US20150273044A1 - Methods of inducing an immune response with compositions comprising a neisseria meningitidis 741 protein - Google Patents
Methods of inducing an immune response with compositions comprising a neisseria meningitidis 741 protein Download PDFInfo
- Publication number
- US20150273044A1 US20150273044A1 US14/739,985 US201514739985A US2015273044A1 US 20150273044 A1 US20150273044 A1 US 20150273044A1 US 201514739985 A US201514739985 A US 201514739985A US 2015273044 A1 US2015273044 A1 US 2015273044A1
- Authority
- US
- United States
- Prior art keywords
- protein
- seq
- proteins
- amino acid
- acid sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 108090000623 proteins and genes Proteins 0.000 title claims abstract description 186
- 102000004169 proteins and genes Human genes 0.000 title claims abstract description 182
- 239000000203 mixture Substances 0.000 title claims description 50
- 238000000034 method Methods 0.000 title claims description 24
- 230000028993 immune response Effects 0.000 title claims description 8
- 230000001939 inductive effect Effects 0.000 title claims 3
- 241000588650 Neisseria meningitidis Species 0.000 title description 7
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 17
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 claims abstract description 15
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 14
- 229920001184 polypeptide Polymers 0.000 claims abstract description 11
- 125000001433 C-terminal amino-acid group Chemical group 0.000 claims abstract description 5
- 125000001429 N-terminal alpha-amino-acid group Chemical group 0.000 claims abstract description 5
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract 4
- 150000001413 amino acids Chemical class 0.000 claims description 39
- 239000002671 adjuvant Substances 0.000 claims description 28
- ILRRQNADMUWWFW-UHFFFAOYSA-K aluminium phosphate Chemical compound O1[Al]2OP1(=O)O2 ILRRQNADMUWWFW-UHFFFAOYSA-K 0.000 claims description 11
- AZDRQVAHHNSJOQ-UHFFFAOYSA-N alumane Chemical class [AlH3] AZDRQVAHHNSJOQ-UHFFFAOYSA-N 0.000 claims 13
- 229940047712 aluminum hydroxyphosphate Drugs 0.000 claims 1
- 241001212279 Neisseriales Species 0.000 abstract description 10
- 235000018102 proteins Nutrition 0.000 description 167
- 108091007433 antigens Proteins 0.000 description 43
- 102000036639 antigens Human genes 0.000 description 43
- 239000000427 antigen Substances 0.000 description 39
- 229960005486 vaccine Drugs 0.000 description 26
- 239000000872 buffer Substances 0.000 description 21
- 150000007523 nucleic acids Chemical class 0.000 description 21
- 235000001014 amino acid Nutrition 0.000 description 18
- 108020004707 nucleic acids Proteins 0.000 description 17
- 102000039446 nucleic acids Human genes 0.000 description 17
- 230000000844 anti-bacterial effect Effects 0.000 description 16
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 15
- 239000000463 material Substances 0.000 description 15
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 14
- 239000012528 membrane Substances 0.000 description 14
- 239000012634 fragment Substances 0.000 description 13
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 12
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 11
- 150000001720 carbohydrates Chemical class 0.000 description 10
- 210000004027 cell Anatomy 0.000 description 10
- 241000588653 Neisseria Species 0.000 description 9
- 108010076504 Protein Sorting Signals Proteins 0.000 description 9
- 239000003814 drug Substances 0.000 description 9
- XLYOFNOQVPJJNP-UHFFFAOYSA-M hydroxide Chemical compound [OH-] XLYOFNOQVPJJNP-UHFFFAOYSA-M 0.000 description 9
- 210000003000 inclusion body Anatomy 0.000 description 9
- 238000000746 purification Methods 0.000 description 9
- 108010094020 polyglycine Proteins 0.000 description 8
- 239000011780 sodium chloride Substances 0.000 description 8
- 239000006228 supernatant Substances 0.000 description 8
- 238000002965 ELISA Methods 0.000 description 7
- 241000699670 Mus sp. Species 0.000 description 7
- 238000005119 centrifugation Methods 0.000 description 7
- 238000012217 deletion Methods 0.000 description 7
- 230000037430 deletion Effects 0.000 description 7
- 238000003556 assay Methods 0.000 description 6
