
- 230000006870 function Effects 0.000 description 1
- 125000000524 functional group Chemical group 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 239000007903 gelatin capsule Substances 0.000 description 1
- 210000004602 germ cell Anatomy 0.000 description 1
- 229940116332 glucose oxidase Drugs 0.000 description 1
- 235000019420 glucose oxidase Nutrition 0.000 description 1
- 229940096919 glycogen Drugs 0.000 description 1
- 150000002334 glycols Chemical class 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 208000019622 heart disease Diseases 0.000 description 1
- 208000006454 hepatitis Diseases 0.000 description 1
- 231100000283 hepatitis Toxicity 0.000 description 1
- 229940022353 herceptin Drugs 0.000 description 1
- 239000000833 heterodimer Substances 0.000 description 1
- 102000054037 human AFG3L2 Human genes 0.000 description 1
- 102000055335 human SPG7 Human genes 0.000 description 1
- 238000009396 hybridization Methods 0.000 description 1
- 210000004408 hybridoma Anatomy 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 238000002649 immunization Methods 0.000 description 1
- 230000000984 immunochemical effect Effects 0.000 description 1
- 229940127121 immunoconjugate Drugs 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 230000002998 immunogenetic effect Effects 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 238000003364 immunohistochemistry Methods 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 230000004968 inflammatory condition Effects 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 229940102223 injectable solution Drugs 0.000 description 1
- 238000007689 inspection Methods 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 229940068935 insulin-like growth factor 2 Drugs 0.000 description 1
- 102000006495 integrins Human genes 0.000 description 1
- 108010044426 integrins Proteins 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 239000007928 intraperitoneal injection Substances 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 208000011379 keloid formation Diseases 0.000 description 1
- 210000002510 keratinocyte Anatomy 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- 239000008297 liquid dosage form Substances 0.000 description 1
- 239000006193 liquid solution Substances 0.000 description 1
- 230000033001 locomotion Effects 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 229960000274 lysozyme Drugs 0.000 description 1
- 239000004325 lysozyme Substances 0.000 description 1
- 235000010335 lysozyme Nutrition 0.000 description 1
- 238000010841 mRNA extraction Methods 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- SXTAYKAGBXMACB-UHFFFAOYSA-N methionine S-imide-S-oxide Natural products CS(=N)(=O)CCC(N)C(O)=O SXTAYKAGBXMACB-UHFFFAOYSA-N 0.000 description 1
- 125000000956 methoxy group Chemical group [H]C([H])([H])O* 0.000 description 1
- 239000004530 micro-emulsion Substances 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 230000000921 morphogenic effect Effects 0.000 description 1
- 201000006417 multiple sclerosis Diseases 0.000 description 1
- 231100000219 mutagenic Toxicity 0.000 description 1
- 230000003505 mutagenic effect Effects 0.000 description 1
- 210000005012 myelin Anatomy 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 230000001537 neural effect Effects 0.000 description 1
- 230000009871 nonspecific binding Effects 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 230000003204 osmotic effect Effects 0.000 description 1
- 201000008482 osteoarthritis Diseases 0.000 description 1
- 230000002188 osteogenic effect Effects 0.000 description 1
- 229960000402 palivizumab Drugs 0.000 description 1
- 230000006320 pegylation Effects 0.000 description 1
- 208000027232 peripheral nervous system disease Diseases 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- 239000008177 pharmaceutical agent Substances 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 229920001200 poly(ethylene-vinyl acetate) Polymers 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 229920002859 polyalkenylene Polymers 0.000 description 1
- 229920001281 polyalkylene Polymers 0.000 description 1
- 239000004633 polyglycolic acid Substances 0.000 description 1
- 229920002704 polyhistidine Polymers 0.000 description 1
- 239000004626 polylactic acid Substances 0.000 description 1
- 229920001451 polypropylene glycol Polymers 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- 229920002451 polyvinyl alcohol Polymers 0.000 description 1
- 230000001376 precipitating effect Effects 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- XJMOSONTPMZWPB-UHFFFAOYSA-M propidium iodide Chemical compound [I-].[I-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CCC[N+](C)(CC)CC)=C1C1=CC=CC=C1 XJMOSONTPMZWPB-UHFFFAOYSA-M 0.000 description 1
- 208000005069 pulmonary fibrosis Diseases 0.000 description 1
- 201000003651 pulmonary sarcoidosis Diseases 0.000 description 1
- 239000012264 purified product Substances 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 230000000241 respiratory effect Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 102000029752 retinol binding Human genes 0.000 description 1
- 108091000053 retinol binding Proteins 0.000 description 1
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 231100000241 scar Toxicity 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 239000008299 semisolid dosage form Substances 0.000 description 1
- 230000036303 septic shock Effects 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- 239000004017 serum-free culture medium Substances 0.000 description 1
- 238000004513 sizing Methods 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- 239000007909 solid dosage form Substances 0.000 description 1
- 230000037439 somatic mutation Effects 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 150000005846 sugar alcohols Polymers 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 230000008961 swelling Effects 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 229940036185 synagis Drugs 0.000 description 1
- 229920001059 synthetic polymer Polymers 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 206010043207 temporal arteritis Diseases 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 125000003396 thiol group Chemical group [H]S* 0.000 description 1
- 230000009772 tissue formation Effects 0.000 description 1
- 231100000041 toxicology testing Toxicity 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 210000002993 trophoblast Anatomy 0.000 description 1
- 230000004614 tumor growth Effects 0.000 description 1
- 230000006433 tumor necrosis factor production Effects 0.000 description 1
- 102000003298 tumor necrosis factor receptor Human genes 0.000 description 1
- 241001515965 unidentified phage Species 0.000 description 1
- 208000019553 vascular disease Diseases 0.000 description 1
- 230000006711 vascular endothelial growth factor production Effects 0.000 description 1
- 230000000007 visual effect Effects 0.000 description 1
- 238000012800 visualization Methods 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 208000016261 weight loss Diseases 0.000 description 1
- 230000004580 weight loss Effects 0.000 description 1
- 238000009736 wetting Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
- C07K16/241—Tumor Necrosis Factors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
- A61P11/06—Antiasthmatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
- A61P11/08—Bronchodilators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/02—Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/06—Antipsoriatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/06—Antigout agents, e.g. antihyperuricemic or uricosuric agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/08—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/08—Antiallergic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P39/00—General protective or antinoxious agents
- A61P39/02—Antidotes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/04—Antihaemorrhagics; Procoagulants; Haemostatic agents; Antifibrinolytic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/04—Inotropic agents, i.e. stimulants of cardiac contraction; Drugs for heart failure
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6863—Cytokines, i.e. immune system proteins modifying a biological response such as cell growth proliferation or differentiation, e.g. TNF, CNF, GM-CSF, lymphotoxin, MIF or their receptors
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/52—Assays involving cytokines
- G01N2333/525—Tumor necrosis factor [TNF]
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2500/00—Screening for compounds of potential therapeutic value
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/16—Ophthalmology
- G01N2800/164—Retinal disorders, e.g. retinopathy
Definitions
- the present invention relates to a domain antibody construct useful for human therapy. More particularly, the present invention relates to a domain antibody construct which binds to human TNF- ⁇ and its use in the treatment of disorders characterised by TNF- ⁇ activity.
- Tumor necrosis factor alpha is a cytokine that has been implicated in mediating shock and the pathophysiology of a variety of human diseases and disorders including sepsis, infections, autoimmune diseases eg. rheumatoid arthritis, Crohn's disease, ulcerative colitis and other bowel conditions, psoriasis, toxic shock, transplant rejection and graft-versus-host disease.
- TNF- ⁇ is produced primarily by activated macrophages and T lymphocytes, but also by neutrophils, endothelial cells, keratinocytes and fibroblasts during acute inflammatory reactions.
- TNF- ⁇ Because of its role in inflammation, TNF- ⁇ has emerged as an important target for inhibition in efforts to reduce the symptoms of inflammatory disorders.
- Various approaches to inhibition of TNF- ⁇ for the clinical treatment of disease have been pursued, including particularly the use of soluble TNF- ⁇ receptors and antibodies specific for TNF- ⁇ .
- Domain antibodies are the smallest functioning binding units of antibodies and correspond to the variable regions of either the heavy (V H ) or light (V L ) chains of antibodies. Domain antibodies have a molecular weight of approximately 13 kDa, or less than one tenth the size of a full antibody.
- domain antibodies are well expressed in bacterial, yeast and mammalian systems. Their small size allows for higher molar quantities per gram of product, thus providing a significant increase in potency per milligram dose.
- dAbs can be used as building blocks to create therapeutic products such as multiple targeting dAb-containing molecules in which two or more dAbs bind to two or more distinct molecular targets, or dAbs may be incorporated into structures designed for pulmonary or oral administration.
- the present inventors have now devised a novel domain antibody construct comprising an immunoglobulin variable domain linked to a constant region including a truncated C H 1 domain. It is postulated that the inclusion of a constant region will assist in prolonging the in vivo half-life of the dAb which is typically of a short duration.
- New World primates are sufficiently similar to human to have antibodies similar to human antibodies so that the host does not generate an anti-antibody immune response when such primate-derived antibodies are introduced into a human.
- New World primates comprise at least 53 species commonly divided into two families, the Callithricidae and Cebidae.
- the Callithricidae consist of marmosets and tamarins.
- the Cebidae includes the squirrel monkey, titi monkey, spider monkey, woolly monkey, capuchin, night or owl monkey and the howler monkey.
- the present invention provides a domain antibody construct which binds to human TNF- ⁇ , the construct comprising:
- said modified hinge region sequence contains either a deletion or a single amino acid substitution of the cysteine residue which normally facilitates disulfide bond formation between heavy and light antibody chains.
- the present invention provides a nucleic acid sequence encoding the domain antibody construct of the first aspect of the invention.
- the present invention provides an isolated nucleic acid molecule comprising a sequence encoding a domain antibody construct which binds human TNF- ⁇ , wherein the nucleic acid molecule comprises a nucleic acid sequence at least 60%, preferably at least 80% identical, more preferably at least 90%, 95%, 96%, 97%, 98% or 99% identical to the sequence set forth in SEQ ID No:50 or SEQ ID No:51 and most preferably, the sequence set forth in SEQ ID No:50 or SEQ ID No:51.
- the present invention provides an isolated nucleic acid molecule comprising a sequence encoding a domain antibody construct which binds human TNF- ⁇ , wherein the nucleic acid molecule comprises a nucleic acid sequence which hybridises under conditions of high stringency to the nucleotide sequence set forth in SEQ ID No:50 or SEQ ID No:51.
- the invention provides a pharmaceutical composition comprising an effective amount of the domain antibody construct according to the first aspect, together with a pharmaceutically acceptable carrier or diluent.
- the present invention provides for the use of the domain antibody construct according to the first aspect of the invention in a diagnostic application for detecting human TNF- ⁇ .
- the invention provides a method for treating a disorder characterised by human TNF- ⁇ activity in a human subject, comprising administering to the subject a pharmaceutical composition according to the fifth aspect of the invention.
- FIG. 1 shows the amino acid (SEQ ID No:5) and nucleotide sequence (SEQ ID No:6) of the acceptor dAb.
- FIG. 2 shows the structure of the preferred embodiment of the domain antibody construct according to the present invention as (A) a monomer and (B) a dimer.
- FIG. 3(A-G) shows the nucleotide and amino acid sequences of eleven (11) marmoset and six (6) Owl monkey V ⁇ gene segments.
- FIG. 4 shows the acceptor dAb amino acid (SEQ ID NO:5) and nucleotide sequence (both strands) (SEQ ID NO:6 AND SEQ ID NO:68).
- the restriction digest sites for Kpn I and San DI which excises region including the CDR2 is indicated in the figure.
- CDR2 residues removed are indicated in underlined.
- FIG. 5 shows the ability of Compound 170 (SEQ ID No:11) to neutralise TNF- ⁇ mediated cytotoxicity in a murine L929 cell viability assay.
- FIG. 6 shows that Compound 170 (SEQ ID No:11) prevents the interaction of TNF- ⁇ with the human p55 or p75 TNF receptors.
- FIG. 7 shows Compound 170 (SEQ ID No:11) staining of transmembrane TNF- ⁇ -expressing NS0 27D4 cells (solid black line) shows higher fluorescence intensity than irrelevant specificity isotype-matched control (grey fill).
- FIG. 8 shows Compound 170 (SEQ ID No:11) produced in a bacterial expression system retained binding to TNF- ⁇ in an ELISA.
- FIG. 9 shows the efficacy of Compound 170 (SEQ ID No:11) in a TNF-mediated murine arthritis model relative to specificity control human IgG 1 .
- mice were scored (arthritic score), (A), and weighed, (B).
- FIG. 10 shows the effect on protein expression of Compound 112 (SEQ ID No:59) and Compound 170 (SEQ ID No:11).
- the present inventors have generated a domain antibody construct which binds to human TNF- ⁇ and which is postulated to exhibit low immunogenicity when administered to humans.
- the domain antibody construct comprises a portion corresponding to a variable domain of an immunoglobulin heavy or light chain (ie. a domain antibody (dAb)), a hinge region and a portion corresponding to a constant region of an antibody heavy chain but wherein the constant region has a truncated C H 1 domain.
- dAb domain antibody
- constant region portion is postulated to increase the in vivo half life of the dAb as well as providing effector functions which are believed to be a component of the anti-inflammatory mechanism of anti-TNF antibodies.
- the present invention provides a domain antibody construct which binds to human TNF- ⁇ , the construct comprising:
- said modified hinge region sequence contains either a deletion or a single amino acid substitution of the cysteine residue which normally facilitates disulfide bond formation between heavy and light antibody chains.
- sequence of the C H 1 domain and the hinge region is XEPKSZDKTHTCPPCPA (SEQ ID NO:64) wherein X is valine, leucine or isoleucine and Z is absent or an amino acid other than cysteine. It is preferred that X at position one is valine and Z is serine.
- the dAb comprises an immunoglobulin heavy or light chain variable domain, wherein said variable domain comprises at least one complementarity determining region (CDR) having a sequence derived from a New World primate wherein the CDR is selected from the group consisting of AATKLQS (SEQ ID No:1), EASSLQS (SEQ ID No:2), EASKLQS (SEQ ID No:3), and SASNLET (SEQ ID No:4)
- CDR complementarity determining region
- the CDR is CDR2.
- the constant region comprises C H 2 and C H 3 domains which together have the following sequence:
- the domain antibody construct comprises an amino acid sequence which is at least 60%, preferably at least 80% identical, more preferably at least 90%, 95%, 96%, 97%, 98% or 99% identical to the sequence set forth in SEQ ID No:11, and most preferably the sequence set forth in SEQ ID No:11.
- binding to is intended to refer to the binding of an antigen by an immunoglobulin variable region with a dissociation constant (K d ) of 1 ⁇ M or lower as measured by surface plasmon resonance analysis using, for example a BIAcoreTM surface plasmon resonance system and BIAcoreTM kinetic evaluation software (eg. version 2.1).
- K d dissociation constant
- the affinity or dissociation constant (K d ) for a specific binding interaction is preferably about 500 nM or lower, more preferably about 300 nM or lower and preferably at least 300 nM to 50 pM, 200 nM to 50 pM, and more preferably at least 100 nM to 50 pM, 75 nM to 50 pM, 10 nM to 50 pM.
- dAb refers to an antibody single variable domain (V H or V L ) polypeptide that specifically binds antigen.
- the domain antibody construct forms a homo- or heterodimer with another domain antibody construct according to the present invention. Dimerisation can increase the strength of antigen binding, wherein the strength of binding is related to the sum of the binding affinities of the multiple binding sites.
- the hinge region of the domain antibody construct comprises at least one, and preferably two, cysteine residues.
- the domain antibody construct forms a homodimer with an identical domain antibody construct.
- the present invention provides a dimeric domain antibody construct which binds to human TNF- ⁇ wherein the dimer consists of two domain antibody constructs according to the present invention.
- the dimeric domain antibody construct is a homodimer and it is particularly preferred that the domain antibody constructs making up the homodimer comprise an amino acid sequence which is at least 60%, preferably at least 80% identical, more preferably at least 90%, 95%, 96%, 97%, 98% or 99% identical to the sequence set forth in SEQ ID No:11, and most preferably the sequence set forth in SEQ ID No:11.
- the present invention provides a nucleic acid sequence encoding the domain antibody construct of the first aspect of the invention.
- the present invention provides an isolated nucleic acid molecule comprising a sequence encoding a domain antibody construct which binds human TNF- ⁇ , wherein the nucleic acid molecule comprises a nucleic acid sequence at least 60%, preferably at least 80% identical, more preferably at least 90%, 95%, 96%, 97%, 98% or 99% identical to the sequence set forth in SEQ ID No:50 or SEQ ID No:51 and most preferably, the sequence set forth in SEQ ID No:50 or SEQ ID No:51.
- the present invention provides an isolated nucleic acid molecule comprising a sequence encoding a domain antibody construct which binds human TNF- ⁇ , wherein the nucleic acid molecule comprises a nucleic acid sequence which hybridises under conditions of high stringency to the nucleotide sequence set forth in SEQ ID No:50 or SEQ ID No:51.
- amino acid sequence identities or similarities may be calculated using the GAP programme and/or aligned using the PILEUP programme of the Computer Genetics Group, Inc., University Research Park, Madison, Wis., United States of America (Devereaux et al, 1984).
- the GAP programme utilizes the algorithm of Needleman and Wunsch (1970) to maximise the number of identical/similar residues and to minimise the number and length of sequence gaps in the alignment.
- the Clustal W programme of Thompson et al, (1994) is used.
- nucleotide sequences may be aligned and their identity calculated using the BESTFIT programme or other appropriate programme of the Computer Genetics Group, Inc., University Research Park, Madison, Wis., United States of America (Devereaux et al, Nucl. Acids Res., 12:387-395, 1984).
- the invention is further based on a method for amplification of New World primate immunoglobulin variable region genes, for example by polymerase chain reaction (PCR) from nucleic acid extracted from New World primate lymphocytes using primers specific for heavy and light chain variable region gene families.
- PCR polymerase chain reaction
- information regarding the boundaries of the variable domains of heavy and light chain genes can be used to design PCR primers that amplify the variable domain from a cloned heavy or light chain coding sequence encoding an antibody known to bind a given antigen.
- the amplified variable region is then inserted either alone or as a fusion with another polypeptide sequence for the human or primate constant region sequence of the invention into a suitable expression vector for production of the domain antibody construct of the invention.
- suitable expression vectors will be familiar to those skilled in the art.
- the repertoire of V H , V L and constant region domains can be a naturally occurring repertoire of immunoglobulin sequences or a synthetic repertoire.
- a naturally occurring repertoire is one prepared, for example, from immunoglobulin-expressing cells harvested from one or more primates. Such repertoires can be na ⁇ ve ie. prepared from newborn immunoglobulin expressing cells, or rearranged ie. prepared from, for example, adult primate B cells. If desired, clones identified from a natural repertoire, or any repertoire that bind the target antigen are then subject to mutagenesis and further screening in order to produce and select variants with improved binding characteristics.
- Synthetic repertoires of single immunoglobulin variable domains are prepared by artificially introducing diversity into a cloned variable domain.
- a repertoire of V H and V L domains can be screened for desired binding specificity and functional behaviour by, for example phage display.
- Methods for the construction of bacteriophage display libraries and lambda phage expression libraries are well known in the art.
- the phage display technique has been described extensively in the art and examples of methods and compounds for generating and screening such libraries and affinity maturing the products of them can be found in, for example, Barbas et al. (1991) PNAS 88:7978-7982; Clarkson et al. (1991) Nature 352:624-628; Dower et al. PCT. 91/17271, U.S. Pat. No. 5,427,908, U.S. Pat. No.
- Recombinant libraries expressing the repertoire of V H and V L domains can be expressed on the surface of microorganisms eg. yeast or bacteria (see PCT publications WO 99/36569 and 98/49286).
- the domain antibody construct of the invention may be produced by recombinant means, including from eukaryotic expression systems including, for example, yeast, higher plant, insect and mammalian cells, as well as fungi and virally-encoded expression systems, as described herein or as known in the art.
- eukaryotic expression systems including, for example, yeast, higher plant, insect and mammalian cells, as well as fungi and virally-encoded expression systems, as described herein or as known in the art.
- the domain antibody constructs of the present invention can be prepared using an S antibody encoding nucleic acid to provide transgenic plants and cultured plant cells (e.g., but not limited to tobacco and maize) that produce such constructs in the plant parts or in cells cultured therefrom.
- transgenic tobacco leaves expressing recombinant proteins have been successfully used to provide large amounts of recombinant proteins, e.g., using an inducible promoter (see, e.g., Cramer et al., Curr. Top. Microbol. Immunol. 240:95-118 1999) and references cited therein.
- transgenic maize has been used to express mammalian proteins at commercial production levels, with biological activities equivalent to those produced in other recombinant systems or purified from natural sources (see, e.g., Hood et al., Adv. Exp. Med. Biol. 464:127-147 1999 and references cited therein).
- Antibodies have also been produced in large amounts from transgenic plant seeds including antibody fragments, such as single chain antibodies (scFv's), including tobacco seeds and potato tubers (see, e.g., Conrad et al., Plant Mol. Biol. 38:101-109 1998 and reference cited therein).
- the domain antibody constructs of the present invention can also be produced using transgenic plants, according to known methods (see also, e.g., Fischer et al., Biotechnol. Appl. Biochem. 30:99-108 October, 1999: Ma & Hein., Trends Biotechnol. 13:522-7 1995; Ma et al., Plant Physiol. 109:341-6 1995; Whitelam et al., Biochem. Soc. Trans. 22:940-944 1994; and references cited therein; each of the above references is entirely incorporated herein by reference).
- the domain antibody constructs of the present invention include naturally purified products, products of chemical synthetic procedures, and products produced by recombinant techniques from a eukaryotic host, including, for example, yeast, higher plant, insect and mammalian cells.
- a eukaryotic host including, for example, yeast, higher plant, insect and mammalian cells.
- the antibody constructs of the present invention can be glycosylated or can be non-glycosylated, with glycosylated preferred.
- Such methods are described in many standard laboratory manuals Sambrook, et al., Molecular Cloning: A Laboratory Manual, 2 nd Edition, Cold Spring Harbor, N.Y. 1989, Sections 17.37-17.42; Ausubel et al, eds.
- the recombinant peptide/protein library is displayed on ribosomes (for examples see Roberts, R W and Szostak, J. W. 1997 Proc. Natl. Acad. Sci. USA. 94:12297-123202 and PCT Publication No. WO98/31700).
- a DNA library eg of antibodies or derivatives preferably prepared from immunised cells, but not so limited
- translation of the library such that the protein and “immunised” mRNAs stay on the ribosome
- affinity selection eg by binding to RSP
- mRNA isolation eg by polymerase chain reaction or related technology
- Remplification eg by polymerase chain reaction or related technology. Additional rounds of selection and amplification can be coupled as necessary to affinity maturation through introduction of somatic mutation in this system or by other methods of affinity maturation as known in the state of the art.
- the CDR sequences may be obtained from several sources, for example, databases such as The National Centre for Biotechnology Information protein and nucleotide databases www.ncbi.nlm.nih.gov, The Kabat Database of Sequences of Proteins of Immunological Interest www.kabatdatabase.com, or the IMGT database www.imgt.cines.fr.
- the CDR regions can be predicted from the V H and V L domain repertoire (see for example Kabat E A and Wu T T Attempts to locate complementarity determining residues in the variable positions of light and heavy chains. Ann. NY Acad. Sci. 190:382-393 (1971)).
- the CDR sequence may be a genomic DNA or a cDNA.
- the preferred method of the present invention involves replacement of the CDR2 in the variable region (or dAb) via primer directed mutagenesis.
- This method consists of annealing a synthetic oligonucleotide encoding a desired mutation(s) to a target region where it serves as a primer for initiation of DNA synthesis in vitro, extending the oligonucleotide by a DNA polymerase to generate a double-stranded DNA that carries the desired mutation, and ligating and cloning the sequence into an appropriate expression vector.
- the New World primate CDR sequence is grafted into a variable region sequence which is of low immunogenicity in humans.
- domain antibody construct or antigen-binding portion thereof, does not raise an antibody response in a human of sufficient magnitude to reduce the effectiveness of continued administration of the domain antibody construct for a sufficient time to achieve therapeutic efficacy.
- variable region sequence into which the New World primate CDR is grafted is the “dAb acceptor sequence” (designated Compound 128), in FIG. 1 .
- the dAb acceptor sequence consists of the amino acid sequence set forth in SEQ ID No:5:
- a marmoset New World primate CDR sequence SASNLET (SEQ ID No:4) is grafted into the variable region dAb acceptor sequence so as to replace the CDR2 sequence (SASELQS; SEQ ID No:55) of the dAb acceptor sequence to produce the following dAb (designated Compound 145):
- the dAb of the domain antibody construct which binds to human TNF- ⁇ comprises the amino acid sequence set forth in SEQ ID No:7.
- variable region sequence (dAb) of the domain antibody construct may be further subject to affinity maturation in order to improve its antigen binding characteristics. This may necessitate the modification of certain amino acid residues within CDR1, CDR3 or framework of the domain antibody construct.
- variable region (dAb) of the domain antibody construct which binds to human TNF- ⁇ comprises the amino acid sequence of SEQ ID No:8 or SEQ ID No:9. These have been designated Compound 123 and Compound 100 respectively, and their sequences are shown below:
- variable region (dAb) of the domain antibody construct which binds to human TNF- ⁇ comprises the amino acid sequence of SEQ ID No:10. This has been designated Compound 196 and the sequence is provided below:
- the constant region sequence of the domain antibody construct may be derived from human or primate sequences.
- the primate sequence may be New World primate or an Old World primate sequence.
- Suitable Old World primates include chimpanzee, or other hominid ape eg. gorilla or orangutan, which because of their close phylogenetic proximity to humans, share a high degree of homology with the human constant region sequence.
- the constant region is derived from a human antibody sequence.
- the inventors have truncated the C H 1 domain of the constant (Fc) region.
- a minimal number of C H 1 domain residues have been retained in order to provide flexibility in the domain antibody construct around the hinge region.
- at least 20 C-terminal amino acid residues of the C H 1 domain are retained, more preferably at least 10 amino acids, still more preferably at least 5 amino acids, even more preferably a single amino acid residue.
- the domain antibody construct has a format comprising dAb-C terminal C H 1 domain residue-hinge region-C H 2 domain-C H 3 domain as illustrated schematically in FIG. 2 .
- the domain antibody construct has the amino acid sequence set forth in SEQ ID No:11. This has been designated Compound 170.
- the hinge region of the naturally occurring immunoglobulin contains a cysteine (C) side chain which facilitates the formation of a disulfide bond between the C H 1 domain of the heavy chain and the constant domain of the light chain.
- C cysteine
- the construct comprises only a single variable domain and thus leaves a potentially reactive unpaired cysteine residue, the cysteine residue has been substituted with an amino acid residue which prevents disulfide bond formation.
- the potential consequences of having an unpaired cysteine may include reduced protein expression due to aggregation and misfolding of the construct.
- any hinge region sequence derived from any of the antibody classes would be appropriate for use in the present invention. It is preferred however, that the hinge region is derived from the antibody subclass IgG i . Preferably, the hinge region is based on the naturally occurring sequence of the hinge region of IgG i and comprises the sequence EPKS S DKTHTCPPCPA (SEQ ID No:12). In this sequence, the Cys which normally occurs at position 5 is replaced by the underlined bolded Ser residue.
- the C-terminal amino acid residue of the C H 1 domain is derived from IgG1. More preferably, the C H 1 residue is a valine (V) residue or a conservative amino acid substitution such as leucine (L) or isoleucine (I). This residue is located immediately proximal to the hinge region and assists in increasing the flexibility of the construct around the hinge region.
- V valine
- I isoleucine
- the domain antibody construct may be derivatised or linked to another functional molecule.
- the domain antibody construct can be functionally linked by chemical coupling, genetic fusion, noncovalent association or otherwise, to one or more other molecular entities, such as another antibody, a detectable agent, a cytotoxic agent, a pharmaceutical agent, and/or a protein or peptide that can mediate association of the antibody or antibody-binding portion with another molecule (such as a streptavidin core region or a polyhistidine tag).
- Useful detectable agents with which the domain antibody construct may be derivatised include fluorescent compounds.
- Exemplary fluorescent detectable agents include fluorescein, fluorescein isothiocyanate, rhodamine, 5-dimethylamine-1-napthalenesulfonyl chloride, phycoerythrin and the like.
- the domain antibody construct may also be derivatised with detectable enzymes such as alkaline phosphatase, horseradish peroxidase, glucose oxidase and the like. When the domain antibody construct is derivatized with a detectable enzyme, it is detected by adding additional reagents that the enzyme uses to produce a detectable reaction product.
- the domain antibody construct may also be derivatised with biotin, and detected through indirect measurement of avidin or streptavidin binding.
- the domain antibody construct according to the invention may be linked to one or more molecules which provide increased half-life and resistance to degradation without loss in activity (eg binding affinity) in vivo. These molecules may be linked to the domain antibody construct via a linker so that they do not interfere/sterically hinder the antigen binding site.
- adduct molecules include for example dAbs directed to an endogenous molecule as described in US patent application 20050271663. Typically, such adduct molecules are polypeptides or fragments of polypeptides which occur naturally in vivo and which resist degradation or removal by endogenous mechanisms. Molecules which increase half life may be selected from the following:
- proteins from the extracellular matrix eg. collagen, laminin, integrin and fibronectin
- proteins found in blood eg. fibrin ⁇ -2 macroglobulin, serum albumin, fibrinogen A, fibrinogen B, serum amyloid protein A, heptaglobin, protein, ubiquitin, uteroglobulin, ⁇ -2 microglobulin, plasminogen, lysozyme, cystatin C, alpha-1-antitrypsin and pancreatic kypsin inhibitor
- immune serum proteins eg. IgE, IgG, IgM
- transport proteins eg.
- retinol binding protein ⁇ -1 microglobulin
- defensins eg. beta-defensin 1, neutrophil defensins 1, 2 and 3
- proteins found at the blood brain barrier or in neural tissues eg. melanocortin receptor, myelin, ascorbate transporter
- transferrin receptor specific ligand-neuropharmaceutical agent fusion proteins see U.S. Pat. No.
- brain capillary endothelial cell receptor transferrin, transferrin receptor, insulin, insulin-like growth factor 1 (IGF 1) receptor, insulin-like growth factor 2 (IGF 2) receptor, insulin receptor;
- IGF 1 insulin-like growth factor 1
- IGF 2 insulin-like growth factor 2
- proteins localised to the kidney eg. polycystin, type IV collagen, organic anion transporter K1, Heymann's antigen
- proteins localised to the liver eg. alcohol dehydrogenase, G250
- blood coagulation factor X blood coagulation factor X
- ⁇ -1 antitrypsin ⁇ -1 antitrypsin
- proteins localised to the lung eg. secretory component (binds IgA);
- proteins localised to the heart eg. HSP 27;
- proteins localised to the skin eg. keratin;
- bone specific proteins such as bone morphogenic proteins (BMPs) eg. BMP-2, -4, -5, -6, -7 (also referred to as osteogenic protein (OP-1) and -8 (OP-2);
- tumour specific proteins eg. human trophoblast antigen, herceptin receptor, oestrogen receptor, cathepsins eg cathepsin B (found in liver and spleen);
- disease-specific proteins eg.
- LAG-3 lymphocyte activation gene
- osteoprotegerin ligand OPGL
- OX40 a member of the TNF receptor family, expressed on activated T cells and the only costimulatory T cell molecule known to be specifically up-regulated in human T cell leukaemia virus type-I (HTLV-I)-producing cells—see Pankow R et al J. Immunol.
- metalloproteases associated with arthritis/cancers
- metalloproteases including CG6512 Drosophila , human paraplegin, human FtsH, human AFG3L2, murine ftsH
- angiogenic growth factors including acidic fibroblast growth factor (FGF-1), basic fibroblast growth factor (FGF-2), Vascular endothelial growth factor/vascular permeability factor (VEGF/VPF), transforming growth factor- ⁇ (TGF- ⁇ ), tumor necrosis factor-alpha (TNF- ⁇ ), angiogenin, interleukin-3 (IL-3), interleukin-8 (IL-8), platelet derived endothelial growth factor (PD-ECGF), placental growth factor (PlGF), midkine platelet-derived growth factor-BB (PDGF), fractalkine; (s) stress proteins (heat shock proteins); and (t) proteins involved in Fc transport.
- FGF-1 acidic fibroblast growth factor
- FGF-2 basic fibroblast growth factor
- the present invention also extends to a PEGylated domain antibody construct which provides increased half-life and resistance to degradation without a loss in activity (e.g. binding affinity) relative to non-PEGylated antibody polypeptides.
- the domain antibody construct can be coupled, using methods known in the art, to polymer molecules (preferably PEG) useful for achieving the increased half-life and degradation resistance properties.
- Polymer moieties which can be utilised in the invention can be synthetic or naturally occurring and include, but not limited to straight or branched chain polyalkylene, polyalkenylene or polyoxyalkylene polymers, or a branched or unbranched polysaccharide such as a homo- or heteropolysaccharide.
- Preferred examples of synthetic polymers which can be used in the invention include straight or branched chain poly(ethylene glycol) (PEG), poly(propylene glycol), or poly(vinyl alcohol) and derivatives or substituted forms thereof.
- Particularly preferred substituted polymers for linkage to the domain antibody construct include substituted PEG, including methoxy(polyethylene glycol).
- Naturally occurring polymer moieties which can be used in addition to or in place of PEG include lactose, amylose, dextran, or glycogen, as well as derivatives thereof which would be recognised by persons skilled in the art.
- the polymer (PEG) molecules useful in the invention can be attached to the domain antibody construct using methods which are well known in the art.
- the first step in the attachment of PEG or other polymer moieties to the domain antibody construct of the invention is the substitution of the hydroxyl end-groups of the PEG polymer by electrophile-containing functional groups.
- PEG polymers are attached to either cysteine or lysine residues present in the domain antibody construct monomers or multimers.
- the cysteine and lysine residues can be naturally occurring, or can be engineered into the domain antibody construct molecule.
- Pegylation of the domain antibody constructs of the invention may be accomplished by any number of means (see for example Kozlowski-A & Harris-J M (2001) Journal of Controlled Release 72:217).
- PEG may be attached to the domain antibody construct either directly or by an intervening linker.
- Linkerless systems for attaching polyethylene glycol to proteins is described in Delgado et al., (1992), Crit. Rev. Thera. Drug Carrier Sys. 9:249-304; Francis et al., (1998), Intern. J. Hematol. 68:1-18; U.S. Pat. No. 4,002,531; U.S. Pat. No. 5,349,052; WO 95/06058; and WO 98/32466, the disclosures of each of which are incorporated herein by reference.
- One system for attaching polyethylene glycol directly to amino acid residues of proteins without an intervening linker employs tresylated MPEG, which is produced by the modification of monomethoxy polyethylene glycol (MPEG) using tresylchloride. Following reaction of amino acid residues with tresylated MPEG, polyethylene glycol is directly attached to the amine groups.
- MPEG monomethoxy polyethylene glycol
- the invention includes protein-polyethylene glycol conjugates produced by reacting proteins of the invention with a polyethylene glycol molecule having a 2,2,2-trifluoreothane sulphonyl group.
- Polyethylene glycol can also be attached to proteins using a number of different intervening linkers.
- U.S. Pat. No. 5,612,460 discloses urethane linkers for connecting polyethylene glycol to proteins.
- Protein-polyethylene glycol conjugates wherein the polyethylene glycol is attached to the protein by a linker can also be produced by reaction of proteins with compounds such as MPEG-succinimidylsuccinate, MPEG activated with 1,1′-carbonyldiimidazole, MPEG-2,4,5-trichloropenylcarbonate, MPEG-p-nitrophenolcarbonate, and various MPEG-succinate derivatives.
- MPEG-succinimidylsuccinate MPEG activated with 1,1′-carbonyldiimidazole
- MPEG-2,4,5-trichloropenylcarbonate MPEG-p-nitrophenolcarbonate
- MPEG-succinate derivatives A number of additional polyethylene glycol derivatives and reaction chemistries for attaching polyethylene glycol to proteins
- the domain antibody construct is coupled directly to polyethylene glycol via a lysine residue.
- the domain antibody construct is coupled directly to PEG via a cysteine residue.
- the unpaired cysteine residue could pre-exist in the sequence, could be added by incorporating a cysteine residue in, for example, the C-terminus of the domain antibody construct.
- attachment of the PEG to the domain antibody construct could be facilitated via a disulphide bonded cysteine such as that described in US20060210526.
- polymer molecules include, for example, derivatives which have additional moieties or reactive groups present therein to permit interaction with amino acid residues of the domain antibody constructs described herein.
- derivatives include N-hydroxylsuccinimide (NHS) active esters, succinimidyl propionate polymers, and sulfhydryl-selective reactive agents such as maleimide, vinyl sulfone, and thiol.
- NHS N-hydroxylsuccinimide
- PEG polymers can be linear molecules, or can be branched wherein multiple PEG moieties are present in a single polymer.
- the reactive group (e.g., MAL, NHS, SPA, VS, or Thiol) may be attached directly to the PEG polymer or may be attached to PEG via a linker molecule.
- the size of polymers useful in the invention can be in the range of 500 Da to 60 kDa, for example, between 1000 Da and 60 kDa, 10 kDa and 60 kDa, 20 kDa and 60 kDa, 30 kDa and 60 kDa, 40 kDa and 60 kDa, and up to between 50 kDa and 60 kDa.
- the polymers used in the invention, particularly PEG can be straight chain polymers or may possess a branched conformation.
- the domain antibody construct according to the first aspect may be multimerised, as for example, hetero- or homodimers, hetero- or homotrimers, hetero- or homotetramers, or higher order hetero- or homomultimers. Multimerisation can increase the strength of antigen binding, wherein the strength of binding is related to the sum of the binding affinities of the multiple binding sites.
- the invention provides a pharmaceutical composition comprising an effective amount of the domain antibody construct according to the first aspect, together with a pharmaceutically acceptable carrier or diluent.
- a “pharmaceutically acceptable carrier” includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like which are physiologically compatible.
- pharmaceutically acceptable carriers include one or more of water, saline, phosphate buffered saline, dextrose, glycerol, ethanol, and the like as well as combinations thereof.
- isotonic agents for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition.
- Pharmaceutically acceptable substances such as minor amounts of auxiliary substances such as wetting or emulsifying agents, preservatives or buffers.
- the composition may be in a variety of forms, including liquid, semi-solid and solid dosage forms, such as liquid solutions (eg inhalable, injectable and infusible solutions), dispersions or suspensions, tablets, pills, powders, liposomes and suppositories.
- liquid solutions eg inhalable, injectable and infusible solutions
- dispersions or suspensions tablets, pills, powders, liposomes and suppositories.
- the composition is in the form of an injectable solution for immunization.
- the administration may be intravenous, intra-arterial, subcutaneous, intraperitoneal, or intramuscular.
- compositions typically must be sterile and stable under the conditions of manufacture and storage.
- the compositions can be formulated as a solution, microemulsion, dispersion, liposome, or other ordered structure suitable to high drug concentration.
- the proper fluidity of a solution can be maintained by for example, use of a coating such as lecithin and/or surfactants.
- Sterile injectable solutions can be prepared by incorporating the active compound (ie. domain antibody construct) in the required amount into an appropriate solvent with one or a combination of ingredients listed above, followed by filtered sterilisation.
- composition may also be formulated as a sterile powder for the preparation of sterile injectable solutions.
- the active compound may be prepared with a carrier that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems.
- a carrier that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems.
- Compatible polymers may be used such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters and polylactic acid.
- composition may also be formulated for oral administration.
- the domain antibody construct may be enclosed in a hard or soft shell gelatin capsule, compressed into tablets, or incorporated directly into the subject's diet.
- Formulations that allow for pulmonary, rectal, transdermal, intrathecal and intraocular administration will be familiar to persons skilled in the art.
- the domain antibody construct may be co-formulated with and/or co-administered with one or more additional therapeutic agents eg. soluble TNF- ⁇ receptor or a chemical agent that inhibits human TNF- ⁇ production, or antibodies that bind other targets such as cytokines or cell surface molecules. Alternatively, it may be co-administered with a soluble immunochemical reagent such as protein A, C, G or L.
- additional therapeutic agents eg. soluble TNF- ⁇ receptor or a chemical agent that inhibits human TNF- ⁇ production, or antibodies that bind other targets such as cytokines or cell surface molecules.
- a soluble immunochemical reagent such as protein A, C, G or L.
- An effective amount may include a therapeutically effective amount or prophylactically effective amount of the domain antibody construct of the invention.
- a therapeutically effective amount refers to an amount effective at dosages and for periods of time necessary, to achieve the desired therapeutic result.
- a prophylactically effective amount refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result. Because a prophylactic dose is administered to a subject prior to or at an earlier stage of disease, the prophylactically effective amount may be less than the therapeutically effective amount.
- the present invention provides for the use of the domain antibody construct according to the first aspect of the invention in a diagnostic application for detecting human TNF- ⁇ .
- the anti-human TNF- ⁇ domain antibody construct according to the invention can be used to detect human TNF- ⁇ for example in a biological sample, such as serum or plasma using a conventional immunoassay, such as an enzyme linked immunosorbent assay (ELISA), a radioimmunoassay (RIA) or tissue immunohistochemistry.
- a biological sample such as serum or plasma
- a conventional immunoassay such as an enzyme linked immunosorbent assay (ELISA), a radioimmunoassay (RIA) or tissue immunohistochemistry.
- ELISA enzyme linked immunosorbent assay
- RIA radioimmunoassay
- tissue immunohistochemistry tissue immunohistochemistry.
- the anti-human TNF- ⁇ domain antibody construct according to the invention can be assayed in biological fluids by a competition immunoassay using recombinant human TNF- ⁇ standards labelled with a detectable substance and an unlabelled anti-human TNF- ⁇ antibody.
- the anti-human TNF- ⁇ domain antibody construct according to the invention may also be used to detect TNF- ⁇ from species other than humans such as non-human primates including cynomolgus, chimpanzee, marmoset, rhesus and other species such as dog, rat, mouse, rabbit, cat, pig, bovine.
- the anti-human TNF- ⁇ domain antibody construct according to the invention may also be used in cell culture applications where it is desired to inhibit TNF- ⁇ activity.
- the invention provides a method for treating a disorder characterised by human TNF- ⁇ activity in a human subject, comprising administering to the subject a pharmaceutical composition according to the second aspect of the invention.
- a disorder characterised by human TNF- ⁇ activity is intended to include diseases and other disorders in which the presence of TNF- ⁇ in a subject suffering from the disorder has been shown to be or is suspected of being either responsible for the pathophysiology of the disorder or a factor which contributes to a worsening of the disorder.