- NTNWOCRCBQPEKQ-YFKPBYRVSA-N N(omega)-methyl-L-arginine Chemical compound CN=C(N)NCCC[C@H](N)C(O)=O NTNWOCRCBQPEKQ-YFKPBYRVSA-N 0.000 description 5
- 241000588677 Neisseria meningitidis serogroup B Species 0.000 description 5
- 201000005702 Pertussis Diseases 0.000 description 5
- 206010043376 Tetanus Diseases 0.000 description 5
- 238000013459 approach Methods 0.000 description 5
- 238000000502 dialysis Methods 0.000 description 5
- 206010013023 diphtheria Diseases 0.000 description 5
- 229960004198 guanidine Drugs 0.000 description 5
- PJJJBBJSCAKJQF-UHFFFAOYSA-N guanidinium chloride Chemical compound [Cl-].NC(N)=[NH2+] PJJJBBJSCAKJQF-UHFFFAOYSA-N 0.000 description 5
- 238000002649 immunization Methods 0.000 description 5
- 230000002163 immunogen Effects 0.000 description 5
- 229940035032 monophosphoryl lipid a Drugs 0.000 description 5
- 239000004627 regenerated cellulose Substances 0.000 description 5
- 239000001488 sodium phosphate Substances 0.000 description 5
- 229910000162 sodium phosphate Inorganic materials 0.000 description 5
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 5
- 238000000108 ultra-filtration Methods 0.000 description 5
- 102000014914 Carrier Proteins Human genes 0.000 description 4
- 108010078791 Carrier Proteins Proteins 0.000 description 4
- 241000588724 Escherichia coli Species 0.000 description 4
- -1 Linker amino acid Chemical group 0.000 description 4
- 241000124008 Mammalia Species 0.000 description 4
- 241000588652 Neisseria gonorrhoeae Species 0.000 description 4
- 108091028043 Nucleic acid sequence Proteins 0.000 description 4
- 101000626900 Trieres chinensis Uncharacterized 5.5 kDa protein in ccsA-rps6 intergenic region Proteins 0.000 description 4
- 229940037003 alum Drugs 0.000 description 4
- 210000004899 c-terminal region Anatomy 0.000 description 4
- 239000003153 chemical reaction reagent Substances 0.000 description 4
- 238000010367 cloning Methods 0.000 description 4
- PRAKJMSDJKAYCZ-UHFFFAOYSA-N dodecahydrosqualene Natural products CC(C)CCCC(C)CCCC(C)CCCCC(C)CCCC(C)CCCC(C)C PRAKJMSDJKAYCZ-UHFFFAOYSA-N 0.000 description 4
- 239000002245 particle Substances 0.000 description 4
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 4
- 230000000069 prophylactic effect Effects 0.000 description 4
- 239000013598 vector Substances 0.000 description 4
- 108010039939 Cell Wall Skeleton Proteins 0.000 description 3
- 108020004414 DNA Proteins 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 108091034117 Oligonucleotide Proteins 0.000 description 3
- 229910019142 PO4 Inorganic materials 0.000 description 3
- 101000870438 Streptococcus gordonii UDP-N-acetylglucosamine-peptide N-acetylglucosaminyltransferase stabilizing protein GtfB Proteins 0.000 description 3
- 101100038645 Streptomyces griseus rppA gene Proteins 0.000 description 3
- 101000645119 Vibrio campbellii (strain ATCC BAA-1116 / BB120) Nucleotide-binding protein VIBHAR_03667 Proteins 0.000 description 3
- 241000700605 Viruses Species 0.000 description 3
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 3
- 229910021502 aluminium hydroxide Inorganic materials 0.000 description 3
- 229940001007 aluminium phosphate Drugs 0.000 description 3
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 3
- 210000004520 cell wall skeleton Anatomy 0.000 description 3
- CTMZLDSMFCVUNX-VMIOUTBZSA-N cytidylyl-(3'->5')-guanosine Chemical group O=C1N=C(N)C=CN1[C@H]1[C@H](O)[C@H](OP(O)(=O)OC[C@@H]2[C@H]([C@@H](O)[C@@H](O2)N2C3=C(C(N=C(N)N3)=O)N=C2)O)[C@@H](CO)O1 CTMZLDSMFCVUNX-VMIOUTBZSA-N 0.000 description 3
- 239000000839 emulsion Substances 0.000 description 3
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 3
- 239000003022 immunostimulating agent Substances 0.000 description 3
- 230000003308 immunostimulating effect Effects 0.000 description 3
- 208000015181 infectious disease Diseases 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 239000008188 pellet Substances 0.000 description 3
- 239000010452 phosphate Substances 0.000 description 3
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 3
- 229920000053 polysorbate 80 Polymers 0.000 description 3
- 230000002265 prevention Effects 0.000 description 3
- 239000001397 quillaja saponaria molina bark Substances 0.000 description 3
- 229930182490 saponin Natural products 0.000 description 3