- the disorder characterised by human TNF- ⁇ activity is selected from the group consisting of inflammation, inflammatory diseases, sepsis, including septic shock, endotoxic shock, gram negative sepsis and toxic shock syndrome; autoimmune disease, including rheumatoid arthritis, juvenile arthritis, rheumatoid spondylitis, ankylosing spondylitis, Sjögren's syndrome, osteoarthritis and gouty arthritis, allergy, multiple sclerosis, autoimmune diabetes, autoimmune uveitis, psoriasis, pemphigoid and nephrotic syndrome; inflammatory conditions of the eye, including macular degeneration, uveitis, Behçet's disease; infectious disease, including fever and myalgias due to infection and cachexia secondary to infection; graft versus host disease; tumour growth or metastasis, hematologic malignancies; pulmonary disorders including asthma, adult respiratory distress syndrome, shock lung, chronic pulmonary inflammatory disease,
- the disorder characterised by human TNF- ⁇ activity is age-related macular degeneration.
- TNF- ⁇ is implicated in stimulating VEGF production and promoting neovascularisation in the eye (Oh-H et al., 1999 Investigative Ophthalmology & Visual Science 40:1891-98), and therefore inhibitors of TNF- ⁇ activity, such as the domain antibody constructs described herein, would be useful for therapy of angiogenesis-related ocular disorders including age-related macular degeneration.
- Marmoset (genus Callithrix , species unknown) and Owl monkey ( Aotus trivirgatus ) genomic DNA were obtained from the European Collection of Cell Cultures (ECACC), catalogue numbers 85011419 and 90110510 respectively. Marmoset DNA was derived from cell line B95-8 while Owl monkey DNA came from cell line OMK 637-69.
- V ⁇ leader sequences and recombination signal sequences were derived from Walter and Tomlinson, Antibody Engineering: A Practical Approach (1996).
- the primers used for amplification of germline V ⁇ DNA were as follows:
- Primer VK1BL AATCKCAGGTKCCAGATG (SEQ ID No:13) Primer VK1BL35a GTTYRGGTKKGTAACACT (SEQ ID No:14) Primer VK1BL35b ATGMCTTGTWACACTGTG (SEQ ID No:15)
- PCR (30 cycles) was performed using Taq polymerase with either primer pair VK1BLxVK1BL35a or VK1BLxVK1BL35b. There was overlap between the sequences cloned and the two primer sets used.
- Genomic PCR products were cloned into Invitrogen's TOPO TA cloning kit (Cat No K4500-01) and sequenced with M13 Forward and pUC Reverse primers. Sequence was confirmed in forward and reverse directions. In order to further confirm key sequences were not subject to PCR errors, the PCR and cloning process was repeated twice for marmoset sequences. Nucleotide (SEQ ID Nos:16-26 and SEQ ID Nos:38-43) and amino acid (SEQ ID Nos:27-37 and SEQ ID Nos:44-49) are given in FIG. 3 (A-G). Marmoset sequences 1, 2 and 3 were confirmed. Sequences 4, 5, 6, 7 and 8 were seen only in the initial PCR. Sequences 9, 10 and 11 were seen only in the repeat (ie second) PCR and cloning.
- AATKLQS (SEQ ID No:1) from Owl monkey sequence 1 (SEQ ID No:44), EASSLQS (SEQ ID No:2) from Owl monkey sequence 2 (SEQ ID No:45), EASKLQS (SEQ ID No:3) from Marmoset sequence 1 (SEQ ID No:27), and SASNLET (SEQ ID No:4) from Marmoset sequence 2 (SEQ ID No:28), were chosen from the amino acid sequences shown in FIG. 3 (A-G).
- Owl Monkey sequence 5 YASSLQS (SEQ ID No:56) was found to be identical to GI6176295 an Aotus nancymaae (Ma's night monkey) cDNA sequence, all other sequences were unique.
- acceptor variable region (anti-TNF domain antibody) sequence in the expression vector was digested (25 ⁇ g) sequentially with KpnI and SanDI which excises the majority of FR2 as well as CDR2 as indicated on the restriction digest map, FIG. 4 .
- the vector was then gel purified to remove the excised wild-type FR2 and CDR2 sequence.
- Oligo annealing was performed by incubating oligo pairs (500 pmol, based on sequences shown in FIG. 3 (A-G)) at 95° C. for 5 minutes followed by 65° C. for 5 minutes and then allowed to reach room temperature slowly on a hot block. Overlaps were then filled in during a Klenow reaction in the presence of dNTPs. Molecular cloning of the synthetic double-stranded DNA (derived by oligo annealing and end filling) into the acceptor variable region sequence was achieved using standard methods.
- the marmoset CDR-grafted dAb Compound 145 (SEQ ID No:7) was affinity matured by constructing 14 separate libraries, each a diversification of the sequence of SEQ ID No:7 at a single amino acid residue. The selected residues are shown bolded below.
- CHOK1SV cells (Lonza Biologics, UK), a suspension variant of CHOK1, were maintained in logarithmic growth phase in CD CHO media supplemented with 6 mM L-glutamine (Invitrogen Cat Nos. 10743-029 and 25030-081). Cultures were incubated at 36.5° C., 10% CO 2 and shaking at 140 rpm. 24 hours before transfection cell number and viability was assessed by trypan blue exclusion (Sigma Cat No. T8154) on a haemocytometer.
- Each sequence was flanked at the 5′ end with a Hind III site, a Kozak sequence (GCCACC; SEQ ID No:57) and a human IgG kappa leader sequence (amino acid sequence MSVPTQVLGLLLLWLTDARC; SEQ ID No:58).
- GCCACC Kozak sequence
- MSVPTQVLGLLLLWLTDARC human IgG kappa leader sequence
- At the 3′ end two stop codons and an EcoR I site were added to each sequence.
- Following synthesis genes were provided cloned into a pCRScript vector (Stratagene) and were released by Hind III/EcoR I digestion in the appropriate restriction enzyme buffer (Roche Diagnostics Cat Nos. 10656313001, 10703737001 and 11417967001 respectively).
- the GS expression vector pEE12.4 (Lonza Biologics, UK) was similarly digested and dephosphorylated using calf intestinal alkaline phosphatase Roche Diagnostics Cat No. 10713023001). Each gene was ligated into the prepared pEE12.4 backbone using the LigaFast Rapid DNA Ligation System from Promega (Cat No. M8221). Ligations were then transformed into One Shot Top 10 chemically competent cells (Invtrogen Cat No. C4040-03) and positive colonies identified by standard techniques. Large quantities of the resulting vectors (pEE12.4-PNO621 and pEE12.4-PNO521-S114C) were prepared by midiprep of overnight cultures using QIAfilter midiprep columns (QIAgen Cat No.
- Vectors were prepared for transfection by precipitating 20 ⁇ g in 100% ethanol with 1/10 volume of 3 M sodium acetate (pH 5.2) (Sigma Cat Nos. E7023 and 52889 respectively). Following a wash in 70% ethanol, vectors were resuspended in 40 ⁇ l of T.E. pH 8.0 (Sigma Cat No. T9285) at a working concentration of 0.5 ⁇ g/ ⁇ l.
- Microtitre plates (e.g. Sarstedt 82.9923-148) were coated with a 1 ⁇ g/mL solution of human recombinant TNF- ⁇ (Peprotech Cat # 300-01A) in carbonate/bicarbonate coating buffer pH 9.6, 100 ⁇ L/well. After overnight incubation at 4° C., plates were washed 3 times with PBS (0.01 M, pH 7.2) with 0.05% Tween 20, and 3 times with PBS. 200 ⁇ L blocking buffer (PBS with 1% BSA ⁇ bovine serum albumin, Sigma Cat #A-9647 ⁇ ) was added per well and incubated at 25° C. for 1 hour.
- PBS 1% BSA ⁇ bovine serum albumin
- ABTS substrate (2,2′-Azino-bis(3-Ethylbenz-Thiazoline-6-Sulfonic acid) diammonium salt, Sigma Cat # A-1888, 0.5 mg/mL in citrate buffer pH 4.4, with 0.03% H 2 O 2 ) were added per well.
- Substrate was developed for 30 minutes at room temperature and absorbance read at 405 nm (reference 620 nm). Sample concentrations were determined relative to the standard curve and were expressed relative to the mean concentration of Compound 112 expressed.
- truncated C H 1 in the domain antibody construct results in a junction between the variable domain and hinge with higher homology to a conventional IgG i C H 1-hinge junction (91.7%) than a junction lacking the truncated C H 1 (83.3%; calculated using Align X on Vector NTI (Invitrogen) with a gap opening penalty of 1).
- Enhanced homology is likely to translate to increased resemblance to conventional immunoglobulin peptide sequences to which human patients should be immunologically tolerant, thereby reducing immunogenic potential.
- TKVEIKR V EPKS (SEQ ID NO: 65) IgG 1 C H 1-hinge junction (NCBI accession AAG00909): TKVDKRV EPKS (SEQ ID NO: 66)
- TKVEIKREPKS (SEQ ID NO: 67)
- C H 1 sequence is bolded as indicated.
- C H 1 domain (SEQ ID No:60) obtained from NCBI protein database (http://www.ncbi.nlm.nih.gov) AAG00909:
- the ability of the domain antibody construct Compound 170 (SEQ ID No:11) to neutralize TNF- ⁇ -mediated cytotoxicity was assessed using a murine L929 cell viability assay.
- Serial dilutions of Compound 170 in RPMI medium with 10% foetal bovine serum (RPMI-FBS) were prepared in 50 ⁇ L volumes in flat bottomed 96 well plates.
- RPMI-FBS foetal bovine serum
- Controls included wells with no TNF (for determination of 100% viability), no cells (0% viability) and a TNF- ⁇ standard curve ranging from 2 pg/mL to 4200 pg/mL.
- Culture plates were incubated in a 5% CO 2 atmosphere at 37° C. for 20 hours, then for a further 3 hours after the addition of 25 ⁇ L 3-(4,5-dimethylthiazol-2yl)-5-(3-carboxymethoxyphenyl)-2-(4-sulfophenyl)-2H-tetrazolium (MTS)/phenazine ethosulfate (PES) (Promega CellTiter 96 AQ ueous One, Madison USA).
- the ability of the domain antibody construct Compound 170 (SEQ ID No:11) to inhibit binding of TNF- ⁇ to human p55 and p75 TNF receptors was evaluated by receptor binding assays.
- Human p55 (RnD systems, Cat No: 372-RI) or p75 (RnD systems, Cat No: 762-R2) was coated onto Maxisorb plates (Nunc) at 0.1 ⁇ g/mL in carbonate coating buffer pH 9.2 by overnight incubation at 4° C.
- Serial half-log dilutions of Compound 170 ranging from 100 ⁇ g/mL down to 3.15 ng/mL (and a no Compound 170 ‘blank’ control) were prepared in antibody diluent (PBS pH 7.2, 0.05% Tween-20, 1% BSA) and were mixed with an equal volume of 60 ng/mL human TNF- ⁇ in antibody diluent.
- a blank containing no PN0621 and no TNF- ⁇ was also prepared to measure background binding. All mixtures were allowed to incubate for exactly 1 hour at room temperature with gentle agitation. During this incubation the coated plates were washed 3 times with PBS, 0.05% Tween-20 and then 3 times with PBS.
- the plates were then blocked with 200 ⁇ l/well of PBS, 1% BSA for 45 minutes at room temperature. Following washing of the plate, 100 ⁇ l of the Compound 170/TNF- ⁇ mixtures were added to triplicate wells for each concentration of Compound 170 tested along with addition of all the controls. The plate was then incubated at room temperature for 1 hour. Following washing of the plate, a biotinylated anti-human TNF- ⁇ antibody (RnD Systems, Cat No: BAF210) was added at 0.6 ⁇ g/mL in antibody diluent to each well and incubated for 1 hour at room temperature.
- TNF- ⁇ a similar cell line based on another murine myeloma (SP2/0) has been described (Scallon et al., (1995) Cytokine 7 251-259).
- Flow cytometry analysis was performed on 5 ⁇ 10 5 viable 27D4 cells per sample with all steps performed at 4° C. or on ice.
- Cell pellets were resuspended with test (Compound 170; SEQ ID No:11) or irrelevant-specificity isotype-matched control (Sigma, Cat No: I5154) at 100 ⁇ g/ml in PBS containing 2% FBS, and incubated on ice for 1 hour.
- Two cell wash cycles were performed, each comprising, centrifugation for 10 minutes at 1000 ⁇ g and resuspension of the cell pellet in PBS/2% FBS.
- the cell pellet was resuspended in 100 ⁇ l secondary antibody conjugate (Anti-human Fc FITC conjugate, Sigma, Cat No: F9512) and incubated for 30 mins. The samples were then washed twice as described above and cell pellets resuspended in 500 ⁇ l PBS/2% FBS with 5 ⁇ g/mL propidium iodide (Sigma, Cat no: P4864). Fluorescent staining of cells was analysed on a Beckman Coulter Cell Lab Quanta flow cytometer and data was processed using WinMDI.
- Stable cell lines of CHOK1SV expressing Compound 170 were created using the expression vector described in the Materials and Methods. Briefly 1 ⁇ 10 7 cells in logarithmic growth phase were electroporated in glutamine-free CDCHO protein-free media in the presence of 40 ⁇ g of linearised plasmid DNA. 24 hours post-transfection a selective pressure of 50 ⁇ M methionine sulphoximine (Sigma) was applied and resistant cells were allowed to form colonies in 96 well plates. When approaching confluence, single colonies were transferred to 24 well plates, T25 and then T75 flasks.
- productivity assessments were performed in parallel to the progress of the cell lines to the next stage. Thus at the 24 well plate and E125 Erlenmeyer flask stages productivity assessments were performed. In each case cells were allowed to grow for 14 days and supernatants evaluated by the TNF ELISA method described in Example 1 for levels of Compound 170. Cell lines were ranked on the productivity and the highest 10 were selected for evaluation in a proprietary fed-batch productivity assessment at Lonza Biologics. Productivities obtained were between 700 mg/L and 3371 mg/L. A lead cell line with a productivity of 2724 mg/L was selected for evaluation in 10 L laboratory scale fermenters.
- ESI-MS electrospray ionisation mass spectrometry
- Compound 170 (SEQ ID No:11) was administered subcutaneously to cynomolgus monkeys at doses of 0.5, 5 and 50 mg/kg, and blood samples were taken at 0.5, 1, 2, 6 and 24 hours then at 1 day, 2, 4, 7, 10 and 14 days. Analysis of these samples for quantitation of Compound 170 levels was performed using the anti-TNF ELISA method described in Example 1. Elimination half-life was determined by analysis of the levels of Compound 170 in these samples. At 0.5 mg/Kg an elimination half-life of 110.5 ⁇ 13.9 hours was calculated. At 5 mg/Kg and 50 mg/Kg elimination half-lives of 110.9 ⁇ 10.4 and 103.5 ⁇ 11.5 hours were calculated.
- Compound 170 (SEQ ID No:11) manufactured to GMP standards was evaluated in animal safety and toxicology studies.
- Compound 170 (SEQ ID No:11) in preceding examples was produced in mammalian expression systems. Functional Compound 170 was also produced using a bacterial expression system.
- the amino acid sequence for Compound 170 minus the signal sequence was back-translated and optimized by GeneOptimizerTM for E. coli expression and synthesized de novo at GeneArt GmbH.
- the synthesized gene was subcloned into the pBAD gIII/His-tagged expression vector (Invitrogen) via NcoI and HindIII restriction sites (Roche) generating a vector ready for bacterial expression.
- TOP10 cells (Invitrogen) were transformed with the vector by the heat shock method and glycerol stocks of single colonies generated. Induction conditions were 0.002% arabinose (Sigma; final concentration) and 4 hr induction period.
- Compound 170 protein samples were generated using the osmotic shock method as detailed in the pBAD bacterial expression system manual (Invitrogen). The BCA assay (Pierce) was used to determine the total protein concentration of the samples. Bacterially-expressed Compound 170 was assayed for binding to TNF- ⁇ in an ELISA as described in Example 1.
- FIG. 9 shows that Compound 170 produced in a bacterial system retained binding to TNF- ⁇ in an ELISA assay.
- amino acid sequence encoded by SEQ ID No:61 is as follows:
- the human TNF transgenic mouse line, Tg197 shows deregulated TNF expression and develops chronic inflammatory polyarthritis (Keffer, J. et. al. (1991) Transgenic mice expressing human tumor necrosis factor: a predictive genetic model of arthritis. EMBO Journal 10:4025-31). Administration of Compound 170 (SEQ ID No:11) prevented the development of arthritis and associated weight loss in these mice ( FIGS. 10A & B).
- mice Groups of 8 heterozygous Tg197 (each containing 4 males and 4 females) were treated with twice weekly intraperitoneal injections of Compound 170 and irrelevant specificity control human IgG 1 (palivizumab ⁇ Synagis® ⁇ , MedImmune/Abbott) in PBS, both at 10 mg/kg. Treatment commenced when mice were 3 weeks of age. At weekly intervals, mice were weighed and scored (arthritic score) based on macroscopic ankle morphology (swelling, distortion and degree of movement).
- Compound 112 (SEQ ID No: 59) is a modification of Compound 170 (SEQ ID No:11) which contains a cysteine residue at position 114 instead of a serine residue which is present in this position in Compound 170.
- the effect of substituting cysteine 114 for serine on protein expression was evaluated by comparison with Compound 170.
- Multiple cultures of host cells transfected with gene constructs for Compound 112 and 170 were assayed for protein expression by ELISA with solid phase TNF as set out in Materials and Methods. The results are set out in FIG. 11 .
Abstract
The present invention provides a domain antibody construct which binds to human TNF-α, with the construct comprising:
-
- (a) a domain antibody (dAb) which binds to human TNF-α;
- (b) a modified hinge region sequence;
- (c) a human or primate heavy chain constant region sequence having a truncated CH1 domain of not more than 20 residues,
- wherein the modified hinge region sequence contains either a deletion or a single amino acid substitution of at least one cysteine residue which normally facilitates disulfide bond formation between heavy and light antibody chains.
Description
- This application is a continuation of U.S. application Ser. No. 11/670,261, filed Feb. 1, 2007, which claims the benefit of U.S. Provisional Patent Application No. 60/817,507, filed Jun. 28, 2006, which claims the benefit of Australian Patent Application No. 2006900456, filed Feb. 1, 2006, and which are hereby incorporated by reference in their entirety.
- The present invention relates to a domain antibody construct useful for human therapy. More particularly, the present invention relates to a domain antibody construct which binds to human TNF-α and its use in the treatment of disorders characterised by TNF-α activity.
- Tumor necrosis factor alpha (TNF-α) is a cytokine that has been implicated in mediating shock and the pathophysiology of a variety of human diseases and disorders including sepsis, infections, autoimmune diseases eg. rheumatoid arthritis, Crohn's disease, ulcerative colitis and other bowel conditions, psoriasis, toxic shock, transplant rejection and graft-versus-host disease. TNF-α is produced primarily by activated macrophages and T lymphocytes, but also by neutrophils, endothelial cells, keratinocytes and fibroblasts during acute inflammatory reactions.
- Because of its role in inflammation, TNF-α has emerged as an important target for inhibition in efforts to reduce the symptoms of inflammatory disorders. Various approaches to inhibition of TNF-α for the clinical treatment of disease have been pursued, including particularly the use of soluble TNF-α receptors and antibodies specific for TNF-α.
- Domain antibodies (dAb) are the smallest functioning binding units of antibodies and correspond to the variable regions of either the heavy (VH) or light (VL) chains of antibodies. Domain antibodies have a molecular weight of approximately 13 kDa, or less than one tenth the size of a full antibody.
- In contrast to conventional antibodies, domain antibodies are well expressed in bacterial, yeast and mammalian systems. Their small size allows for higher molar quantities per gram of product, thus providing a significant increase in potency per milligram dose. In addition, dAbs can be used as building blocks to create therapeutic products such as multiple targeting dAb-containing molecules in which two or more dAbs bind to two or more distinct molecular targets, or dAbs may be incorporated into structures designed for pulmonary or oral administration.
- The present inventors have now devised a novel domain antibody construct comprising an immunoglobulin variable domain linked to a constant region including a
truncated C H1 domain. It is postulated that the inclusion of a constant region will assist in prolonging the in vivo half-life of the dAb which is typically of a short duration. - Evolutionarily distant primates, such as New World primates are sufficiently similar to human to have antibodies similar to human antibodies so that the host does not generate an anti-antibody immune response when such primate-derived antibodies are introduced into a human. New World primates (infraorder-Platyrrhini) comprise at least 53 species commonly divided into two families, the Callithricidae and Cebidae. The Callithricidae consist of marmosets and tamarins. The Cebidae includes the squirrel monkey, titi monkey, spider monkey, woolly monkey, capuchin, night or owl monkey and the howler monkey.
- Previous studies have characterised the expressed immunoglobulin heavy chain repertoire of the Callithrix jacchus marmoset (von Budingen H—C et al., Characterization of the expressed immunoglobulin IGHV repertoire in the New World marmoset Callithrix jacchus. Immunogenetics; 53:557-563 (2001)). Six IGHV subgroups were identified which showed a high degree of sequence similarity to their human IGHV counterparts. The framework regions were more conserved when compared to the complementarity determining regions (CDRs), with the greatest degree of variability located in CDR3. The degree of similarity between C. jacchus and human IGHV sequences was less than between Old World monkeys and humans.
- In a first aspect, the present invention provides a domain antibody construct which binds to human TNF-α, the construct comprising:
- (a) a domain antibody (dAb) which binds to human TNF-α
- (b) a modified hinge region sequence;
- (c) a human or primate heavy chain constant region sequence having a
truncated C H1 domain of not more than 20 residues, more preferably not more than 10 residues, still more preferably not more than 5 residues and even more preferably a single residue; - wherein said modified hinge region sequence contains either a deletion or a single amino acid substitution of the cysteine residue which normally facilitates disulfide bond formation between heavy and light antibody chains.
- In a second aspect the present invention provides a nucleic acid sequence encoding the domain antibody construct of the first aspect of the invention.
- In a third aspect the present invention provides an isolated nucleic acid molecule comprising a sequence encoding a domain antibody construct which binds human TNF-α, wherein the nucleic acid molecule comprises a nucleic acid sequence at least 60%, preferably at least 80% identical, more preferably at least 90%, 95%, 96%, 97%, 98% or 99% identical to the sequence set forth in SEQ ID No:50 or SEQ ID No:51 and most preferably, the sequence set forth in SEQ ID No:50 or SEQ ID No:51.
- In a fourth aspect the present invention provides an isolated nucleic acid molecule comprising a sequence encoding a domain antibody construct which binds human TNF-α, wherein the nucleic acid molecule comprises a nucleic acid sequence which hybridises under conditions of high stringency to the nucleotide sequence set forth in SEQ ID No:50 or SEQ ID No:51.
- In a fifth aspect, the invention provides a pharmaceutical composition comprising an effective amount of the domain antibody construct according to the first aspect, together with a pharmaceutically acceptable carrier or diluent.
- In a sixth aspect, the present invention provides for the use of the domain antibody construct according to the first aspect of the invention in a diagnostic application for detecting human TNF-α.
- In a seventh aspect, the invention provides a method for treating a disorder characterised by human TNF-α activity in a human subject, comprising administering to the subject a pharmaceutical composition according to the fifth aspect of the invention.
-
FIG. 1 shows the amino acid (SEQ ID No:5) and nucleotide sequence (SEQ ID No:6) of the acceptor dAb. -
FIG. 2 shows the structure of the preferred embodiment of the domain antibody construct according to the present invention as (A) a monomer and (B) a dimer. -
FIG. 3(A-G) shows the nucleotide and amino acid sequences of eleven (11) marmoset and six (6) Owl monkey Vκ gene segments. -
FIG. 4 shows the acceptor dAb amino acid (SEQ ID NO:5) and nucleotide sequence (both strands) (SEQ ID NO:6 AND SEQ ID NO:68). The restriction digest sites for Kpn I and San DI which excises region including the CDR2 is indicated in the figure. CDR2 residues removed are indicated in underlined. -
FIG. 5 shows the ability of Compound 170 (SEQ ID No:11) to neutralise TNF-α mediated cytotoxicity in a murine L929 cell viability assay. -
FIG. 6 shows that Compound 170 (SEQ ID No:11) prevents the interaction of TNF-α with the human p55 or p75 TNF receptors. -
FIG. 7 shows Compound 170 (SEQ ID No:11) staining of transmembrane TNF-α-expressing NS0 27D4 cells (solid black line) shows higher fluorescence intensity than irrelevant specificity isotype-matched control (grey fill). -
FIG. 8 shows Compound 170 (SEQ ID No:11) produced in a bacterial expression system retained binding to TNF-α in an ELISA. -
FIG. 9 shows the efficacy of Compound 170 (SEQ ID No:11) in a TNF-mediated murine arthritis model relative to specificity control human IgG1. At weekly intervals mice were scored (arthritic score), (A), and weighed, (B). -
FIG. 10 shows the effect on protein expression of Compound 112 (SEQ ID No:59) and Compound 170 (SEQ ID No:11). -
FIG. 11 shows non-reducing SDS PAGE analysis of Protein A purified Compound 170 (SEQ ID No:11) from 4×10 L fermentations of the lead cell line;lane 1=inter-assay control;lane 2=molecular weight markers;lane 3=blank;lane 4=Protein A purified Compound 170 (SEQ ID No:11) in 10 L fermentation ID (run 1);lane 5=Protein A purifiedCompound 170 in 10 L fermentation ID (run 2);lane 6=Protein A purifiedCompound 170 in 10 L fermentation ID (run 3);lane 7=Protein A purifiedCompound 170 in 10 L fermentation ID (run 4). -
FIG. 12 shows reducing SDS PAGE analysis of Protein A purified Compound 170 (SEQ ID No:11) from 4×10 L fermentations of the lead cell line;lane 1=inter-assay control;lane 2=molecular weight markers;lane 3=blank;lane 4=Protein A purified Compound 170 (SEQ ID No:11) in 10 L fermentation ID (run 1);lane 5=Protein A purifiedCompound 170 in 10 L fermentation ID (run 2);lane 6=Protein A purifiedCompound 170 in 10 L fermentation ID (run 3);lane 7=Protein A purifiedCompound 170 in 10 L fermentation ID (run 4). - The present inventors have generated a domain antibody construct which binds to human TNF-α and which is postulated to exhibit low immunogenicity when administered to humans. The domain antibody construct comprises a portion corresponding to a variable domain of an immunoglobulin heavy or light chain (ie. a domain antibody (dAb)), a hinge region and a portion corresponding to a constant region of an antibody heavy chain but wherein the constant region has a
truncated C H1 domain. - The inclusion of the constant region portion is postulated to increase the in vivo half life of the dAb as well as providing effector functions which are believed to be a component of the anti-inflammatory mechanism of anti-TNF antibodies.
- In a first aspect, the present invention provides a domain antibody construct which binds to human TNF-α, the construct comprising:
- (a) a domain antibody (dAb) which binds to human TNF-α
- (b) a modified hinge region sequence;
- (c) a human or primate heavy chain constant region sequence having a
truncated C H1 domain of not more than 20 residues, more preferably not more than 10 residues, still more preferably not more than 5 residues and even more preferably a single residue; - wherein said modified hinge region sequence contains either a deletion or a single amino acid substitution of the cysteine residue which normally facilitates disulfide bond formation between heavy and light antibody chains.
- In a preferred embodiment the sequence of the
C H1 domain and the hinge region is XEPKSZDKTHTCPPCPA (SEQ ID NO:64) wherein X is valine, leucine or isoleucine and Z is absent or an amino acid other than cysteine. It is preferred that X at position one is valine and Z is serine. - In a preferred embodiment of the present invention the dAb comprises an immunoglobulin heavy or light chain variable domain, wherein said variable domain comprises at least one complementarity determining region (CDR) having a sequence derived from a New World primate wherein the CDR is selected from the group consisting of AATKLQS (SEQ ID No:1), EASSLQS (SEQ ID No:2), EASKLQS (SEQ ID No:3), and SASNLET (SEQ ID No:4)
- In another preferred embodiment the CDR is CDR2.
- In a preferred embodiment the dAb has a sequence selected from the group consisting of:
-
(Compound 145; SEQ ID No: 7) DIQMTQSPSSLSASVGDRVTITCRASQSIDSYLHWYQQKPGKAPKWYS ASNLETGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQVVWRPFTF GQGTKVEIKR (Compound 123; SEQ ID No: 8) DIQMTQSPSSLSASVGDRVTITCRASQAIDSYLHWYQQKPGKAPKLLI YSASNLETGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQVVWRPF TFGQGTKVEIKR ( Compound 100; SEQ ID No: 9)DIQMTQSPSSLSASVGDRVTITCRASQSIDSYLHWYQQKPGKAPKWYS ASNLETGVPSRFSGSGSGTDFTLTISSLLPEDFATYYCQQVVWRPFTF GQGTKVEIKR (Compound 196; SEQ ID No: 10) DIQMTQSPSSLSASVGDRVTITCRASQAIDSYLHWYQQKPGKAPKLLI YSASNLETGVPSRFSGSGSGTDFTLTISSLLPEDFATYYCQQVVWRPF TFGQGTKVEIKR (Compound 134; SEQ ID No: 52) DIQMTQSPSSLSASVGDRVTITCRASQSIDSYLHWYQQKPGKPPKWYS ASNLETGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQVVWRPFTF GQGTKVEIKR (Compound 137; SEQ ID No: 53) DIQMTQSPSSLSASVGDRVTITCRASQSIDSYLHWYQQKPGKAPKWYS ASNLETGVPSRFSGRGSGTDFTLTISSLQPEDFATYYCQQVVWRPFTF GQGTKVEIKR (Compound 121; SEQ ID No: 54) DIQMTQSPSSLSASVGDRVTITCRASQSIDSYLHWYQQKPGKAPKWYS ASNLETGVPSRFSGSGSGTDFTLTISSLVPEDFATYYCQQVVWRPFTF GQGTKVEIKR; and
a sequence at least 95%, more preferably at least 96%, 97%, 98% or 99% identical to one of these sequences. - In a further preferred embodiment the constant region comprises
C H2 andC H3 domains which together have the following sequence: -
(SEQ ID NO: 63) PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPS DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVF SCSVMHEALHNHYTQKSLSLSPGK;
or an amino acid sequence which is at least 60%, preferably at least 80% identical, more preferably at least 90%, 95%, 96%, 97%, 98% or 99% identical thereto. - In another preferred embodiment the domain antibody construct comprises an amino acid sequence which is at least 60%, preferably at least 80% identical, more preferably at least 90%, 95%, 96%, 97%, 98% or 99% identical to the sequence set forth in SEQ ID No:11, and most preferably the sequence set forth in SEQ ID No:11.
- The term “binds to” as used herein, is intended to refer to the binding of an antigen by an immunoglobulin variable region with a dissociation constant (Kd) of 1 μM or lower as measured by surface plasmon resonance analysis using, for example a BIAcore™ surface plasmon resonance system and BIAcore™ kinetic evaluation software (eg. version 2.1). The affinity or dissociation constant (Kd) for a specific binding interaction is preferably about 500 nM or lower, more preferably about 300 nM or lower and preferably at least 300 nM to 50 pM, 200 nM to 50 pM, and more preferably at least 100 nM to 50 pM, 75 nM to 50 pM, 10 nM to 50 pM. The term “dAb” as used herein refers to an antibody single variable domain (VH or VL) polypeptide that specifically binds antigen.
- In a further preferred embodiment of the present invention the domain antibody construct forms a homo- or heterodimer with another domain antibody construct according to the present invention. Dimerisation can increase the strength of antigen binding, wherein the strength of binding is related to the sum of the binding affinities of the multiple binding sites. To facilitate dimer formation, the hinge region of the domain antibody construct comprises at least one, and preferably two, cysteine residues.
- In a particularly preferred embodiment of the present invention, the domain antibody construct forms a homodimer with an identical domain antibody construct.
- Accordingly in another aspect the present invention provides a dimeric domain antibody construct which binds to human TNF-α wherein the dimer consists of two domain antibody constructs according to the present invention.
- It is preferred that the dimeric domain antibody construct is a homodimer and it is particularly preferred that the domain antibody constructs making up the homodimer comprise an amino acid sequence which is at least 60%, preferably at least 80% identical, more preferably at least 90%, 95%, 96%, 97%, 98% or 99% identical to the sequence set forth in SEQ ID No:11, and most preferably the sequence set forth in SEQ ID No:11.
- In a second aspect the present invention provides a nucleic acid sequence encoding the domain antibody construct of the first aspect of the invention.
- In a third aspect the present invention provides an isolated nucleic acid molecule comprising a sequence encoding a domain antibody construct which binds human TNF-α, wherein the nucleic acid molecule comprises a nucleic acid sequence at least 60%, preferably at least 80% identical, more preferably at least 90%, 95%, 96%, 97%, 98% or 99% identical to the sequence set forth in SEQ ID No:50 or SEQ ID No:51 and most preferably, the sequence set forth in SEQ ID No:50 or SEQ ID No:51.
- In a fourth aspect the present invention provides an isolated nucleic acid molecule comprising a sequence encoding a domain antibody construct which binds human TNF-α, wherein the nucleic acid molecule comprises a nucleic acid sequence which hybridises under conditions of high stringency to the nucleotide sequence set forth in SEQ ID No:50 or SEQ ID No:51.
- In determining whether or not two polypeptide sequences fall within percentage identity limits, those skilled in the art will be aware that it is necessary to conduct a side-by-side comparison or multiple alignment of sequences. In such comparisons or alignments, differences will arise in the positioning of non-identical residues, depending upon the algorithm used to perform the alignment. In the present context, reference to a ‘percentage identity’ or ‘similarity’ between two or more amino acid sequences shall be taken to refer to the number of identical and similar residues respectively, between said sequences as determined using any standard algorithm known to those skilled in the art. For example, amino acid sequence identities or similarities may be calculated using the GAP programme and/or aligned using the PILEUP programme of the Computer Genetics Group, Inc., University Research Park, Madison, Wis., United States of America (Devereaux et al, 1984). The GAP programme utilizes the algorithm of Needleman and Wunsch (1970) to maximise the number of identical/similar residues and to minimise the number and length of sequence gaps in the alignment. Alternatively or in addition, wherein more than two amino acid sequences are being compared, the Clustal W programme of Thompson et al, (1994) is used.
- In determining whether or not two nucleotide sequences fall within these percentage limits, those skilled in the art will be aware that it is necessary to conduct a side-by-side comparison or multiple alignment of sequences. In such comparisons or alignments, differences may arise in the positioning of non-identical residues, depending upon the algorithm used to perform the alignment. In the present context, reference to a percentage identity between two or more nucleotide sequences shall be taken to refer to the number of identical residues between said sequences as determined using any standard algorithm known to those skilled in the art. For example, nucleotide sequences may be aligned and their identity calculated using the BESTFIT programme or other appropriate programme of the Computer Genetics Group, Inc., University Research Park, Madison, Wis., United States of America (Devereaux et al, Nucl. Acids Res., 12:387-395, 1984).
- High stringency preferably involves hybridisation under conditions of 65° C. and 0.1×SSC {1×SSC=0.15 M NaCl, 0.015 M Na3 Citrate pH 7.0}.
- In one embodiment, the invention is further based on a method for amplification of New World primate immunoglobulin variable region genes, for example by polymerase chain reaction (PCR) from nucleic acid extracted from New World primate lymphocytes using primers specific for heavy and light chain variable region gene families. For example, information regarding the boundaries of the variable domains of heavy and light chain genes (VH and VL respectively) can be used to design PCR primers that amplify the variable domain from a cloned heavy or light chain coding sequence encoding an antibody known to bind a given antigen. The amplified variable region is then inserted either alone or as a fusion with another polypeptide sequence for the human or primate constant region sequence of the invention into a suitable expression vector for production of the domain antibody construct of the invention. Suitable expression vectors will be familiar to those skilled in the art.
- The repertoire of VH, VL and constant region domains can be a naturally occurring repertoire of immunoglobulin sequences or a synthetic repertoire. A naturally occurring repertoire is one prepared, for example, from immunoglobulin-expressing cells harvested from one or more primates. Such repertoires can be naïve ie. prepared from newborn immunoglobulin expressing cells, or rearranged ie. prepared from, for example, adult primate B cells. If desired, clones identified from a natural repertoire, or any repertoire that bind the target antigen are then subject to mutagenesis and further screening in order to produce and select variants with improved binding characteristics.
- Synthetic repertoires of single immunoglobulin variable domains are prepared by artificially introducing diversity into a cloned variable domain.
- A repertoire of VH and VL domains can be screened for desired binding specificity and functional behaviour by, for example phage display. Methods for the construction of bacteriophage display libraries and lambda phage expression libraries are well known in the art. The phage display technique has been described extensively in the art and examples of methods and compounds for generating and screening such libraries and affinity maturing the products of them can be found in, for example, Barbas et al. (1991) PNAS 88:7978-7982; Clarkson et al. (1991) Nature 352:624-628; Dower et al. PCT. 91/17271, U.S. Pat. No. 5,427,908, U.S. Pat. No. 5,580,717 and EP 527,839; Fuchs et al. (1991) Bio/Technology 9:1370-1372; Garrad et al. (1991) Bio/Technology 9:1373-1377; Garrard et al. PCT WO 92/09690; Gram et al. (1992) PNAS 89:3576-3580; Griffiths et al. (1993) EMBO J. 12:725-734; Griffiths et al. U.S. Pat. No. 5,885,793 and EP 589,877; Hawkins et al. (1992) J Mol Biol 226:889-896; Hay et al. (1992) Hum Antibod Hybridomas 3:81-85; Hoogenboom et al. (1991) Nuc Acid Res 19:4133-4137; Huse et al. (1989) Science 246:1275-1281; Knappik et al. (2000) J Mol Biol 296:57-86; Knappik et al. PCT WO 97/08320; Ladner et al. U.S. Pat. No. 5,223,409, No. 5,403,484, No. 5,571,698, No. 5,837,500 and EP 436,597; McCafferty et al. (1990) Nature 348:552-554; McCafferty et al. PCT. WO 92/01047, U.S. Pat. No. 5,969,108 and EP 589,877; Salfeld et al. PCT WO 97/29131, U.S. Provisional Application No. 60/126,603; and Winter et al. PCT WO 92/20791 and EP 368,684.
- Recombinant libraries expressing the repertoire of VH and VL domains can be expressed on the surface of microorganisms eg. yeast or bacteria (see PCT publications WO 99/36569 and 98/49286).
- The domain antibody construct of the invention may be produced by recombinant means, including from eukaryotic expression systems including, for example, yeast, higher plant, insect and mammalian cells, as well as fungi and virally-encoded expression systems, as described herein or as known in the art.
- The domain antibody constructs of the present invention can be prepared using an S antibody encoding nucleic acid to provide transgenic plants and cultured plant cells (e.g., but not limited to tobacco and maize) that produce such constructs in the plant parts or in cells cultured therefrom. As a non-limiting example, transgenic tobacco leaves expressing recombinant proteins have been successfully used to provide large amounts of recombinant proteins, e.g., using an inducible promoter (see, e.g., Cramer et al., Curr. Top. Microbol. Immunol. 240:95-118 1999) and references cited therein. Also, transgenic maize has been used to express mammalian proteins at commercial production levels, with biological activities equivalent to those produced in other recombinant systems or purified from natural sources (see, e.g., Hood et al., Adv. Exp. Med. Biol. 464:127-147 1999 and references cited therein). Antibodies have also been produced in large amounts from transgenic plant seeds including antibody fragments, such as single chain antibodies (scFv's), including tobacco seeds and potato tubers (see, e.g., Conrad et al., Plant Mol. Biol. 38:101-109 1998 and reference cited therein). Thus, the domain antibody constructs of the present invention can also be produced using transgenic plants, according to known methods (see also, e.g., Fischer et al., Biotechnol. Appl. Biochem. 30:99-108 October, 1999: Ma & Hein., Trends Biotechnol. 13:522-7 1995; Ma et al., Plant Physiol. 109:341-6 1995; Whitelam et al., Biochem. Soc. Trans. 22:940-944 1994; and references cited therein; each of the above references is entirely incorporated herein by reference).
- The domain antibody constructs of the present invention include naturally purified products, products of chemical synthetic procedures, and products produced by recombinant techniques from a eukaryotic host, including, for example, yeast, higher plant, insect and mammalian cells. Depending upon the host employed in a recombinant production procedure, the antibody constructs of the present invention can be glycosylated or can be non-glycosylated, with glycosylated preferred. Such methods are described in many standard laboratory manuals Sambrook, et al., Molecular Cloning: A Laboratory Manual, 2nd Edition, Cold Spring Harbor, N.Y. 1989, Sections 17.37-17.42; Ausubel et al, eds. Current Protocols in Molecular Biology 1987-1993,
Chapters - In one expression system the recombinant peptide/protein library is displayed on ribosomes (for examples see Roberts, R W and Szostak, J. W. 1997 Proc. Natl. Acad. Sci. USA. 94:12297-123202 and PCT Publication No. WO98/31700). Thus another example involves the generation and in vitro transcription of a DNA library (eg of antibodies or derivatives preferably prepared from immunised cells, but not so limited), translation of the library such that the protein and “immunised” mRNAs stay on the ribosome, affinity selection (eg by binding to RSP), mRNA isolation, reverse translation and subsequent amplification (eg by polymerase chain reaction or related technology). Additional rounds of selection and amplification can be coupled as necessary to affinity maturation through introduction of somatic mutation in this system or by other methods of affinity maturation as known in the state of the art.
- Another example sees the application of emulsion compartmentalisation technology to the generation of the domain antibodies of the invention. In emulsion compartmentalisation, in vitro and optical sorting methods are combined with co-compartmentalisation of translated protein and its nucleotide coding sequence in aqueous phase within an oil droplet in an emulsion (see PCT publications no's WO 99/026711 and WO 00/40712).
- The CDR sequences may be obtained from several sources, for example, databases such as The National Centre for Biotechnology Information protein and nucleotide databases www.ncbi.nlm.nih.gov, The Kabat Database of Sequences of Proteins of Immunological Interest www.kabatdatabase.com, or the IMGT database www.imgt.cines.fr. Alternatively, the CDR regions can be predicted from the VH and VL domain repertoire (see for example Kabat E A and Wu T T Attempts to locate complementarity determining residues in the variable positions of light and heavy chains. Ann. NY Acad. Sci. 190:382-393 (1971)). The CDR sequence may be a genomic DNA or a cDNA.
- There are a number of ways in which a replacement CDR may be grafted into a variable region sequence and such methods will be familiar to those skilled in the art. The preferred method of the present invention involves replacement of the CDR2 in the variable region (or dAb) via primer directed mutagenesis. This method consists of annealing a synthetic oligonucleotide encoding a desired mutation(s) to a target region where it serves as a primer for initiation of DNA synthesis in vitro, extending the oligonucleotide by a DNA polymerase to generate a double-stranded DNA that carries the desired mutation, and ligating and cloning the sequence into an appropriate expression vector.