- 150000007949 saponins Chemical class 0.000 description 3
- 239000000126 substance Substances 0.000 description 3
- YYGNTYWPHWGJRM-UHFFFAOYSA-N (6E,10E,14E,18E)-2,6,10,15,19,23-hexamethyltetracosa-2,6,10,14,18,22-hexaene Chemical compound CC(C)=CCCC(C)=CCCC(C)=CCCC=C(C)CCC=C(C)CCC=C(C)C YYGNTYWPHWGJRM-UHFFFAOYSA-N 0.000 description 2
- 241000588832 Bordetella pertussis Species 0.000 description 2
- 241000606768 Haemophilus influenzae Species 0.000 description 2
- 108010065805 Interleukin-12 Proteins 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- 102000007651 Macrophage Colony-Stimulating Factor Human genes 0.000 description 2
- 108010046938 Macrophage Colony-Stimulating Factor Proteins 0.000 description 2
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 2
- 108700020354 N-acetylmuramyl-threonyl-isoglutamine Proteins 0.000 description 2
- 241000588654 Neisseria cinerea Species 0.000 description 2
- 241000588649 Neisseria lactamica Species 0.000 description 2
- 241000921898 Neisseria meningitidis serogroup A Species 0.000 description 2
- 108091093037 Peptide nucleic acid Proteins 0.000 description 2
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 2
- 241000193985 Streptococcus agalactiae Species 0.000 description 2
- BHEOSNUKNHRBNM-UHFFFAOYSA-N Tetramethylsqualene Natural products CC(=C)C(C)CCC(=C)C(C)CCC(C)=CCCC=C(C)CCC(C)C(=C)CCC(C)C(C)=C BHEOSNUKNHRBNM-UHFFFAOYSA-N 0.000 description 2
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 2
- NWMHDZMRVUOQGL-CZEIJOLGSA-N almurtide Chemical compound OC(=O)CC[C@H](C(N)=O)NC(=O)[C@H](C)NC(=O)CO[C@@H]([C@H](O)[C@H](O)CO)[C@@H](NC(C)=O)C=O NWMHDZMRVUOQGL-CZEIJOLGSA-N 0.000 description 2
- 159000000013 aluminium salts Chemical class 0.000 description 2
- 229910000329 aluminium sulfate Inorganic materials 0.000 description 2
- 230000001580 bacterial effect Effects 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- 210000002421 cell wall Anatomy 0.000 description 2
- 239000003795 chemical substances by application Substances 0.000 description 2
- 238000004587 chromatography analysis Methods 0.000 description 2
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Chemical compound NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 description 2
- 229960003983 diphtheria toxoid Drugs 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 150000002148 esters Chemical class 0.000 description 2
- 239000013604 expression vector Substances 0.000 description 2
- 238000009472 formulation Methods 0.000 description 2
- 230000005847 immunogenicity Effects 0.000 description 2
- 230000004957 immunoregulator effect Effects 0.000 description 2
- 238000003780 insertion Methods 0.000 description 2
- 230000037431 insertion Effects 0.000 description 2
- 229930182817 methionine Natural products 0.000 description 2
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 2
- JMUHBNWAORSSBD-WKYWBUFDSA-N mifamurtide Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@@H](OC(=O)CCCCCCCCCCCCCCC)COP(O)(=O)OCCNC(=O)[C@H](C)NC(=O)CC[C@H](C(N)=O)NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@H]1[C@H](O)[C@@H](CO)OC(O)[C@@H]1NC(C)=O JMUHBNWAORSSBD-WKYWBUFDSA-N 0.000 description 2
- 229960005225 mifamurtide Drugs 0.000 description 2
- 125000001446 muramyl group Chemical group N[C@@H](C=O)[C@@H](O[C@@H](C(=O)*)C)[C@H](O)[C@H](O)CO 0.000 description 2
- 239000007764 o/w emulsion Substances 0.000 description 2
- 229920002113 octoxynol Polymers 0.000 description 2
- 229940066429 octoxynol Drugs 0.000 description 2
- 229920001542 oligosaccharide Polymers 0.000 description 2
- 150000002482 oligosaccharides Chemical class 0.000 description 2
- 210000001322 periplasm Anatomy 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 239000012064 sodium phosphate buffer Substances 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 229940031439 squalene Drugs 0.000 description 2
- TUHBEKDERLKLEC-UHFFFAOYSA-N squalene Natural products CC(=CCCC(=CCCC(=CCCC=C(/C)CCC=C(/C)CC=C(C)C)C)C)C TUHBEKDERLKLEC-UHFFFAOYSA-N 0.000 description 2
- 239000004094 surface-active agent Substances 0.000 description 2
- 230000032258 transport Effects 0.000 description 2