- In a preferred embodiment of the present invention, the New World primate CDR sequence is grafted into a variable region sequence which is of low immunogenicity in humans.
- By reference to the term “low immunogenicity” it is meant that the domain antibody construct or antigen-binding portion thereof, does not raise an antibody response in a human of sufficient magnitude to reduce the effectiveness of continued administration of the domain antibody construct for a sufficient time to achieve therapeutic efficacy.
- Preferably, the variable region sequence into which the New World primate CDR is grafted is the “dAb acceptor sequence” (designated Compound 128), in
FIG. 1 . The dAb acceptor sequence consists of the amino acid sequence set forth in SEQ ID No:5: -
(SEQ ID No: 5) DIQMTQSPSSLSASVGDRVTITCRASQSIDSYLHWYQQKPGKAPKWYS ASELQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQVVWRPFTF GQGTKVEIKR. - This sequence is encoded by the nucleotide sequence set forth in SEQ ID No:6:
-
(SEQ ID No: 6) GAC ATC CAG ATG ACC CAG TCT CCA TCC TCT CTG TCT GCA TCT GTA GGA GAC CGT GTC ACC ATC ACT TGC CGG GCA AGT CAG AGC ATT GAT AGT TAT TTA CAT TGG TAC CAG CAG AAA CCA GGG AAA GCC CCT AAG CTC CTG ATC TAT AGT GCA TCC GAG TTG CAA AGT GGG GTC CCA TCA CGT TTC AGT GGC AGT GGA TCT GGG ACA GAT TTC ACT CTC ACC ATC AGC AGT CTG CAA CCT GAA GAT TTT GCT ACG TAC TAC TGT CAA CAG GTT GTG TGG CGT CCT TTT ACG TTC GGC CAA GGG ACC AAG GTG GAA ATC AAA CGG - In one preferred embodiment of the present invention, a marmoset New World primate CDR sequence SASNLET (SEQ ID No:4) is grafted into the variable region dAb acceptor sequence so as to replace the CDR2 sequence (SASELQS; SEQ ID No:55) of the dAb acceptor sequence to produce the following dAb (designated Compound 145):
-
Compound 145 (SEQ ID No: 7) DIQMTQSPSSLSASVGDRVTITCRASQSIDSYLHWYQQKPGKAPKWYS ASNLETGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQVVWRPFTF GQGTKVEIKR - Thus, in one preferred embodiment, the dAb of the domain antibody construct which binds to human TNF-α, comprises the amino acid sequence set forth in SEQ ID No:7.
- It is within the scope of the present invention, that the variable region sequence (dAb) of the domain antibody construct may be further subject to affinity maturation in order to improve its antigen binding characteristics. This may necessitate the modification of certain amino acid residues within CDR1, CDR3 or framework of the domain antibody construct.
- For example, SEQ ID No:7 was affinity matured as set out in the Materials and Methods and tested for TNF-α-binding. In a further preferred embodiment, the variable region (dAb) of the domain antibody construct which binds to human TNF-α comprises the amino acid sequence of SEQ ID No:8 or SEQ ID No:9. These have been designated Compound 123 and
Compound 100 respectively, and their sequences are shown below: -
Compound 123 (SEQ ID No: 8) DIQMTQSPSSLSASVGDRVTITCRASQAIDSYLHWYQQKPGKAPKLLI YSASNLETGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQVVWRPF TFGQGTKVEIKR Compound 100 (SEQ ID No: 9) DIQMTQSPSSLSASVGDRVTITCRASQSIDSYLHWYQQKPGKAPKWYS ASNLETGVPSRFSGSGSGTDFTLTISSLLPEDFATYYCQQVVWRPFTF GQGTKVEIKR - In a particularly preferred embodiment, the variable region (dAb) of the domain antibody construct which binds to human TNF-α comprises the amino acid sequence of SEQ ID No:10. This has been designated Compound 196 and the sequence is provided below:
-
Compound 196 (SEQ ID No: 10) DIQMTQSPSSLSASVGDRVTITCRASQAIDSYLHWYQQKPGKAPKLLI YSASNLETGVPSRFSGSGSGTDFTLTISSLLPEDFATYYCQQVVWRPF TFGQGTKVEIKR - It will be appreciated by persons skilled in the art that the constant region sequence of the domain antibody construct may be derived from human or primate sequences. The primate sequence may be New World primate or an Old World primate sequence. Suitable Old World primates include chimpanzee, or other hominid ape eg. gorilla or orangutan, which because of their close phylogenetic proximity to humans, share a high degree of homology with the human constant region sequence. Preferably, the constant region is derived from a human antibody sequence. Examples of such sequences can be found in The National Centre for Biotechnology Information protein and nucleotide databases www.ncbi.nlm.nih.gov, and The Kabat Database of Sequences of Proteins of Immunological Interest www.kabatdatabase.com, or the IMGT database www.imgt.cines.fr.
- In designing the domain antibody construct of the present invention, the inventors have truncated the
C H1 domain of the constant (Fc) region. A minimal number ofC H1 domain residues have been retained in order to provide flexibility in the domain antibody construct around the hinge region. Preferably, at least 20 C-terminal amino acid residues of theC H1 domain are retained, more preferably at least 10 amino acids, still more preferably at least 5 amino acids, even more preferably a single amino acid residue. - Thus, in a preferred embodiment, the domain antibody construct has a format comprising dAb-
C terminal C H1 domain residue-hinge region-C H2 domain-C H3 domain as illustrated schematically inFIG. 2 . - In a particularly preferred embodiment, the domain antibody construct has the amino acid sequence set forth in SEQ ID No:11. This has been designated
Compound 170. -
Compound 170 (SEQ ID No: 11) DIQMTQSPSSLSASVGDRVTITCRASQAIDSYLHWYQQKPGKAPKLLI YSASNLETGVPSRFSGSGSGTDFTLTISSLLPEDFATYYCQQVVWRPF TFGQGTKVEIKRVEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDT LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT PPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGK - The hinge region of the naturally occurring immunoglobulin contains a cysteine (C) side chain which facilitates the formation of a disulfide bond between the
C H1 domain of the heavy chain and the constant domain of the light chain. Because the construct comprises only a single variable domain and thus leaves a potentially reactive unpaired cysteine residue, the cysteine residue has been substituted with an amino acid residue which prevents disulfide bond formation. The potential consequences of having an unpaired cysteine may include reduced protein expression due to aggregation and misfolding of the construct. - It is to be understood that any hinge region sequence derived from any of the antibody classes would be appropriate for use in the present invention. It is preferred however, that the hinge region is derived from the antibody subclass IgGi. Preferably, the hinge region is based on the naturally occurring sequence of the hinge region of IgGi and comprises the sequence EPKSSDKTHTCPPCPA (SEQ ID No:12). In this sequence, the Cys which normally occurs at
position 5 is replaced by the underlined bolded Ser residue. - Preferably, the C-terminal amino acid residue of the
C H1 domain is derived from IgG1. More preferably, theC H1 residue is a valine (V) residue or a conservative amino acid substitution such as leucine (L) or isoleucine (I). This residue is located immediately proximal to the hinge region and assists in increasing the flexibility of the construct around the hinge region. - Sequences of the
C H2 andC H3 domains are preferably derived from Swissprot database accession number P01857: -
(SEQ ID No: 63) PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPS DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVF SCSVMHEALHNHYTQKSLSLSPGK. - The domain antibody construct may be derivatised or linked to another functional molecule. For example, the domain antibody construct can be functionally linked by chemical coupling, genetic fusion, noncovalent association or otherwise, to one or more other molecular entities, such as another antibody, a detectable agent, a cytotoxic agent, a pharmaceutical agent, and/or a protein or peptide that can mediate association of the antibody or antibody-binding portion with another molecule (such as a streptavidin core region or a polyhistidine tag).
- Useful detectable agents with which the domain antibody construct may be derivatised include fluorescent compounds. Exemplary fluorescent detectable agents include fluorescein, fluorescein isothiocyanate, rhodamine, 5-dimethylamine-1-napthalenesulfonyl chloride, phycoerythrin and the like. The domain antibody construct may also be derivatised with detectable enzymes such as alkaline phosphatase, horseradish peroxidase, glucose oxidase and the like. When the domain antibody construct is derivatized with a detectable enzyme, it is detected by adding additional reagents that the enzyme uses to produce a detectable reaction product. The domain antibody construct may also be derivatised with biotin, and detected through indirect measurement of avidin or streptavidin binding.
- The domain antibody construct according to the invention may be linked to one or more molecules which provide increased half-life and resistance to degradation without loss in activity (eg binding affinity) in vivo. These molecules may be linked to the domain antibody construct via a linker so that they do not interfere/sterically hinder the antigen binding site. These adduct molecules include for example dAbs directed to an endogenous molecule as described in US patent application 20050271663. Typically, such adduct molecules are polypeptides or fragments of polypeptides which occur naturally in vivo and which resist degradation or removal by endogenous mechanisms. Molecules which increase half life may be selected from the following:
- (a) proteins from the extracellular matrix, eg. collagen, laminin, integrin and fibronectin;
(b) proteins found in blood, eg. fibrin α-2 macroglobulin, serum albumin, fibrinogen A, fibrinogen B, serum amyloid protein A, heptaglobin, protein, ubiquitin, uteroglobulin, β-2 microglobulin, plasminogen, lysozyme, cystatin C, alpha-1-antitrypsin and pancreatic kypsin inhibitor;
(c) immune serum proteins, eg. IgE, IgG, IgM;
(d) transport proteins, eg. retinol binding protein, α-1 microglobulin;
(e) defensins, eg. beta-defensin 1,neutrophil defensins
(f) proteins found at the blood brain barrier or in neural tissues, eg. melanocortin receptor, myelin, ascorbate transporter;
(g) transferrin receptor specific ligand-neuropharmaceutical agent fusion proteins (see U.S. Pat. No. 5,977,307); brain capillary endothelial cell receptor, transferrin, transferrin receptor, insulin, insulin-like growth factor 1 (IGF 1) receptor, insulin-like growth factor 2 (IGF 2) receptor, insulin receptor;
(h) proteins localised to the kidney, eg. polycystin, type IV collagen, organic anion transporter K1, Heymann's antigen;
(i) proteins localised to the liver, eg. alcohol dehydrogenase, G250;
(j) blood coagulation factor X;
(k) α-1 antitrypsin; - (m) proteins localised to the lung, eg. secretory component (binds IgA);
(n) proteins localised to the heart, eg.HSP 27;
(o) proteins localised to the skin, eg, keratin;
(p) bone specific proteins, such as bone morphogenic proteins (BMPs) eg. BMP-2, -4, -5, -6, -7 (also referred to as osteogenic protein (OP-1) and -8 (OP-2);
(q) tumour specific proteins, eg. human trophoblast antigen, herceptin receptor, oestrogen receptor, cathepsins eg cathepsin B (found in liver and spleen);
(r) disease-specific proteins, eg. antigens expressed only on activated T-cells: including LAG-3 (lymphocyte activation gene); osteoprotegerin ligand (OPGL) see Kong Y Y et al Nature (1999) 402, 304-309; OX40 (a member of the TNF receptor family, expressed on activated T cells and the only costimulatory T cell molecule known to be specifically up-regulated in human T cell leukaemia virus type-I (HTLV-I)-producing cells—see Pankow R et al J. Immunol. (2000) July 1; 165(1):263-70; metalloproteases (associated with arthritis/cancers), including CG6512 Drosophila, human paraplegin, human FtsH, human AFG3L2, murine ftsH; angiogenic growth factors, including acidic fibroblast growth factor (FGF-1), basic fibroblast growth factor (FGF-2), Vascular endothelial growth factor/vascular permeability factor (VEGF/VPF), transforming growth factor-α (TGF-α), tumor necrosis factor-alpha (TNF-α), angiogenin, interleukin-3 (IL-3), interleukin-8 (IL-8), platelet derived endothelial growth factor (PD-ECGF), placental growth factor (PlGF), midkine platelet-derived growth factor-BB (PDGF), fractalkine;
(s) stress proteins (heat shock proteins); and
(t) proteins involved in Fc transport. - The present invention also extends to a PEGylated domain antibody construct which provides increased half-life and resistance to degradation without a loss in activity (e.g. binding affinity) relative to non-PEGylated antibody polypeptides.
- The domain antibody construct can be coupled, using methods known in the art, to polymer molecules (preferably PEG) useful for achieving the increased half-life and degradation resistance properties. Polymer moieties which can be utilised in the invention can be synthetic or naturally occurring and include, but not limited to straight or branched chain polyalkylene, polyalkenylene or polyoxyalkylene polymers, or a branched or unbranched polysaccharide such as a homo- or heteropolysaccharide. Preferred examples of synthetic polymers which can be used in the invention include straight or branched chain poly(ethylene glycol) (PEG), poly(propylene glycol), or poly(vinyl alcohol) and derivatives or substituted forms thereof. Particularly preferred substituted polymers for linkage to the domain antibody construct include substituted PEG, including methoxy(polyethylene glycol). Naturally occurring polymer moieties which can be used in addition to or in place of PEG include lactose, amylose, dextran, or glycogen, as well as derivatives thereof which would be recognised by persons skilled in the art.
- The polymer (PEG) molecules useful in the invention can be attached to the domain antibody construct using methods which are well known in the art. The first step in the attachment of PEG or other polymer moieties to the domain antibody construct of the invention is the substitution of the hydroxyl end-groups of the PEG polymer by electrophile-containing functional groups. Particularly, PEG polymers are attached to either cysteine or lysine residues present in the domain antibody construct monomers or multimers. The cysteine and lysine residues can be naturally occurring, or can be engineered into the domain antibody construct molecule.
- Pegylation of the domain antibody constructs of the invention may be accomplished by any number of means (see for example Kozlowski-A & Harris-J M (2001) Journal of Controlled Release 72:217). PEG may be attached to the domain antibody construct either directly or by an intervening linker. Linkerless systems for attaching polyethylene glycol to proteins is described in Delgado et al., (1992), Crit. Rev. Thera. Drug Carrier Sys. 9:249-304; Francis et al., (1998), Intern. J. Hematol. 68:1-18; U.S. Pat. No. 4,002,531; U.S. Pat. No. 5,349,052; WO 95/06058; and WO 98/32466, the disclosures of each of which are incorporated herein by reference.
- One system for attaching polyethylene glycol directly to amino acid residues of proteins without an intervening linker employs tresylated MPEG, which is produced by the modification of monomethoxy polyethylene glycol (MPEG) using tresylchloride. Following reaction of amino acid residues with tresylated MPEG, polyethylene glycol is directly attached to the amine groups. Thus, the invention includes protein-polyethylene glycol conjugates produced by reacting proteins of the invention with a polyethylene glycol molecule having a 2,2,2-trifluoreothane sulphonyl group.
- Polyethylene glycol can also be attached to proteins using a number of different intervening linkers. For example, U.S. Pat. No. 5,612,460 discloses urethane linkers for connecting polyethylene glycol to proteins. Protein-polyethylene glycol conjugates wherein the polyethylene glycol is attached to the protein by a linker can also be produced by reaction of proteins with compounds such as MPEG-succinimidylsuccinate, MPEG activated with 1,1′-carbonyldiimidazole, MPEG-2,4,5-trichloropenylcarbonate, MPEG-p-nitrophenolcarbonate, and various MPEG-succinate derivatives. A number of additional polyethylene glycol derivatives and reaction chemistries for attaching polyethylene glycol to proteins are described in WO 98/32466, the entire disclosure of which is incorporated herein by reference.
- In a particularly preferred embodiment of the present invention the domain antibody construct is coupled directly to polyethylene glycol via a lysine residue. In yet another preferred embodiment of the present invention, the domain antibody construct is coupled directly to PEG via a cysteine residue. The unpaired cysteine residue could pre-exist in the sequence, could be added by incorporating a cysteine residue in, for example, the C-terminus of the domain antibody construct. Alternatively, attachment of the PEG to the domain antibody construct could be facilitated via a disulphide bonded cysteine such as that described in US20060210526.
- Other derivatized forms of polymer molecules include, for example, derivatives which have additional moieties or reactive groups present therein to permit interaction with amino acid residues of the domain antibody constructs described herein. Such derivatives include N-hydroxylsuccinimide (NHS) active esters, succinimidyl propionate polymers, and sulfhydryl-selective reactive agents such as maleimide, vinyl sulfone, and thiol. PEG polymers can be linear molecules, or can be branched wherein multiple PEG moieties are present in a single polymer.
- The reactive group (e.g., MAL, NHS, SPA, VS, or Thiol) may be attached directly to the PEG polymer or may be attached to PEG via a linker molecule.
- The size of polymers useful in the invention can be in the range of 500 Da to 60 kDa, for example, between 1000 Da and 60 kDa, 10 kDa and 60 kDa, 20 kDa and 60 kDa, 30 kDa and 60 kDa, 40 kDa and 60 kDa, and up to between 50 kDa and 60 kDa. The polymers used in the invention, particularly PEG, can be straight chain polymers or may possess a branched conformation.
- In a further embodiment, the domain antibody construct according to the first aspect may be multimerised, as for example, hetero- or homodimers, hetero- or homotrimers, hetero- or homotetramers, or higher order hetero- or homomultimers. Multimerisation can increase the strength of antigen binding, wherein the strength of binding is related to the sum of the binding affinities of the multiple binding sites.
- In a fifth aspect, the invention provides a pharmaceutical composition comprising an effective amount of the domain antibody construct according to the first aspect, together with a pharmaceutically acceptable carrier or diluent.
- A “pharmaceutically acceptable carrier” includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like which are physiologically compatible. Examples of pharmaceutically acceptable carriers include one or more of water, saline, phosphate buffered saline, dextrose, glycerol, ethanol, and the like as well as combinations thereof. In many cases it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition. Pharmaceutically acceptable substances such as minor amounts of auxiliary substances such as wetting or emulsifying agents, preservatives or buffers.
- The composition may be in a variety of forms, including liquid, semi-solid and solid dosage forms, such as liquid solutions (eg inhalable, injectable and infusible solutions), dispersions or suspensions, tablets, pills, powders, liposomes and suppositories. Preferably, the composition is in the form of an injectable solution for immunization. The administration may be intravenous, intra-arterial, subcutaneous, intraperitoneal, or intramuscular.
- Therapeutic compositions typically must be sterile and stable under the conditions of manufacture and storage. The compositions can be formulated as a solution, microemulsion, dispersion, liposome, or other ordered structure suitable to high drug concentration. The proper fluidity of a solution can be maintained by for example, use of a coating such as lecithin and/or surfactants. Sterile injectable solutions can be prepared by incorporating the active compound (ie. domain antibody construct) in the required amount into an appropriate solvent with one or a combination of ingredients listed above, followed by filtered sterilisation.
- The composition may also be formulated as a sterile powder for the preparation of sterile injectable solutions.
- In certain embodiments the active compound may be prepared with a carrier that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems. Compatible polymers may be used such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters and polylactic acid.
- The composition may also be formulated for oral administration. In this embodiment, the domain antibody construct may be enclosed in a hard or soft shell gelatin capsule, compressed into tablets, or incorporated directly into the subject's diet.
- Formulations that allow for pulmonary, rectal, transdermal, intrathecal and intraocular administration will be familiar to persons skilled in the art.
- Supplementary active compounds can also be incorporated into the composition. The domain antibody construct may be co-formulated with and/or co-administered with one or more additional therapeutic agents eg. soluble TNF-α receptor or a chemical agent that inhibits human TNF-α production, or antibodies that bind other targets such as cytokines or cell surface molecules. Alternatively, it may be co-administered with a soluble immunochemical reagent such as protein A, C, G or L.
- An effective amount may include a therapeutically effective amount or prophylactically effective amount of the domain antibody construct of the invention. A therapeutically effective amount refers to an amount effective at dosages and for periods of time necessary, to achieve the desired therapeutic result. A prophylactically effective amount refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result. Because a prophylactic dose is administered to a subject prior to or at an earlier stage of disease, the prophylactically effective amount may be less than the therapeutically effective amount.
- In a sixth aspect, the present invention provides for the use of the domain antibody construct according to the first aspect of the invention in a diagnostic application for detecting human TNF-α.
- For example, the anti-human TNF-α domain antibody construct according to the invention can be used to detect human TNF-α for example in a biological sample, such as serum or plasma using a conventional immunoassay, such as an enzyme linked immunosorbent assay (ELISA), a radioimmunoassay (RIA) or tissue immunohistochemistry. The anti-human TNF-α domain antibody construct according to the invention can be assayed in biological fluids by a competition immunoassay using recombinant human TNF-α standards labelled with a detectable substance and an unlabelled anti-human TNF-α antibody.
- The anti-human TNF-α domain antibody construct according to the invention may also be used to detect TNF-α from species other than humans such as non-human primates including cynomolgus, chimpanzee, marmoset, rhesus and other species such as dog, rat, mouse, rabbit, cat, pig, bovine.
- The anti-human TNF-α domain antibody construct according to the invention may also be used in cell culture applications where it is desired to inhibit TNF-α activity.
- In a seventh aspect, the invention provides a method for treating a disorder characterised by human TNF-α activity in a human subject, comprising administering to the subject a pharmaceutical composition according to the second aspect of the invention.
- A disorder characterised by human TNF-α activity is intended to include diseases and other disorders in which the presence of TNF-α in a subject suffering from the disorder has been shown to be or is suspected of being either responsible for the pathophysiology of the disorder or a factor which contributes to a worsening of the disorder. Preferably, the disorder characterised by human TNF-α activity is selected from the group consisting of inflammation, inflammatory diseases, sepsis, including septic shock, endotoxic shock, gram negative sepsis and toxic shock syndrome; autoimmune disease, including rheumatoid arthritis, juvenile arthritis, rheumatoid spondylitis, ankylosing spondylitis, Sjögren's syndrome, osteoarthritis and gouty arthritis, allergy, multiple sclerosis, autoimmune diabetes, autoimmune uveitis, psoriasis, pemphigoid and nephrotic syndrome; inflammatory conditions of the eye, including macular degeneration, uveitis, Behçet's disease; infectious disease, including fever and myalgias due to infection and cachexia secondary to infection; graft versus host disease; tumour growth or metastasis, hematologic malignancies; pulmonary disorders including asthma, adult respiratory distress syndrome, shock lung, chronic pulmonary inflammatory disease, pulmonary sarcoidosis, pulmonary fibrosis and silicosis; inflammatory bowel disorders including Crohn's disease and ulcerative colitis; cardiac disorders, congestive heart failure; vascular disorders including Wegener's disease, giant cell arteritis; inflammatory bone disorders, central nervous system disorders such as Alzheimer's disease; peripheral nervous system disorders such as sciatica, hepatitis, coagulation disturbances, burns, reperfusion injury, endometrosis, keloid formation and scar tissue formation.
- In a particularly preferred embodiment, the disorder characterised by human TNF-α activity is age-related macular degeneration. TNF-α is implicated in stimulating VEGF production and promoting neovascularisation in the eye (Oh-H et al., 1999 Investigative Ophthalmology & Visual Science 40:1891-98), and therefore inhibitors of TNF-α activity, such as the domain antibody constructs described herein, would be useful for therapy of angiogenesis-related ocular disorders including age-related macular degeneration.
- Throughout this specification the word “comprise”, or variations such as “comprises” or “comprising”, will be understood to imply the inclusion of a stated element, integer or step, or group of elements, integers or steps, but not the exclusion of any other element, integer or step, or group of elements, integers or steps.
- All publications mentioned in this specification are herein incorporated by reference. Any discussion of documents, acts, materials, devices, articles or the like which has been included in the present specification is solely for the purpose of providing a context for the present invention. It is not to be taken as an admission that any or all of these matters form part of the prior art base or were common general knowledge in the field relevant to the present invention as it existed in Australia or elsewhere before the priority date of each claim of this application.
- In order that the nature of the present invention may be more clearly understood, preferred forms thereof will now be described with reference to the following non-limiting examples.
- Marmoset (genus Callithrix, species unknown) and Owl monkey (Aotus trivirgatus) genomic DNA were obtained from the European Collection of Cell Cultures (ECACC), catalogue numbers 85011419 and 90110510 respectively. Marmoset DNA was derived from cell line B95-8 while Owl monkey DNA came from cell line OMK 637-69.
- Degenerate primers based on human Vκ leader sequences and recombination signal sequences (RSS) were derived from Walter and Tomlinson, Antibody Engineering: A Practical Approach (1996). The primers used for amplification of germline Vκ DNA were as follows:
-
Primer VK1BL AATCKCAGGTKCCAGATG (SEQ ID No:13) Primer VK1BL35a GTTYRGGTKKGTAACACT (SEQ ID No:14) Primer VK1BL35b ATGMCTTGTWACACTGTG (SEQ ID No:15) - PCR (30 cycles) was performed using Taq polymerase with either primer pair VK1BLxVK1BL35a or VK1BLxVK1BL35b. There was overlap between the sequences cloned and the two primer sets used.
- Genomic PCR products were cloned into Invitrogen's TOPO TA cloning kit (Cat No K4500-01) and sequenced with M13 Forward and pUC Reverse primers. Sequence was confirmed in forward and reverse directions. In order to further confirm key sequences were not subject to PCR errors, the PCR and cloning process was repeated twice for marmoset sequences. Nucleotide (SEQ ID Nos:16-26 and SEQ ID Nos:38-43) and amino acid (SEQ ID Nos:27-37 and SEQ ID Nos:44-49) are given in
FIG. 3 (A-G).Marmoset sequences Sequences Sequences - Oligo Synthesis and Cloning into Acceptor Sequence
- Four CDR sequences, namely AATKLQS (SEQ ID No:1) from Owl monkey sequence 1 (SEQ ID No:44), EASSLQS (SEQ ID No:2) from Owl monkey sequence 2 (SEQ ID No:45), EASKLQS (SEQ ID No:3) from Marmoset sequence 1 (SEQ ID No:27), and SASNLET (SEQ ID No:4) from Marmoset sequence 2 (SEQ ID No:28), were chosen from the amino acid sequences shown in
FIG. 3 (A-G).Owl Monkey sequence 5, YASSLQS (SEQ ID No:56) was found to be identical to GI6176295 an Aotus nancymaae (Ma's night monkey) cDNA sequence, all other sequences were unique. - The acceptor variable region (anti-TNF domain antibody) sequence in the expression vector (Domantis proprietary vector) was digested (25 μg) sequentially with KpnI and SanDI which excises the majority of FR2 as well as CDR2 as indicated on the restriction digest map,
FIG. 4 . The vector was then gel purified to remove the excised wild-type FR2 and CDR2 sequence. - Oligo annealing was performed by incubating oligo pairs (500 pmol, based on sequences shown in
FIG. 3 (A-G)) at 95° C. for 5 minutes followed by 65° C. for 5 minutes and then allowed to reach room temperature slowly on a hot block. Overlaps were then filled in during a Klenow reaction in the presence of dNTPs. Molecular cloning of the synthetic double-stranded DNA (derived by oligo annealing and end filling) into the acceptor variable region sequence was achieved using standard methods. - The marmoset CDR-grafted dAb Compound 145 (SEQ ID No:7) was affinity matured by constructing 14 separate libraries, each a diversification of the sequence of SEQ ID No:7 at a single amino acid residue. The selected residues are shown bolded below.
-
DIQMTQSPSSLSASVGDRVTITCRASQSIDSYLHWYQQKPGKAPKWYS ASNLETGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQVVWRPFTF GQGTKVEIKR - The selection was based upon residues in CDR1 and CDR3 that are known to be diversified in the mature human Ig repertoire, and framework residues that have been observed to produce functional proteins after mutagenesis in related dAbs. For each of the selected residues, complimentary forward and reverse PCR primer pairs were designed with NKK degeneracy, and two initial PCR reactions were performed each with a single mutagenic primer and flanking primer. After clean-up, the two PCR products were annealed and then amplified using flanking primers alone (splicing by overlap extension of PCR; Lowman H. L. & Clackson T. (eds), Phage Display: A practical approach, Oxford University Press, Oxford, UK). Clones were initially screened by ELISA using solid-phase TNF, and positive clones were sequenced. dAb protein was purified from the best clones and evaluated for potency in receptor binding assays and L929 cytotoxicity assays. Compounds 100 (SEQ ID No:9) and 123 (SEQ ID No:8) were found to have improved TNF-neutralization relative to the parent dAb, Compound 145 (SEQ ID No:7).
- Combination of the affinity-enhancing substitutions of
Compounds 100 and 123, yielded an anti-TNF dAb with further improved potency in the L929 cytotoxicity assay (Compound 196; SEQ ID No:10). - CHOK1SV cells (Lonza Biologics, UK), a suspension variant of CHOK1, were maintained in logarithmic growth phase in CD CHO media supplemented with 6 mM L-glutamine (Invitrogen Cat Nos. 10743-029 and 25030-081). Cultures were incubated at 36.5° C., 10% CO2 and shaking at 140 rpm. 24 hours before transfection cell number and viability was assessed by trypan blue exclusion (Sigma Cat No. T8154) on a haemocytometer. 8×106 viable cells were pelleted at 200×g for 5 minutes and resuspended in 8 ml of CM25 media (Lonza Biologics, UK) supplemented with 10% heat inactivated dialysed fetal calf serum (Invitrogen Cat No. 26400-044) and 6 mM L-glutamine. Cells were plated out at 500 per well in a 24 well plate and incubated at 36.5° C., 10% CO2.
- 3 hours before transfection the media was replenished with a fresh aliquot of 500 CM25 media supplemented with 10% heat inactivated dialysed fetal calf serum and 6 mM L-Glutamine.
- Gene sequences for Compound 112 (SEQ ID No:50) and Compound 170 (SEQ ID No:51) were optimized for mammalian cell expression and synthesized.
-
Compound 112 (SEQ ID No: 50) GACATCCAGATGACCCAGAGCCCCAGCAGCCTGAGCGCCTCTGTGGGC GATAGAGTGACCATCACCTGCAGAGCCAGCCAGGCCATCGACAGCTAC CTGCACTGGTATCAGCAGAAGCCTGGCAAGGCCCCTAAGCTGCTGATC TACAGCGCCAGCAATCTGGAGACCGGCGTGCCTAGCAGATTCAGCGGC AGCGGCTCCGGCACCGACTTCACCCTGACCATCAGCAGCCTGCTGCCT GAGGATTTCGCCACCTACTACTGCCAGCAGGTGGTGTGGAGACCTTTC ACCTTCGGCCAGGGCACCAAGGTGGAGATCAAGCGGGTGGAGCCCAAG AGCTGCGATAAGACCCACACCTGCCCCCCCTGCCCTGCCCCCGAGCTG CTGGGCGGACCCAGCGTGTTCCTGTTCCCCCCCAAGCCTAAGGACACC CTGATGATCAGCAGAACCCCCGAGGTGACCTGCGTGGTGGTGGATGTG AGCCACGAGGACCCTGAGGTGAAGTTCAACTGGTACGTGGACGGCGTG GAGGTGCACAATGCCAAGACCAAGCCCAGGGAGGAGCAGTACAACAGC ACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGGATTGGCTG AACGGCAAGGAGTACAAGTGCAAGGTGTCCAACAAGGCCCTGCCTGCC CCTATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCAGAGAGCCC CAGGTGTACACCCTGCCCCCTAGCAGAGATGAGCTGACCAAGAACCAG GTGTCCCTGACCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCC GTGGAGTGGGAGAGCAACGGCCAGCCCGAGAACAACTACAAGACCACC CCCCCTGTGCTGGACAGCGATGGCAGCTTCTTCCTGTACAGCAAGCTG ACCGTGGACAAGAGCAGATGGCAGCAGGGCAACGTGTTCAGCTGCAGC GTGATGCACGAGGCCCTGCACAATCACTACACCCAGAAGAGCCTGAGC CTGTCCCCTGGCAAG Compound 170 (SEQ ID No: 51) GACATCCAGATGACCCAGAGCCCCAGCAGCCTGAGCGCCTCTGTGGGC GATAGAGTGACCATCACCTGCAGAGCCAGCCAGGCCATCGACAGCTAC CTGCACTGGTATCAGCAGAAGCCTGGCAAGGCCCCTAAGCTGCTGATC TACAGCGCCAGCAATCTGGAGACCGGCGTGCCTAGCAGATTCAGCGGC AGCGGCTCCGGCACCGACTTCACCCTGACCATCAGCAGCCTGCTGCCT GAGGATTTCGCCACCTACTACTGCCAGCAGGTGGTGTGGAGACCTTTC ACCTTCGGCCAGGGCACCAAGGTGGAGATCAAGCGGGTGGAGCCCAAG AGCAGCGATAAGACCCACACCTGCCCCCCCTGCCCTGCCCCCGAGCTG CTGGGCGGACCCAGCGTGTTCCTGTTCCCCCCCAAGCCTAAGGACACC CTGATGATCAGCAGAACCCCCGAGGTGACCTGCGTGGTGGTGGATGTG AGCCACGAGGACCCTGAGGTGAAGTTCAACTGGTACGTGGACGGCGTG GAGGTGCACAATGCCAAGACCAAGCCCAGGGAGGAGCAGTACAACAGC ACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGGATTGGCTG AACGGCAAGGAGTACAAGTGCAAGGTGTCCAACAAGGCCCTGCCTGCC CCTATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCCAGAGAGCCC CAGGTGTACACCCTGCCCCCTAGCAGAGATGAGCTGACCAAGAACCAG GTGTCCCTGACCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCC GTGGAGTGGGAGAGCAACGGCCAGCCCGAGAACAACTACAAGACCACC CCCCCTGTGCTGGACAGCGATGGCAGCTTCTTCCTGTACAGCAAGCTG ACCGTGGACAAGAGCAGATGGCAGCAGGGCAACGTGTTCAGCTGCAGC GTGATGCACGAGGCCCTGCACAATCACTACACCCAGAAGAGCCTGAGC CTGTCCCCTGGCAAG - Each sequence was flanked at the 5′ end with a Hind III site, a Kozak sequence (GCCACC; SEQ ID No:57) and a human IgG kappa leader sequence (amino acid sequence MSVPTQVLGLLLLWLTDARC; SEQ ID No:58). At the 3′ end two stop codons and an EcoR I site were added to each sequence. Following synthesis genes were provided cloned into a pCRScript vector (Stratagene) and were released by Hind III/EcoR I digestion in the appropriate restriction enzyme buffer (Roche Diagnostics Cat Nos. 10656313001, 10703737001 and 11417967001 respectively). The GS expression vector pEE12.4 (Lonza Biologics, UK) was similarly digested and dephosphorylated using calf intestinal alkaline phosphatase Roche Diagnostics Cat No. 10713023001). Each gene was ligated into the prepared pEE12.4 backbone using the LigaFast Rapid DNA Ligation System from Promega (Cat No. M8221). Ligations were then transformed into One
Shot Top 10 chemically competent cells (Invtrogen Cat No. C4040-03) and positive colonies identified by standard techniques. Large quantities of the resulting vectors (pEE12.4-PNO621 and pEE12.4-PNO521-S114C) were prepared by midiprep of overnight cultures using QIAfilter midiprep columns (QIAgen Cat No. 12243). Vectors were prepared for transfection by precipitating 20 μg in 100% ethanol with 1/10 volume of 3 M sodium acetate (pH 5.2) (Sigma Cat Nos. E7023 and 52889 respectively). Following a wash in 70% ethanol, vectors were resuspended in 40 μl of T.E. pH 8.0 (Sigma Cat No. T9285) at a working concentration of 0.5 μg/μl. - For each
transfection 2 μl of Lipofectamine 2000 was added to 50 μl of Optimem I media (Invitrogen Cat Nos. 11668-027 and 31985-062) in a well of a 96 well plate. In a second well 1.6 μl of the expression vector (0.8 μg) was added to 50 μl of Optimem I media. Following a 5 minute room temperature incubation the contents of the two wells were mixed together and left for a further 20 minute incubation. Following this second incubation the whole transfection mixture was added to a well in the 24 well plate containing the CHOK1SV cells. Cells were incubated for at least 72 hours and supernatants harvested. Supernatants were centrifuged at 4,000×g for 5 minutes to pellet cell debris and were stored at −20° C. until expression of Compound 112 (SEQ ID No:59) and Compound 170 (SEQ ID No:11) was assayed by TNF ELISA. -
Compound 112 (SEQ ID No: 59) DIQMTQSPSSLSASVGDRVTITCRASQAIDSYLHWYQQKPGKAPKLLI YSASNLETGVPSRFSGSGSGTDFTLTISSLLPEDFATYYCQQVVWRPF TFGQGTKVEIKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDT LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT PPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGK - Microtitre plates (e.g. Sarstedt 82.9923-148) were coated with a 1 μg/mL solution of human recombinant TNF-α (Peprotech Cat # 300-01A) in carbonate/bicarbonate coating buffer pH 9.6, 100 μL/well. After overnight incubation at 4° C., plates were washed 3 times with PBS (0.01 M, pH 7.2) with 0.05
% Tween Compound 112 expressed. - Inclusion of the
truncated C H1 in the domain antibody construct results in a junction between the variable domain and hinge with higher homology to a conventional IgGi CH1-hinge junction (91.7%) than a junction lacking the truncated CH1 (83.3%; calculated using Align X on Vector NTI (Invitrogen) with a gap opening penalty of 1). Enhanced homology is likely to translate to increased resemblance to conventional immunoglobulin peptide sequences to which human patients should be immunologically tolerant, thereby reducing immunogenic potential. -
-
Compound 170 variable region-truncated CH1-hingejunction: TKVEIKRVEPKS (SEQ ID NO: 65) IgG1 CH1-hinge junction (NCBI accession AAG00909): TKVDKRVEPKS (SEQ ID NO: 66) Compound 170 variable region-hinge junction( truncated C H1 absent):TKVEIKREPKS (SEQ ID NO: 67)
C H1 sequence is bolded as indicated.
C H1 domain (SEQ ID No:60) obtained from NCBI protein database (http://www.ncbi.nlm.nih.gov) AAG00909: -
1 STKGPSVFPL APSSKSTSGG TAALGCLVKD YFPEPVTVSW NSGALTSGVH TFPAVLQSSG 61 LYSLSSVVTV PSSSLGTQTY ICNVNHKPSN TKVDKRVEPK SCDKTHTCPP CPAPELLGGP 121 SVFLFPPKPK DTLMISRTPE VTCVVVDVSH EDPEVKFNWY VDGVEVHNAK TKPREEQYNS 181 TYRVVSVLTV LHQDWLNGKE YKCKVSNKAL PAPIEKTISK AKGQPREPQV YTLPPSREEM 241 TKNQVSLTCL VKGFYPSDIA VEWESNGQPE NNYKTTPPVL DSDGSFFLYS KLTVDKSRWQ 301 QGNVFSCSVM HEALHNHYTQ KSLSLSPGK
CH1-hinge junction is indicated in underline. - The ability of the domain antibody construct Compound 170 (SEQ ID No:11) to neutralize TNF-α-mediated cytotoxicity was assessed using a murine L929 cell viability assay. Serial dilutions of
Compound 170 in RPMI medium with 10% foetal bovine serum (RPMI-FBS) were prepared in 50 μL volumes in flat bottomed 96 well plates. To each of these wells was added 50 μL recombinant human TNF-α (Strathmann Biotec, Hamburg, Germany) at a concentration of 360 pg/mL, followed by 2.5×104 L929 cells in 50 μL and 25 μL Actinomycin D at 40 μg/mL, all prepared in RPMI-FBS. Controls included wells with no TNF (for determination of 100% viability), no cells (0% viability) and a TNF-α standard curve ranging from 2 pg/mL to 4200 pg/mL. Culture plates were incubated in a 5% CO2 atmosphere at 37° C. for 20 hours, then for a further 3 hours after the addition of 25 μL 3-(4,5-dimethylthiazol-2yl)-5-(3-carboxymethoxyphenyl)-2-(4-sulfophenyl)-2H-tetrazolium (MTS)/phenazine ethosulfate (PES) (Promega CellTiter 96 AQueous One, Madison USA). Absorbance at 492 nm was determined against a reference wavelength of 630 nm and viability curves were plotted using average values calculated from triplicate test wells. The TNF-a-neutralizing ability ofCompound 170 is indicated by increasing cell viability with increasing concentrations of Compound 170 (FIG. 6 ). - The ability of the domain antibody construct Compound 170 (SEQ ID No:11) to inhibit binding of TNF-α to human p55 and p75 TNF receptors was evaluated by receptor binding assays. Human p55 (RnD systems, Cat No: 372-RI) or p75 (RnD systems, Cat No: 762-R2) was coated onto Maxisorb plates (Nunc) at 0.1 μg/mL in carbonate coating buffer pH 9.2 by overnight incubation at 4° C. Serial half-log dilutions of
Compound 170 ranging from 100 μg/mL down to 3.15 ng/mL (and a no Compound 170 ‘blank’ control) were prepared in antibody diluent (PBS pH 7.2, 0.05% Tween-20, 1% BSA) and were mixed with an equal volume of 60 ng/mL human TNF-α in antibody diluent. A blank containing no PN0621 and no TNF-α was also prepared to measure background binding. All mixtures were allowed to incubate for exactly 1 hour at room temperature with gentle agitation. During this incubation the coated plates were washed 3 times with PBS, 0.05% Tween-20 and then 3 times with PBS. The plates were then blocked with 200 μl/well of PBS, 1% BSA for 45 minutes at room temperature. Following washing of the plate, 100 μl of theCompound 170/TNF-α mixtures were added to triplicate wells for each concentration ofCompound 170 tested along with addition of all the controls. The plate was then incubated at room temperature for 1 hour. Following washing of the plate, a biotinylated anti-human TNF-α antibody (RnD Systems, Cat No: BAF210) was added at 0.6 μg/mL in antibody diluent to each well and incubated for 1 hour at room temperature. Following washing a Streptavidin-HRP conjugate (Zymed, Cat No: 43-4323) was added at 1:2000 in antibody diluent and incubated at room temperature for 45 mins. Visualization was performed using TMB substrate (Invitrogen, Cat No: 00-2023) stopped with 1 M HCl after 4 minutes. Absorbance readings were then measured at 450 nm using a reference of 620 nm. Analysis was performed by calculating the average absorbance of the triplicates. The average of the non-specific binding (no TNF-a) was subtracted from each absorbance value. - The results are indicated in
FIG. 7 and show thatCompound 170 prevents the interaction of TNF-α with the human p55 or p75 TNF receptors. - Analysis of binding to cell-bound (transmembrane) TNF-α was performed using an NS0 cell line, 27D4, stably transfected with a gene encoding human TNF-α protein lacking a TACE cleavage site, such that TNF-α remains cell membrane-associated because it cannot be cleaved. A similar cell line based on another murine myeloma (SP2/0) has been described (Scallon et al., (1995)
Cytokine 7 251-259). - Flow cytometry analysis was performed on 5×105 viable 27D4 cells per sample with all steps performed at 4° C. or on ice. Cell pellets were resuspended with test (
Compound 170; SEQ ID No:11) or irrelevant-specificity isotype-matched control (Sigma, Cat No: I5154) at 100 μg/ml in PBS containing 2% FBS, and incubated on ice for 1 hour. Two cell wash cycles were performed, each comprising, centrifugation for 10 minutes at 1000×g and resuspension of the cell pellet in PBS/2% FBS. Following another centrifugation step the cell pellet was resuspended in 100 μl secondary antibody conjugate (Anti-human Fc FITC conjugate, Sigma, Cat No: F9512) and incubated for 30 mins. The samples were then washed twice as described above and cell pellets resuspended in 500 μl PBS/2% FBS with 5 μg/mL propidium iodide (Sigma, Cat no: P4864). Fluorescent staining of cells was analysed on a Beckman Coulter Cell Lab Quanta flow cytometer and data was processed using WinMDI. - The results are indicated in
FIG. 8 , and show thatCompound 170 staining of transmembrane TNF-α-expressing NS0 27D4 cells (solid black line) shows higher fluorescence intensity than irrelevant specificity isotype-matched control (grey fill). - Stable cell lines of CHOK1SV expressing Compound 170 (SEQ ID No:11) were created using the expression vector described in the Materials and Methods. Briefly 1×107 cells in logarithmic growth phase were electroporated in glutamine-free CDCHO protein-free media in the presence of 40 μg of linearised plasmid DNA. 24 hours post-transfection a selective pressure of 50 μM methionine sulphoximine (Sigma) was applied and resistant cells were allowed to form colonies in 96 well plates. When approaching confluence, single colonies were transferred to 24 well plates, T25 and then T75 flasks. Once over confluent in T75 flasks cell lines were progressed to culture in E125 Erlenmeyer flasks and adapted to suspension growth over 6 subcultures. Once adapted to suspension growth cell lines were cryopreserved in a freeze mix of 92.5% CDCHO media:7.5% DMSO.