- XETCRXVKJHBPMK-MJSODCSWSA-N trehalose 6,6'-dimycolate Chemical compound C([C@@H]1[C@H]([C@H](O)[C@@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](COC(=O)C(CCCCCCCCCCC3C(C3)CCCCCCCCCCCCCCCCCC)C(O)CCCCCCCCCCCCCCCCCCCCCCCCC)O2)O)O1)O)OC(=O)C(C(O)CCCCCCCCCCCCCCCCCCCCCCCCC)CCCCCCCCCCC1CC1CCCCCCCCCCCCCCCCCC XETCRXVKJHBPMK-MJSODCSWSA-N 0.000 description 2
- 102000003390 tumor necrosis factor Human genes 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- HDTRYLNUVZCQOY-UHFFFAOYSA-N α-D-glucopyranosyl-α-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OC1C(O)C(O)C(O)C(CO)O1 HDTRYLNUVZCQOY-UHFFFAOYSA-N 0.000 description 1
- YHQZWWDVLJPRIF-JLHRHDQISA-N (4R)-4-[[(2S,3R)-2-[acetyl-[(3R,4R,5S,6R)-3-amino-4-[(1R)-1-carboxyethoxy]-5-hydroxy-6-(hydroxymethyl)oxan-2-yl]amino]-3-hydroxybutanoyl]amino]-5-amino-5-oxopentanoic acid Chemical compound C(C)(=O)N([C@@H]([C@H](O)C)C(=O)N[C@H](CCC(=O)O)C(N)=O)C1[C@H](N)[C@@H](O[C@@H](C(=O)O)C)[C@H](O)[C@H](O1)CO YHQZWWDVLJPRIF-JLHRHDQISA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- PXFBZOLANLWPMH-UHFFFAOYSA-N 16-Epiaffinine Natural products C1C(C2=CC=CC=C2N2)=C2C(=O)CC2C(=CC)CN(C)C1C2CO PXFBZOLANLWPMH-UHFFFAOYSA-N 0.000 description 1
- LRSASMSXMSNRBT-UHFFFAOYSA-N 5-methylcytosine Chemical compound CC1=CNC(=O)N=C1N LRSASMSXMSNRBT-UHFFFAOYSA-N 0.000 description 1
- 244000063299 Bacillus subtilis Species 0.000 description 1
- 235000014469 Bacillus subtilis Nutrition 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 231100000699 Bacterial toxin Toxicity 0.000 description 1
- 101100039010 Caenorhabditis elegans dis-3 gene Proteins 0.000 description 1
- 101100181929 Caenorhabditis elegans lin-3 gene Proteins 0.000 description 1
- 241001647372 Chlamydia pneumoniae Species 0.000 description 1
- 241000606153 Chlamydia trachomatis Species 0.000 description 1
- 241000193163 Clostridioides difficile Species 0.000 description 1
- 102100031725 Cortactin-binding protein 2 Human genes 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 102100037840 Dehydrogenase/reductase SDR family member 2, mitochondrial Human genes 0.000 description 1
- 102000016911 Deoxyribonucleases Human genes 0.000 description 1
- 108010053770 Deoxyribonucleases Proteins 0.000 description 1
- 108010016626 Dipeptides Proteins 0.000 description 1
- BCCRXDTUTZHDEU-VKHMYHEASA-N Gly-Ser Chemical compound NCC(=O)N[C@@H](CO)C(O)=O BCCRXDTUTZHDEU-VKHMYHEASA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 206010018612 Gonorrhoea Diseases 0.000 description 1
- 101150029115 HOPX gene Proteins 0.000 description 1
- 102000002812 Heat-Shock Proteins Human genes 0.000 description 1
- 108010004889 Heat-Shock Proteins Proteins 0.000 description 1
- 241000590002 Helicobacter pylori Species 0.000 description 1
- 241000711549 Hepacivirus C Species 0.000 description 1
- 241000700721 Hepatitis B virus Species 0.000 description 1
- 241000709721 Hepatovirus A Species 0.000 description 1
- 108010002231 IgA-specific serine endopeptidase Proteins 0.000 description 1
- 102000008070 Interferon-gamma Human genes 0.000 description 1
- 108010074328 Interferon-gamma Proteins 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 108010002352 Interleukin-1 Proteins 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 108090000978 Interleukin-4 Proteins 0.000 description 1
- 108010002616 Interleukin-5 Proteins 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 108010002586 Interleukin-7 Proteins 0.000 description 1
- 108010063738 Interleukins Proteins 0.000 description 1
- 102000015696 Interleukins Human genes 0.000 description 1
- 201000005505 Measles Diseases 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 201000009906 Meningitis Diseases 0.000 description 1
- 206010027202 Meningitis bacterial Diseases 0.000 description 1
- 241000588655 Moraxella catarrhalis Species 0.000 description 1
- WPNJAUFVNXKLIM-UHFFFAOYSA-N Moxonidine Chemical compound COC1=NC(C)=NC(Cl)=C1NC1=NCCN1 WPNJAUFVNXKLIM-UHFFFAOYSA-N 0.000 description 1
- 208000005647 Mumps Diseases 0.000 description 1
- 102000016943 Muramidase Human genes 0.000 description 1
- 108010014251 Muramidase Proteins 0.000 description 1
- 101100476480 Mus musculus S100a8 gene Proteins 0.000 description 1
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 1
- 108700015872 N-acetyl-nor-muramyl-L-alanyl-D-isoglutamine Proteins 0.000 description 1
- 241001174901 Neisseria meningitidis alpha275 Species 0.000 description 1
- 101100459189 Neisseria meningitidis serogroup B (strain MC58) mutS gene Proteins 0.000 description 1
- 241000947238 Neisseria meningitidis serogroup C Species 0.000 description 1
- 241001573069 Neisseria meningitidis serogroup Y Species 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 102000005348 Neuraminidase Human genes 0.000 description 1
- 108010006232 Neuraminidase Proteins 0.000 description 1
- 108020004485 Nonsense Codon Proteins 0.000 description 1
- 101150075249 ORF40 gene Proteins 0.000 description 1
- 101710116435 Outer membrane protein Proteins 0.000 description 1
- 101100156835 Paenarthrobacter nicotinovorans xdh gene Proteins 0.000 description 1
- 108010081690 Pertussis Toxin Proteins 0.000 description 1
- 208000000474 Poliomyelitis Diseases 0.000 description 1
- 229920000954 Polyglycolide Polymers 0.000 description 1
- 241000605862 Porphyromonas gingivalis Species 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 101710093543 Probable non-specific lipid-transfer protein Proteins 0.000 description 1
- 101710197985 Probable protein Rev Proteins 0.000 description 1
- 101710188053 Protein D Proteins 0.000 description 1
- 206010037742 Rabies Diseases 0.000 description 1
- 101710132893 Resolvase Proteins 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 241000293871 Salmonella enterica subsp. enterica serovar Typhi Species 0.000 description 1
- 229920002684 Sepharose Polymers 0.000 description 1
- 206010040047 Sepsis Diseases 0.000 description 1
- 101710084578 Short neurotoxin 1 Proteins 0.000 description 1
- PRXRUNOAOLTIEF-ADSICKODSA-N Sorbitan trioleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@@H](OC(=O)CCCCCCC\C=C/CCCCCCCC)[C@H]1OC[C@H](O)[C@H]1OC(=O)CCCCCCC\C=C/CCCCCCCC PRXRUNOAOLTIEF-ADSICKODSA-N 0.000 description 1
- 241000191967 Staphylococcus aureus Species 0.000 description 1
- 229930182558 Sterol Natural products 0.000 description 1
- 241000193998 Streptococcus pneumoniae Species 0.000 description 1
- 241000193996 Streptococcus pyogenes Species 0.000 description 1
- 241001505901 Streptococcus sp. 'group A' Species 0.000 description 1
- 241000193990 Streptococcus sp. 'group B' Species 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 1
- 101710182223 Toxin B Proteins 0.000 description 1
- 101710182532 Toxin a Proteins 0.000 description 1
- 102000010912 Transferrin-Binding Proteins Human genes 0.000 description 1
- 108010062476 Transferrin-Binding Proteins Proteins 0.000 description 1
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 108010046334 Urease Proteins 0.000 description 1
- 241000607626 Vibrio cholerae Species 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- 150000005215 alkyl ethers Chemical class 0.000 description 1
- HDTRYLNUVZCQOY-LIZSDCNHSA-N alpha,alpha-trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 description 1
- 239000004411 aluminium Substances 0.000 description 1
- 229910052782 aluminium Inorganic materials 0.000 description 1
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 1
- 235000010210 aluminium Nutrition 0.000 description 1
- 230000000692 anti-sense effect Effects 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 201000009904 bacterial meningitis Diseases 0.000 description 1
- 239000000688 bacterial toxin Substances 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 229940038705 chlamydia trachomatis Drugs 0.000 description 1
- 238000010961 commercial manufacture process Methods 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 229940031670 conjugate vaccine Drugs 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 229920001577 copolymer Polymers 0.000 description 1
- 229940104302 cytosine Drugs 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 239000003599 detergent Substances 0.000 description 1
- 238000001784 detoxification Methods 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 230000037433 frameshift Effects 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 229940044627 gamma-interferon Drugs 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 150000004676 glycans Chemical class 0.000 description 1
- 229940047650 haemophilus influenzae Drugs 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 229940037467 helicobacter pylori Drugs 0.000 description 1
- 229930186900 holotoxin Natural products 0.000 description 1