- Whilst cell lines were being expanded through the different well and flask sizes, a number of productivity assessments were performed in parallel to the progress of the cell lines to the next stage. Thus at the 24 well plate and E125 Erlenmeyer flask stages productivity assessments were performed. In each case cells were allowed to grow for 14 days and supernatants evaluated by the TNF ELISA method described in Example 1 for levels of
Compound 170. Cell lines were ranked on the productivity and the highest 10 were selected for evaluation in a proprietary fed-batch productivity assessment at Lonza Biologics. Productivities obtained were between 700 mg/L and 3371 mg/L. A lead cell line with a productivity of 2724 mg/L was selected for evaluation in 10 L laboratory scale fermenters. - Four separate 10 L laboratory scale fermenters were run over 15 days with the lead cell line and a proprietary generic fed batch process based on the protein-free CDCHO media. The resulting mean productivity of the 4 fermentations was 4851 mg/L with the highest productivity being 4925 mg/L (the highest reported level of productivity previously reported by Lonza Biologics for a non clonal cell line in a 15 day fermentation is 3560 mg/L). The 10 L laboratory-scale fermenters used were designed to mimic the fermentation conditions found in larger scale fermenters up to 2000 L, hence the lead cell line is expected to be suitable for commercial scale manufacture. Indeed similar expression levels were observed in a 200 L fermenter.
- Product harvested from the 4×10 L fermentations of the lead cell line expressing Compound 170 (SEQ ID No:11) was purified by Protein A affinity chromatography and analysed by SDS PAGE under both reducing and non-reducing conditions. As shown in
FIG. 11 ,Compound 170 is expressed as a monomer of approximately 90 kDa. This monomer is composed of 2 subunits of approximately 40 kDa which are apparent inFIG. 12 when the SDS PAGE is run under reducing conditions. Since SDS PAGE is not suitable for exact sizing of proteins further analysis of theCompound 170 monomer has been performed. ESI-MS (electronspray ionisation mass spectrometry) has sized theCompound 170 monomer at 78.739 kDa. This is in agreement with the predicted molecular weight of 2 subunits (2×38.058=76.116 kDa) each of which also carry a bi-antennary core fucosylated glycan sugar structure. - Compound 170 (SEQ ID No:11) was administered subcutaneously to cynomolgus monkeys at doses of 0.5, 5 and 50 mg/kg, and blood samples were taken at 0.5, 1, 2, 6 and 24 hours then at 1 day, 2, 4, 7, 10 and 14 days. Analysis of these samples for quantitation of
Compound 170 levels was performed using the anti-TNF ELISA method described in Example 1. Elimination half-life was determined by analysis of the levels ofCompound 170 in these samples. At 0.5 mg/Kg an elimination half-life of 110.5±13.9 hours was calculated. At 5 mg/Kg and 50 mg/Kg elimination half-lives of 110.9±10.4 and 103.5±11.5 hours were calculated. - When
Compound 170 was administered by intravenous route at 50 mg/Kg blood samples were taken at 10, 30 and 60 minutes, 4 and 24 hours, 2, 4, 7, 10 and 14 days. Analysis of these samples for quantitation ofCompound 170 levels was performed using the anti-TNF ELISA method described in Example 1. Elimination half-life was determined by analysis of the levels ofCompound 170 in these samples. Following 50 mg/Kg intravenous administration an elimination half-life of 109.6±10.7 hours was calculated. - Compound 170 (SEQ ID No:11) manufactured to GMP standards was evaluated in animal safety and toxicology studies.
- Different monkeys administered single doses of
Compound 170 at 0.5, 5 and 50 mg/kg by subcutaneous or intravenous route of administration showed no effects related to their treatment withCompound 170. In these studies microscopic examination of a range of organs was undertaken and no effects were observed. - Starting with a dose of 0.5 mg/kg given either subcutaneously or intravenously escalating doses up to 50 mg/kg were administered to cynomolgus monkeys every 7 days. Animals were assessed for a wide range of physiological and behavioural parameters including haematology, clinical chemistry, body and organ weight and macroscopic inspection of organs following necropsy. Throughout these studies no adverse reactions to the treatment with
Compound 170 were reported. Following the conclusion of the dose escalation phase of studies those animals which received the escalating dose subcutaneously were administered with a further 4 doses of 50 mg/kg over a further 4 week period. Again no effects, across the wide range of parameters, related to the treatment withCompound 170 were observed. - The cardiovascular safety of
Compound 170 at 50 mg/kg was evaluated in cynomolgus monkeys fitted with radio-telemetry monitors. These monitors report a range of respiratory and cardiovascular parameters directly from the conscious monkeys. Following dosing withCompound 170 no adverse treatment-related clinical observations were reported. - Compound 170 (SEQ ID No:11) in preceding examples was produced in mammalian expression systems.
Functional Compound 170 was also produced using a bacterial expression system. - The amino acid sequence for
Compound 170 minus the signal sequence was back-translated and optimized by GeneOptimizer™ for E. coli expression and synthesized de novo at GeneArt GmbH. The synthesized gene was subcloned into the pBAD gIII/His-tagged expression vector (Invitrogen) via NcoI and HindIII restriction sites (Roche) generating a vector ready for bacterial expression. TOP10 cells (Invitrogen) were transformed with the vector by the heat shock method and glycerol stocks of single colonies generated. Induction conditions were 0.002% arabinose (Sigma; final concentration) and 4 hr induction period.Compound 170 protein samples were generated using the osmotic shock method as detailed in the pBAD bacterial expression system manual (Invitrogen). The BCA assay (Pierce) was used to determine the total protein concentration of the samples. Bacterially-expressedCompound 170 was assayed for binding to TNF-α in an ELISA as described in Example 1. -
FIG. 9 shows thatCompound 170 produced in a bacterial system retained binding to TNF-α in an ELISA assay. - The DNA sequence for bacterial expression of
Compound 170 is as follows: -
(SEQ ID No: 61) ATGGCGAGCACCGATATTCAGATGACCCAGAGCCCGAGCAGCCTGAGC GCGAGCGTGGGTGATCGTGTGACCATTACCTGCCGTGCGAGCCAGGCG ATTGATAGCTATCTGCATTGGTATCAGCAGAAACCGGGCAAAGCGCCG AAACTGCTGATTTATAGCGCGAGCAACCTGGAAACCGGCGTGCCGAGC CGTTTTAGCGGCAGCGGTAGCGGCACCGATTTTACCCTGACCATTAGC AGCCTGCTGCCGGAAGATTTTGCGACCTATTATTGCCAGCAGGTGGTG TGGCGTCCGTTTACCTTTGGCCAGGGCACCAAAGTGGAAATTAAACGC GTGGAACCGAAAAGCAGCGATAAAACCCACACGTGCCCGCCGTGTCCG GCGCCGGAACTGCTGGGTGGCCCGAGCGTGTTTCTGTTTCCGCCGAAA CCGAAAGATACCCTGATGATTAGCCGTACCCCGGAAGTGACCTGCGTG GTGGTGGATGTGAGCCATGAAGATCCGGAAGTGAAATTCAACTGGTAT GTGGATGGCGTGGAAGTGCATAACGCGAAAACCAAACCGCGTGAAGAA CAGTATAACAGCACCTATCGTGTGGTGAGCGTGCTGACCGTGCTGCAT CAGGATTGGCTGAACGGCAAAGAATACAAATGCAAAGTGTCTAACAAA GCGCTGCCGGCGCCGATTGAAAAAACCATCAGCAAAGCGAAAGGCCAG CCGCGTGAACCGCAGGTGTATACCCTGCCGCCGAGCCGTGATGAACTG ACCAAAAACCAGGTGAGCCTGACCTGCCTGGTGAAAGGCTTTTATCCG AGCGATATTGCGGTGGAATGGGAAAGCAACGGCCAGCCGGAAAACAAC TATAAAACCACCCCGCCGGTGCTGGATAGCGATGGCAGCTTTTTCCTG TATAGCAAACTGACCGTGGATAAAAGCCGTTGGCAGCAGGGCAACGTG TTTAGCTGCAGCGTGATGCATGAAGCGCTGCATAACCATTATACCCAG AAAAGCCTGAGCCTGAGCCCGGGTAAAGCGGCGGCG - The amino acid sequence encoded by SEQ ID No:61 is as follows:
-
(SEQ ID NO: 62) MASTDIQMTQSPSSLSASVGDRVTITCRASQAIDSYLHWYQQKPGKAP KLLIYSASNLETGVPSRFSGSGSGTDFTLTISSLLPEDFATYYCQQVV WRPFTFGQGTKVEIKRVEPKSSDKTHTCPPCPAPELLGGPSVFLFPPK PKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQ PREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQ KSLSLSPGKAAAVDHHHHHH - The human TNF transgenic mouse line, Tg197, shows deregulated TNF expression and develops chronic inflammatory polyarthritis (Keffer, J. et. al. (1991) Transgenic mice expressing human tumor necrosis factor: a predictive genetic model of arthritis. EMBO Journal 10:4025-31). Administration of Compound 170 (SEQ ID No:11) prevented the development of arthritis and associated weight loss in these mice (
FIGS. 10A & B). Groups of 8 heterozygous Tg197 (each containing 4 males and 4 females) were treated with twice weekly intraperitoneal injections ofCompound 170 and irrelevant specificity control human IgG1 (palivizumab {Synagis®}, MedImmune/Abbott) in PBS, both at 10 mg/kg. Treatment commenced when mice were 3 weeks of age. At weekly intervals, mice were weighed and scored (arthritic score) based on macroscopic ankle morphology (swelling, distortion and degree of movement). - Compound 112 (SEQ ID No: 59) is a modification of Compound 170 (SEQ ID No:11) which contains a cysteine residue at position 114 instead of a serine residue which is present in this position in
Compound 170. The effect of substituting cysteine 114 for serine on protein expression was evaluated by comparison withCompound 170. Multiple cultures of host cells transfected with gene constructs forCompound FIG. 11 . - It will be appreciated by persons skilled in the art that numerous variations and/or modifications may be made to the invention as shown in the specific embodiments without departing from the spirit or scope of the invention as broadly described. The present embodiments are, therefore, to be considered in all respects as illustrative and not restrictive.
Claims (21)
1. A domain antibody construct which binds to human TNF-α, the construct comprising:
(a) a domain antibody (dAb) which binds to human TNF-α;
(b) a modified hinge region sequence;
(c) a human or primate heavy chain constant region sequence having a truncated CH1 domain of not more than 20 residues,
wherein said modified hinge region sequence contains either a deletion or a single amino acid substitution of at least one cysteine residue which normally facilitates disulfide bond formation between heavy and light antibody chains.
2. The domain antibody construct according to claim 1 wherein the human or primate heavy chain constant region sequence having a truncated CH1 domain comprises not more than 10 residues.
3. The domain antibody construct according to claim 2 wherein the human or primate heavy chain constant region sequence having a truncated CH1 domain comprises not more than 5 residues.
4. The domain antibody construct according to claim 3 wherein the human or primate heavy chain constant region sequence having a truncated CH1 domain comprises not more than a single residue.
5. The domain antibody construct according to claim 1 wherein the sequence of the CH1 domain and the hinge region is XEPKSZDKTHTCPPCPA (SEQ ID No: 64) wherein X is valine, leucine or isoleucine and Z is absent or an amino acid other than cysteine.
6. The domain antibody construct according to claim 5 wherein X is valine and Z is serine.
7. The domain antibody construct according to claim 1 wherein the dAb comprises an immunoglobulin heavy or light chain variable domain, wherein said variable domain comprises at least one complementarity determining region (CDR) having a sequence derived from a New World primate wherein the CDR is selected from the group consisting of AATKLQS (SEQ ID No:1), EASSLQS (SEQ ID No:2), EASKLQS (SEQ ID No:3), and SASNLET (SEQ ID No:4).
8. The domain antibody construct according to claim 7 wherein the CDR is CDR2.
9. The domain antibody construct according to claim 1 wherein the domain antibody has a sequence selected from the group consisting of:
a sequence at least 95% identical to one of these sequences.
10. The domain antibody construct according to claim 1 wherein the cysteine residue within the hinge region which normally facilitates disulfide bond formation between heavy and light antibody chains is substituted with a serine residue.
11. The domain antibody construct according to claim 1 wherein the hinge region comprises the sequence EPKSSDKTHTCPPCPA (SEQ ID No:12).
12-20. (canceled)
21. The domain antibody construct according to claim 1 wherein the amino acid sequence is at least 60% identical to the sequence set forth in SEQ ID No:11.
22-29. (canceled)
30. A dimeric domain antibody construct which binds to human TNF-α wherein the dimer consists of two domain antibody constructs according to claim 1 .
31. The dimeric domain antibody construct according to claim 30 wherein the dimeric domain antibody construct is a homodimer.
32. The dimeric domain antibody construct according to claim 31 wherein the domain antibody constructs making up the homodimer comprises an amino acid sequence which is at least 60% identical to the sequence set forth in SEQ ID No:11.
33-50. (canceled)
51. A pharmaceutical composition comprising an effective amount of a domain antibody construct according to claim 1 , together with a pharmaceutically acceptable carrier or diluent.
52. A pharmaceutical composition comprising an effective amount of a dimeric domain antibody construct according to claim 30 , together with a pharmaceutically acceptable carrier or diluent.