- 238000000265 homogenisation Methods 0.000 description 1
- 210000004201 immune sera Anatomy 0.000 description 1
- 229940042743 immune sera Drugs 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 229960001438 immunostimulant agent Drugs 0.000 description 1
- 206010022000 influenza Diseases 0.000 description 1
- 229940047124 interferons Drugs 0.000 description 1
- 229940047122 interleukins Drugs 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 239000004325 lysozyme Substances 0.000 description 1
- 229960000274 lysozyme Drugs 0.000 description 1
- 235000010335 lysozyme Nutrition 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 229910001629 magnesium chloride Inorganic materials 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 230000001459 mortal effect Effects 0.000 description 1
- 208000010805 mumps infectious disease Diseases 0.000 description 1
- JXTPJDDICSTXJX-UHFFFAOYSA-N n-Triacontane Natural products CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC JXTPJDDICSTXJX-UHFFFAOYSA-N 0.000 description 1
- 101150103157 nmb gene Proteins 0.000 description 1
- 239000002736 nonionic surfactant Substances 0.000 description 1
- 239000006179 pH buffering agent Substances 0.000 description 1
- 108010021711 pertactin Proteins 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 229940051841 polyoxyethylene ether Drugs 0.000 description 1
- 229920000056 polyoxyethylene ether Polymers 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 235000004252 protein component Nutrition 0.000 description 1
- 108020001580 protein domains Proteins 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 201000005404 rubella Diseases 0.000 description 1
- 239000000523 sample Substances 0.000 description 1
- BHPKMBDCWXHRQT-UHFFFAOYSA-N saponin e Chemical compound OC1C(O)C(O)C(C)OC1OC1C(O)C(OC2C(C3C(C4C(C5(CC(=O)OC5)C(C5C(O5)(C)CC(O)C=C(C)C)CC4)(C)CC3)(C)CC2)(C)C)OC(CO)C1O BHPKMBDCWXHRQT-UHFFFAOYSA-N 0.000 description 1
- 238000010845 search algorithm Methods 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 238000000527 sonication Methods 0.000 description 1
- 238000001179 sorption measurement Methods 0.000 description 1
- 229940032094 squalane Drugs 0.000 description 1
- 150000003432 sterols Chemical class 0.000 description 1
- 235000003702 sterols Nutrition 0.000 description 1
- 229940031000 streptococcus pneumoniae Drugs 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 229910021653 sulphate ion Inorganic materials 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 101150101515 tbpl2 gene Proteins 0.000 description 1
- 229960000814 tetanus toxoid Drugs 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 201000008827 tuberculosis Diseases 0.000 description 1
- 238000010396 two-hybrid screening Methods 0.000 description 1
- 229940118696 vibrio cholerae Drugs 0.000 description 1
- 238000009736 wetting Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
- A61K39/095—Neisseria
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/22—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Neisseriaceae (F)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/53—DNA (RNA) vaccination
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55505—Inorganic adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- This invention is in the field of protein expression.
- it relates to the expression of proteins from Neisseria (e.g. N. gonorrhoeae or, preferably, N. meningitidis ).
- References 1 and 2 disclose alternative and improved approaches for the expression of the Neisserial proteins disclosed in references 3 to 6.
- One such method is to produce ‘hybrid’ proteins in which two or more Neisserial proteins are expressed as a single polypeptide chain.
- This approach offers two advantages. First, a protein that may be unstable or poorly expressed on its own can be assisted by adding a suitable hybrid partner that overcomes the problem. Second, commercial manufacture is simplified as only one expression and purification need be employed in order to produce two separately-useful proteins.
- the invention provides a method for the simultaneous expression of two or more (e.g. 3, 4, 5, 6 or more) Neisserial proteins, in which said two or more proteins are joined such that they are translated as a single polypeptide chain.
- the hybrid proteins of the invention can be represented by the formula: NH 2 -A-[—X-L-] n -B—COOH wherein X is an amino acid sequence, L is an optional linker amino acid sequence, A is an optional N-terminal amino acid sequence, B is an optional C-terminal amino acid sequence, and n is an integer greater than 1.
- n is between 2 and x, and the value of x is typically 3, 4, 5, 6, 7, 8, 9 or 10.
- each ⁇ X ⁇ moiety is:
- a preferred subset of (a) is: orf46.1, 230, 287, 741, 919, 936, 953, 961 and 983.
- a more preferred subset of (a) is: orf46.1, 287, 741 and 961.
- FIG. 3 shows preferred hybrid proteins.
- the hybrid protein comprises a first —X— moiety (—X a —) and a second —X— moiety (—X b —).
- the —X a — moiety has one of the following amino acid sequences:
- the —X b — moiety is related to —X a — such that: (i) —X b — has sequence identity to 13 X a —, and/or (j) —X b — comprises a fragment of —X a —.
- this second type of hybrid protein examples include proteins in which two or more —X— moieties are identical, or in which they are variants of the same protein e.g. two polymorphic forms of the same protein may be expressed as —X a —X b —, and three polymorphic forms may be expressed as —X a —X b —X a — etc.
- —X a — and —X b — moieties may be in either order from N-terminus to C-terminus.
- the —X a — moiety is preferably an orf1, orf4, orf25, orf40, orf46.1, orf83, NMB1343, 230, 233, 287, 292, 594, 687, 736, 741, 907, 919, 936, 953, 961 or 983 amino acid sequence.
- the —X a — moiety is more preferably an orf46.1, 230, 287, 741, 919, 936, 953, 961 or 983 amino acid sequence.
- the —X a — moiety is most preferably an orf46.1, 287, 741 or 961 amino acid sequence.
- the degree of ‘sequence identity’ referred to in (b) and (i) is preferably greater than 50% (eg. 60%, 70%, 80%, 90%, 95%, 99% or more, up to 100%). This includes mutants, homologs, orthologs, allelic variants etc. [e.g. see ref. 8].
- fragment referred to in (c) and (j) should consist of least m consecutive amino acids from an amino acid sequence from (a), (d), (e), (f), (g) or (h) and, depending on the particular sequence, m is 7 or more (eg. 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200 or more).
- the fragment comprises an epitope from an amino acid sequence from (a), (d), (e), (t), (g) or (h).
- Preferred fragments are those disclosed in references 9 and 10.
- Preferred (c) and (j) fragments are C- and/or N-terminal truncations (e.g. ⁇ 1-287, A2-287 etc.).
- Poly-glycine sequences can be represented as (Gly) g , where g>3 (e.g. 4, 5, 6, 7, 8, 9 or more). If a —X— moiety includes a poly-glycine sequence in its wild-type form, it is preferred to omit this sequence in the hybrid proteins of the invention. This may be by disrupting or removing the (Gly) g —by deletion (e.g. CGGGGS ⁇ CGGGS, CGGS, CGS or CS), by substitution (e.g.
- Preferred (c) and (j) fragments omit complete protein domains. This is particularly useful for protein 961, 287, and ORF46. Once a protein has been notional divided into domains, (c) and (j) fragments can omit one or more of these domains (e.g. 287B, 287C, 287BC, ORF46 1-433 , ORF46 434-608 , 961c— reference 2; FIGS. 4 and 5 herein).
- 287 protein has been notionally split into three domains, referred to as A, B & C (see FIG. 5 of reference 2).
- Domain B aligns with IgA proteases
- domain C aligns with transferrin-binding proteins
- domain A shows no strong alignment with database sequences.
- An alignment of polymorphic forms of 287 is disclosed in reference 8.
- ORF46 has been notionally split into two domains—a first domain (amino acids 1-433; ORF46.1) which is well-conserved between species and serogroups, and a second domain (amino acids 434-608) which is not well-conserved.
- the second domain is preferably deleted, leaving ORF46.1.
- An alignment of polymorphic forms of ORF46 is disclosed in reference 8.
- 961 protein has been notionally split into several domains ( FIG. 4 ).
- a —X— moiety has a leader peptide sequence in its wild-type form, this may be included or omitted in the hybrid proteins of the invention. Where the leader peptide is omitted, this is a preferred example of an amino acid sequence within (c) and (j).
- the leader peptides will be deleted except for that of the —X— moiety located at the N-terminus of the hybrid protein i.e. the leader peptide of X 1 will be retained, but the leader peptides of X 2 . . . X n will be omitted. This is equivalent to deleting all leader peptides and using the leader peptide of X 1 as moiety -A-.
- preferred pairs of —X— moieties are: ⁇ G287 and 230; ⁇ G287 and 936; ⁇ G287 and 741; 961c and 287; 961c and 230; 961c and 936; 961cL and 287; 961cL and 230; 961cL and 936; ORF46.1 and 936; ORF46.1 and 230; 230 and 961; 230 and 741; 936 and 961; 936 and 741.
- 287 is used in full-length form, it is preferably at the C-terminal end of a hybrid protein; if it is to be used at the N-terminus, if is preferred to use a ⁇ G form of 287.
- 741 is used in full-length form, it is preferably at the C-terminal end of a hybrid protein; if it is to be used at the N-terminus, if is preferred to use a ⁇ G form of 741.
- linker amino acid sequence -L- may be present or absent.
- the hybrid may be NH 2 —X 1 -L 1 -X 2 -L 2 -COOH, NH 2 —X 1 —X 2 —COOH, NH 2 —X 1 -L 1 -X 2 —COOH, NH 2 —X 1 —X 2 -L 2 -COOH, etc.
- a useful linker is GSGGGG (SEQ ID 27), with the Gly-Ser dipeptide being formed from a BamHI restriction site, thus aiding cloning and manipulation, and the Gly 4 tetrapeptide being a typical poly-glycine linker.
- X n+1 is a ⁇ G protein and L n is a glycine linker, this may be equivalent to X n+1 not being a ⁇ G protein and L n being absent.
- the invention can use amino acid sequences from any strains of N. meningitidis. References to a particular protein (e.g. ‘287’, or ‘ORF46.1’) therefore include that protein from any strain. Sequence variations between strains are included within (b), (c), (i) and (j).
- Reference sequences from N. meningitidis serogroup B include:
- Reference 8 discloses polymorphic forms of proteins ORF4, ORF40, ORF46, 225, 235, 287, 519, 726, 919 and 953. Polymorphic forms of 961 are disclosed in references 11 & 12. Any of these polymorphic forms may be used in accordance with the present invention.
- sequence listing herein includes polymorphic forms of proteins 741 (SEQ IDs 1-22) and NMB 1343 (SEQ IDs 23-24) which have been identified.
- Preferred proteins of the invention comprise —X— moieties having an amino acid sequence found in N. meningitidis serogroup B.
- preferred —X— moieties are from strains 2996, MC58, 95N477, or 394/98.
- Strain 95N477 is sometimes referred to herein as ‘ET37’, this being its electrophoretic type.
- Strain 394/98 is sometimes referred to herein as ‘nz’, as it is a New Zealand strain.
- this is preferably from strain 2996 or from strain 394/98.
- this is preferably from serogroup B strains MC58, 2996, 394/98, or 95N477, or from serogroup C strain 90/18311.
- this is preferably from strain 2996.
- Strains are indicated as a subscript e.g. 741 MC58 is protein 741 from strain MC58. Unless otherwise stated, proteins mentioned herein (e.g. with no subscript) are from N. meningitidis strain 2996, which can be taken as a ‘reference’ strain. It will be appreciated, however, that the invention is not in general limited by strain. As mentioned above, general references to a protein (e.g. ‘287’, ‘919’ etc.) may be taken to include that protein from any strain. This will typically have sequence identity to 2996 of 90% or more (eg. 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more).
- References 1 and 2 disclose how a protein can be notionally divided into domains and how the protein can be manipulated based on these domains.
- the present invention extends the application of this approach to protein 961 (also known as ‘NadA’ [11,12]).
- NadA has 405 amino acids. This protein has notionally been divided into the following nine domains ( FIG. 4 ):
- This information can be used to locate the same domains in other forms of 961.
- fragments are preferred (c) and (j) fragments, but they may also be expressed in their own right i.e. not in the form of a hybrid protein of the invention.
- the invention provides a protein comprising one of these fragments, providing that the protein is not full-length 961 and is not a protein specifically disclosed in reference 1 or 2.
- This protein may be a fusion protein (e.g. a GST-fusion or a His-tag fusion).
- the invention also provides a protein having an amino acid sequence from SEQ IDs 1 to 24. It also provides proteins and nucleic acid having sequence identity to these. As described above, the degree of ‘sequence identity’ is preferably greater than 50% (eg. 60%, 70%, 80%, 90%, 95%, 99% or more).