53-59. (canceled)
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US12/831,874 US20110044979A1 (en) | 2006-02-01 | 2010-07-07 | Domain antibody construct |
Applications Claiming Priority (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
AU2006900456A AU2006900456A0 (en) | 2006-02-01 | Domain antibody construct | |
AU2006900456 | 2006-02-01 | ||
US81750706P | 2006-06-28 | 2006-06-28 | |
US11/670,261 US7846439B2 (en) | 2006-02-01 | 2007-02-01 | Domain antibody construct |
US12/831,874 US20110044979A1 (en) | 2006-02-01 | 2010-07-07 | Domain antibody construct |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US11/670,261 Continuation US7846439B2 (en) | 2006-02-01 | 2007-02-01 | Domain antibody construct |
Publications (1)
Publication Number | Publication Date |
---|---|
US20110044979A1 true US20110044979A1 (en) | 2011-02-24 |
Family
ID=45220168
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US11/670,261 Expired - Fee Related US7846439B2 (en) | 2006-02-01 | 2007-02-01 | Domain antibody construct |
US12/831,874 Abandoned US20110044979A1 (en) | 2006-02-01 | 2010-07-07 | Domain antibody construct |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US11/670,261 Expired - Fee Related US7846439B2 (en) | 2006-02-01 | 2007-02-01 | Domain antibody construct |
Country Status (12)
Country | Link |
---|---|
US (2) | US7846439B2 (en) |
EP (1) | EP1987064A4 (en) |
JP (2) | JP5259423B2 (en) |
KR (1) | KR20090039666A (en) |
CN (2) | CN101400703B (en) |
AU (1) | AU2007211829C9 (en) |
BR (1) | BRPI0707425A2 (en) |
CA (1) | CA2640661A1 (en) |
EA (1) | EA017417B1 (en) |
MX (1) | MX2008009792A (en) |
NZ (1) | NZ569988A (en) |
WO (1) | WO2007087673A1 (en) |
Families Citing this family (18)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2007019620A1 (en) * | 2005-08-15 | 2007-02-22 | Arana Therapeutics Limited | Engineered antibodies with new world primate framework regions |
AU2006326867A1 (en) * | 2005-12-20 | 2007-06-28 | Cephalon Australia Pty Ltd | Chimeric antibodies with part New World primate binding regions |
MX2008009792A (en) | 2006-02-01 | 2008-09-01 | Arana Therapeutics Ltd | Domain antibody construct. |
US20080139790A1 (en) * | 2006-12-08 | 2008-06-12 | Jennings Philip A | Chimeric antibodies |
WO2008092209A1 (en) * | 2007-02-01 | 2008-08-07 | Arana Therapeutics Limited | Protein construct with improved properties |
EP2036980A1 (en) * | 2007-09-14 | 2009-03-18 | Gruber, Jens | Down regulation of gene expression using virus-like particles charged with nucleic acid |
EP2238165B1 (en) | 2008-01-07 | 2017-07-05 | Government of the United States of America, as represented by the Secretary, Department of Health and Human Services | Anti-hiv domain antibodies and method of making and using same |
BRPI0914005A2 (en) * | 2008-07-02 | 2015-11-17 | Emergent Product Dev Seattle | multi-target tnf-alpha antagonist proteins |
EP2318436A4 (en) * | 2008-08-14 | 2012-12-19 | Cephalon Australia Pty Ltd | Variant domain antibodies |
KR20110091777A (en) * | 2008-11-26 | 2011-08-12 | 글락소 그룹 리미티드 | Polypeptides, antibody variable domains and antagonists |
US8133979B2 (en) * | 2008-12-16 | 2012-03-13 | Hoffmann-La Roche Inc. | Antibodies against human angiopoietin 2 |
EP2210902A1 (en) | 2009-01-14 | 2010-07-28 | TcL Pharma | Recombinant monovalent antibodies |
IT1394281B1 (en) * | 2009-01-19 | 2012-06-06 | Zardi | PROCESS FOR THE PRODUCTION OF POLYVALENT AND POLYSPECIFIC MELTING PROTEINS USING AS A STRUCTURE CARRYING OUT THE UTEROGLOBIN AND PRODUCTS OBTAINED SO. |
WO2010121140A1 (en) | 2009-04-16 | 2010-10-21 | Facet Biotech Corporation | ANTI-TNF-α ANTIBODIES AND THEIR USES |
AU2012310328A1 (en) * | 2011-09-23 | 2014-04-10 | Technophage, Investigação E Desenvolvimento Em Biotecnologia, S.A. | Anti-Tumor Necrosis Factor-alpha agents and uses thereof |
CN104045715B (en) * | 2013-03-15 | 2018-05-01 | 兰州大学 | The preparation and application of Dimerized fusion protein |
AU2016304764C1 (en) * | 2015-08-07 | 2023-06-01 | Imaginab, Inc. | Antigen binding constructs to target molecules |
US11266745B2 (en) | 2017-02-08 | 2022-03-08 | Imaginab, Inc. | Extension sequences for diabodies |
Citations (47)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4002531A (en) * | 1976-01-22 | 1977-01-11 | Pierce Chemical Company | Modifying enzymes with polyethylene glycol and product produced thereby |
US4816567A (en) * | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
US5223409A (en) * | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
US5225539A (en) * | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
US5349052A (en) * | 1988-10-20 | 1994-09-20 | Royal Free Hospital School Of Medicine | Process for fractionating polyethylene glycol (PEG)-protein adducts and an adduct for PEG and granulocyte-macrophage colony stimulating factor |
US5427908A (en) * | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
US5585089A (en) * | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
US5612460A (en) * | 1989-04-19 | 1997-03-18 | Enzon, Inc. | Active carbonates of polyalkylene oxides for modification of polypeptides |
US5627052A (en) * | 1990-08-02 | 1997-05-06 | B.R. Centre, Ltd. | Methods for the production of proteins with a desired function |
US5885793A (en) * | 1991-12-02 | 1999-03-23 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
US5892019A (en) * | 1987-07-15 | 1999-04-06 | The United States Of America, As Represented By The Department Of Health And Human Services | Production of a single-gene-encoded immunoglobulin |
US5969108A (en) * | 1990-07-10 | 1999-10-19 | Medical Research Council | Methods for producing members of specific binding pairs |
US5977307A (en) * | 1989-09-07 | 1999-11-02 | Alkermes, Inc. | Transferrin receptor specific ligand-neuropharmaceutical agent fusion proteins |
US5994510A (en) * | 1990-12-21 | 1999-11-30 | Celltech Therapeutics Limited | Recombinant antibodies specific for TNFα |
US20030039649A1 (en) * | 2001-07-12 | 2003-02-27 | Jefferson Foote | Super humanized antibodies |
US20030118592A1 (en) * | 2001-01-17 | 2003-06-26 | Genecraft, Inc. | Binding domain-immunoglobulin fusion proteins |
US20030143682A1 (en) * | 2000-11-07 | 2003-07-31 | Nicolaides Nicholas C. | Antibodies and methods for generating genetically altered antibodies with high affinity |
US20030199679A1 (en) * | 1990-12-21 | 2003-10-23 | Adair John Robert | Recombinant antibodies specific for TNF-alpha |
US20030215427A1 (en) * | 2001-04-11 | 2003-11-20 | Michael Jensen | CE7-specific redirected immune cells |
US20030232971A1 (en) * | 1989-08-07 | 2003-12-18 | Rathjen Deborah Ann | Tumour necrosis factor binding ligands |
US20040101905A1 (en) * | 2000-12-01 | 2004-05-27 | Brekke Ole Henrik Andre | Product |
US20040132101A1 (en) * | 2002-09-27 | 2004-07-08 | Xencor | Optimized Fc variants and methods for their generation |
US6821505B2 (en) * | 1997-03-03 | 2004-11-23 | Board Of Regents, The University Of Texas System | Immunoglobin-like domains with increased half lives |
US20050118643A1 (en) * | 2003-07-18 | 2005-06-02 | Burgess Teresa L. | Specific binding agents to hepatocyte growth factor |
US20050226863A1 (en) * | 2003-11-20 | 2005-10-13 | Massachusetts Institute Of Technology | Single-domain antibodies and uses thereof |
US20050271663A1 (en) * | 2001-06-28 | 2005-12-08 | Domantis Limited | Compositions and methods for treating inflammatory disorders |
US20060024308A1 (en) * | 2004-07-06 | 2006-02-02 | Roberto Crea | High affinity anti-TNF-alpha antibodies and method |
US20060034845A1 (en) * | 2002-11-08 | 2006-02-16 | Karen Silence | Single domain antibodies directed against tumor necrosis factor alpha and uses therefor |
US20060038027A1 (en) * | 2004-03-15 | 2006-02-23 | Boston Scientific Scimed, Inc. | Apparatus and method for fine bore orifice spray coating of medical devices and pre-filming atomization |
US20060073141A1 (en) * | 2001-06-28 | 2006-04-06 | Domantis Limited | Compositions and methods for treating inflammatory disorders |
US20060083747A1 (en) * | 2002-12-27 | 2006-04-20 | Domantis Limited | Fc fusion |
US20060210526A1 (en) * | 2003-07-11 | 2006-09-21 | Brocchini Stephen J | Conjugated biological molecules and their preparation |
US20070003549A1 (en) * | 2004-08-24 | 2007-01-04 | Olga Ignatovich | Ligands that have binding specificity for VEGF and/or EGFR and methods of use therefor |
US20070111281A1 (en) * | 2005-05-09 | 2007-05-17 | Glycart Biotechnology Ag | Antigen binding molecules having modified Fc regions and altered binding to Fc receptors |
US20070202105A1 (en) * | 2006-02-01 | 2007-08-30 | Peptech Limited | Domain antibody construct |
US20070269449A1 (en) * | 2003-03-26 | 2007-11-22 | Apogenix Gmbh | Fc Fusion Proteins |
US20080071063A1 (en) * | 2006-02-03 | 2008-03-20 | Medimmune, Inc. | Protein Formulations |
US20080095767A1 (en) * | 2005-08-15 | 2008-04-24 | Peptech Limited | Engineered antibodies with new world primate framework regions |
US20080139790A1 (en) * | 2006-12-08 | 2008-06-12 | Jennings Philip A | Chimeric antibodies |
US20080227958A1 (en) * | 2006-04-14 | 2008-09-18 | Trubion Pharmaceuticals Inc. | Binding proteins comprising immunoglobulin hinge and fc regions having altered fc effector functions |
US20080241166A1 (en) * | 2002-06-28 | 2008-10-02 | Domantis Limited | Ligands that bind a receptor |
US20080260738A1 (en) * | 2007-04-18 | 2008-10-23 | Moore Margaret D | Single chain fc, methods of making and methods of treatment |
US20090075338A1 (en) * | 2004-03-08 | 2009-03-19 | Zymogenetics, Inc | Dimeric fusion proteins and materials and methods for producing them |
US20090148905A1 (en) * | 2007-11-30 | 2009-06-11 | Claire Ashman | Antigen-binding constructs |
US20090221803A1 (en) * | 2005-04-26 | 2009-09-03 | Medimmune, Inc. | Modulation of antibody effector function by hinge domain engineering |
US20090226428A1 (en) * | 2005-12-20 | 2009-09-10 | Arana Therapeutic Limited | Anti-inflammatory dab |
US20100125130A1 (en) * | 1989-08-07 | 2010-05-20 | Deborah Ann Rathjen | Tumour necrosis factor binding ligands |
Family Cites Families (33)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1988001649A1 (en) | 1986-09-02 | 1988-03-10 | Genex Corporation | Single polypeptide chain binding molecules |
GB8720833D0 (en) | 1987-09-04 | 1987-10-14 | Celltech Ltd | Recombinant dna product |
WO1989007142A1 (en) | 1988-02-05 | 1989-08-10 | Morrison Sherie L | Domain-modified constant region antibodies |
AU4308689A (en) | 1988-09-02 | 1990-04-02 | Protein Engineering Corporation | Generation and selection of recombinant varied binding proteins |
JP2919890B2 (en) | 1988-11-11 | 1999-07-19 | メディカル リサーチ カウンスル | Single domain ligand, receptor consisting of the ligand, method for producing the same, and use of the ligand and the receptor |
WO1992020791A1 (en) | 1990-07-10 | 1992-11-26 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
CA2095633C (en) | 1990-12-03 | 2003-02-04 | Lisa J. Garrard | Enrichment method for variant proteins with altered binding properties |
DE69233628T2 (en) | 1991-07-25 | 2007-04-26 | Biogen Idec Inc., San Diego | Recombinant antibodies for human therapy |
GB9317618D0 (en) | 1993-08-24 | 1993-10-06 | Royal Free Hosp School Med | Polymer modifications |
DK1143006T3 (en) | 1995-08-18 | 2008-07-14 | Morphosys Ip Gmbh | Vectors / DNA sequences from human combinatorial antibody libraries |
US6090382A (en) * | 1996-02-09 | 2000-07-18 | Basf Aktiengesellschaft | Human antibodies that bind human TNFα |
TR199801532T2 (en) | 1996-02-09 | 1998-11-23 | Basf Aktiengesellschaft | Human antibodies that bind human TNFalpha. |
DE69731289D1 (en) | 1996-03-18 | 2004-11-25 | Univ Texas | IMMUNGLOBULIN-LIKE DOMAIN WITH INCREASED HALF-VALUE TIMES |
US6300065B1 (en) | 1996-05-31 | 2001-10-09 | Board Of Trustees Of The University Of Illinois | Yeast cell surface display of proteins and uses thereof |
CN1238366C (en) | 1997-01-21 | 2006-01-25 | 综合医院公司 | Selection of proteins using RNA-protein fusions |
JP2001508783A (en) | 1997-01-29 | 2001-07-03 | ポリマスク・ファーマシューティカルズ・パブリック・リミテッド・カンパニー | PEGylation method |
WO1998049286A2 (en) | 1997-05-01 | 1998-11-05 | Board Of Regents, The University Of Texas System | Directed evolution of enzymes and antibodies |
IES80929B2 (en) | 1997-11-26 | 1999-06-30 | Donal Richard Mcgoey | Filter with form-retaining stabilizing means |
US20020142374A1 (en) * | 1998-08-17 | 2002-10-03 | Michael Gallo | Generation of modified molecules with increased serum half-lives |
GB9900298D0 (en) | 1999-01-07 | 1999-02-24 | Medical Res Council | Optical sorting method |
CN1763097B (en) | 1999-01-15 | 2011-04-13 | 杰南技术公司 | Polypeptide variants with altered effector function |
US7446179B2 (en) * | 2000-11-07 | 2008-11-04 | City Of Hope | CD19-specific chimeric T cell receptor |
WO2004058821A2 (en) | 2002-12-27 | 2004-07-15 | Domantis Limited | Dual specific single domain antibodies specific for a ligand and for the receptor of the ligand |
MXPA04009418A (en) | 2002-03-29 | 2005-06-08 | Schering Corp | Human monoclonal antibodies to interleukin-5 and methods and compositions comprising same. |
CN1678634A (en) | 2002-06-28 | 2005-10-05 | 多曼蒂斯有限公司 | Immunoglobulin single variable antigen combination area and its opposite constituent |
AU2003286003B2 (en) * | 2002-11-08 | 2011-05-26 | Ablynx N.V. | Stabilized single domain antibodies |
GB0230201D0 (en) | 2002-12-27 | 2003-02-05 | Domantis Ltd | Retargeting |
CA2542192C (en) | 2003-06-27 | 2013-05-28 | Bioren, Inc. | Look-through mutagenesis |
AU2004220325B2 (en) | 2003-06-30 | 2011-05-12 | Domantis Limited | Polypeptides |
US20070212301A1 (en) | 2003-11-07 | 2007-09-13 | Amgen, Inc. | Monkey Immunoglobulin Sequences |
PT1718677E (en) | 2003-12-19 | 2012-07-18 | Genentech Inc | Monovalent antibody fragments useful as therapeutics |
JP2008531060A (en) | 2005-03-04 | 2008-08-14 | バイオジェン・アイデック・エムエイ・インコーポレイテッド | A method for humanizing immunoglobulin variable regions via rational modification of complementarity determining residues |
ZA200802246B (en) | 2005-08-15 | 2009-09-30 | Arana Therapeutics Ltd | Engineered antibodies with new world primate framework regions |
-
2007
- 2007-02-01 MX MX2008009792A patent/MX2008009792A/en active IP Right Grant
- 2007-02-01 JP JP2008552642A patent/JP5259423B2/en not_active Expired - Fee Related
- 2007-02-01 BR BRPI0707425-5A patent/BRPI0707425A2/en not_active IP Right Cessation
- 2007-02-01 EP EP07701418A patent/EP1987064A4/en not_active Withdrawn
- 2007-02-01 AU AU2007211829A patent/AU2007211829C9/en not_active Ceased
- 2007-02-01 US US11/670,261 patent/US7846439B2/en not_active Expired - Fee Related
- 2007-02-01 KR KR1020087021381A patent/KR20090039666A/en not_active Application Discontinuation
- 2007-02-01 CA CA002640661A patent/CA2640661A1/en not_active Abandoned
- 2007-02-01 WO PCT/AU2007/000085 patent/WO2007087673A1/en active Application Filing
- 2007-02-01 CN CN2007800083708A patent/CN101400703B/en not_active Expired - Fee Related
- 2007-02-01 CN CN2013100625658A patent/CN103232540A/en active Pending
- 2007-02-01 NZ NZ569988A patent/NZ569988A/en not_active IP Right Cessation
- 2007-02-01 EA EA200870208A patent/EA017417B1/en not_active IP Right Cessation
-
2010
- 2010-07-07 US US12/831,874 patent/US20110044979A1/en not_active Abandoned
-
2012
- 2012-11-15 JP JP2012251159A patent/JP2013059338A/en active Pending
Patent Citations (57)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4002531A (en) * | 1976-01-22 | 1977-01-11 | Pierce Chemical Company | Modifying enzymes with polyethylene glycol and product produced thereby |
US4816567A (en) * | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
US5225539A (en) * | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
US5892019A (en) * | 1987-07-15 | 1999-04-06 | The United States Of America, As Represented By The Department Of Health And Human Services | Production of a single-gene-encoded immunoglobulin |
US5837500A (en) * | 1988-09-02 | 1998-11-17 | Dyax, Corp. | Directed evolution of novel binding proteins |
US5223409A (en) * | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
US5403484A (en) * | 1988-09-02 | 1995-04-04 | Protein Engineering Corporation | Viruses expressing chimeric binding proteins |
US5571698A (en) * | 1988-09-02 | 1996-11-05 | Protein Engineering Corporation | Directed evolution of novel binding proteins |
US5349052A (en) * | 1988-10-20 | 1994-09-20 | Royal Free Hospital School Of Medicine | Process for fractionating polyethylene glycol (PEG)-protein adducts and an adduct for PEG and granulocyte-macrophage colony stimulating factor |
US5585089A (en) * | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
US5612460A (en) * | 1989-04-19 | 1997-03-18 | Enzon, Inc. | Active carbonates of polyalkylene oxides for modification of polypeptides |
US20100125130A1 (en) * | 1989-08-07 | 2010-05-20 | Deborah Ann Rathjen | Tumour necrosis factor binding ligands |
US20030232971A1 (en) * | 1989-08-07 | 2003-12-18 | Rathjen Deborah Ann | Tumour necrosis factor binding ligands |
US5977307A (en) * | 1989-09-07 | 1999-11-02 | Alkermes, Inc. | Transferrin receptor specific ligand-neuropharmaceutical agent fusion proteins |
US5580717A (en) * | 1990-05-01 | 1996-12-03 | Affymax Technologies N.V. | Recombinant library screening methods |
US5427908A (en) * | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
US5969108A (en) * | 1990-07-10 | 1999-10-19 | Medical Research Council | Methods for producing members of specific binding pairs |
US5627052A (en) * | 1990-08-02 | 1997-05-06 | B.R. Centre, Ltd. | Methods for the production of proteins with a desired function |
US5994510A (en) * | 1990-12-21 | 1999-11-30 | Celltech Therapeutics Limited | Recombinant antibodies specific for TNFα |
US20030199679A1 (en) * | 1990-12-21 | 2003-10-23 | Adair John Robert | Recombinant antibodies specific for TNF-alpha |
US5885793A (en) * | 1991-12-02 | 1999-03-23 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
US6821505B2 (en) * | 1997-03-03 | 2004-11-23 | Board Of Regents, The University Of Texas System | Immunoglobin-like domains with increased half lives |
US20030143682A1 (en) * | 2000-11-07 | 2003-07-31 | Nicolaides Nicholas C. | Antibodies and methods for generating genetically altered antibodies with high affinity |
US20040101905A1 (en) * | 2000-12-01 | 2004-05-27 | Brekke Ole Henrik Andre | Product |
US20030118592A1 (en) * | 2001-01-17 | 2003-06-26 | Genecraft, Inc. | Binding domain-immunoglobulin fusion proteins |
US20030215427A1 (en) * | 2001-04-11 | 2003-11-20 | Michael Jensen | CE7-specific redirected immune cells |
US20050271663A1 (en) * | 2001-06-28 | 2005-12-08 | Domantis Limited | Compositions and methods for treating inflammatory disorders |
US20090258012A1 (en) * | 2001-06-28 | 2009-10-15 | Domantis Limited | Compositions and methods for treating inflammatory disorders |
US20060073141A1 (en) * | 2001-06-28 | 2006-04-06 | Domantis Limited | Compositions and methods for treating inflammatory disorders |
US20030039649A1 (en) * | 2001-07-12 | 2003-02-27 | Jefferson Foote | Super humanized antibodies |
US20080241166A1 (en) * | 2002-06-28 | 2008-10-02 | Domantis Limited | Ligands that bind a receptor |
US20040132101A1 (en) * | 2002-09-27 | 2004-07-08 | Xencor | Optimized Fc variants and methods for their generation |
US20060034845A1 (en) * | 2002-11-08 | 2006-02-16 | Karen Silence | Single domain antibodies directed against tumor necrosis factor alpha and uses therefor |
US20060083747A1 (en) * | 2002-12-27 | 2006-04-20 | Domantis Limited | Fc fusion |
US20070269449A1 (en) * | 2003-03-26 | 2007-11-22 | Apogenix Gmbh | Fc Fusion Proteins |
US20060210526A1 (en) * | 2003-07-11 | 2006-09-21 | Brocchini Stephen J | Conjugated biological molecules and their preparation |
US20050118643A1 (en) * | 2003-07-18 | 2005-06-02 | Burgess Teresa L. | Specific binding agents to hepatocyte growth factor |
US20050226863A1 (en) * | 2003-11-20 | 2005-10-13 | Massachusetts Institute Of Technology | Single-domain antibodies and uses thereof |
US20090075338A1 (en) * | 2004-03-08 | 2009-03-19 | Zymogenetics, Inc | Dimeric fusion proteins and materials and methods for producing them |
US20060038027A1 (en) * | 2004-03-15 | 2006-02-23 | Boston Scientific Scimed, Inc. | Apparatus and method for fine bore orifice spray coating of medical devices and pre-filming atomization |
US20060024308A1 (en) * | 2004-07-06 | 2006-02-02 | Roberto Crea | High affinity anti-TNF-alpha antibodies and method |
US20070003549A1 (en) * | 2004-08-24 | 2007-01-04 | Olga Ignatovich | Ligands that have binding specificity for VEGF and/or EGFR and methods of use therefor |
US20090081233A1 (en) * | 2004-08-24 | 2009-03-26 | Domantis Limited | Ligands that have binding specificity for VEGF and/or EGFR and methods of use therefor |
US20090221803A1 (en) * | 2005-04-26 | 2009-09-03 | Medimmune, Inc. | Modulation of antibody effector function by hinge domain engineering |
US20070111281A1 (en) * | 2005-05-09 | 2007-05-17 | Glycart Biotechnology Ag | Antigen binding molecules having modified Fc regions and altered binding to Fc receptors |
US20080095767A1 (en) * | 2005-08-15 | 2008-04-24 | Peptech Limited | Engineered antibodies with new world primate framework regions |
US20090286962A1 (en) * | 2005-12-20 | 2009-11-19 | Woolven Benjamin P | Chimeric antibodies with part new world primate binding regions |
US8263076B2 (en) * | 2005-12-20 | 2012-09-11 | Cephalon Australia Pty Ltd. | Anti-inflammatory dAb |
US20090226428A1 (en) * | 2005-12-20 | 2009-09-10 | Arana Therapeutic Limited | Anti-inflammatory dab |
US7846439B2 (en) * | 2006-02-01 | 2010-12-07 | Cephalon Australia Pty Ltd | Domain antibody construct |
US20070202105A1 (en) * | 2006-02-01 | 2007-08-30 | Peptech Limited | Domain antibody construct |
US20080071063A1 (en) * | 2006-02-03 | 2008-03-20 | Medimmune, Inc. | Protein Formulations |
US20080227958A1 (en) * | 2006-04-14 | 2008-09-18 | Trubion Pharmaceuticals Inc. | Binding proteins comprising immunoglobulin hinge and fc regions having altered fc effector functions |
US20080255343A1 (en) * | 2006-12-08 | 2008-10-16 | Arana Therapeutics Limited | Chimeric antibodies |
US20080139790A1 (en) * | 2006-12-08 | 2008-06-12 | Jennings Philip A | Chimeric antibodies |
US20080260738A1 (en) * | 2007-04-18 | 2008-10-23 | Moore Margaret D | Single chain fc, methods of making and methods of treatment |
US20090148905A1 (en) * | 2007-11-30 | 2009-06-11 | Claire Ashman | Antigen-binding constructs |
Also Published As
Publication number | Publication date |
---|---|
CA2640661A1 (en) | 2007-08-09 |
AU2007211829C9 (en) | 2013-07-11 |
EA200870208A1 (en) | 2009-02-27 |
NZ569988A (en) | 2011-09-30 |
KR20090039666A (en) | 2009-04-22 |
EP1987064A1 (en) | 2008-11-05 |
WO2007087673A1 (en) | 2007-08-09 |
AU2007211829C8 (en) | 2013-06-27 |
JP2013059338A (en) | 2013-04-04 |
CN103232540A (en) | 2013-08-07 |
AU2007211829C1 (en) | 2013-05-23 |
US20070202105A1 (en) | 2007-08-30 |
AU2007211829A1 (en) | 2007-08-09 |
CN101400703B (en) | 2013-05-08 |
JP2009525031A (en) | 2009-07-09 |
AU2007211829B2 (en) | 2012-11-08 |
EA017417B1 (en) | 2012-12-28 |
JP5259423B2 (en) | 2013-08-07 |
MX2008009792A (en) | 2008-09-01 |
BRPI0707425A2 (en) | 2011-05-03 |
CN101400703A (en) | 2009-04-01 |
EP1987064A4 (en) | 2010-04-07 |
US7846439B2 (en) | 2010-12-07 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US7846439B2 (en) | Domain antibody construct | |
JP2009525031A5 (en) | ||
US7981414B2 (en) | Anti-inflammatory dAb | |
ES2387312T3 (en) | Stabilized human IgG4 antibodies | |
US20080095767A1 (en) | Engineered antibodies with new world primate framework regions | |
EP3216804A2 (en) | Anti-cd25 antibodies and their uses | |
US20080255343A1 (en) | Chimeric antibodies | |
AU2006281981A1 (en) | Chimeric antibodies with new world primate regions | |
WO2008092209A1 (en) | Protein construct with improved properties | |
NZ569405A (en) | Anti-inflammatory domain antibody binding to TNF-alpha | |
MX2008008029A (en) | Anti-inflammatory dab | |
MX2008002162A (en) | Engineered antibodies with new world primate framework regions |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |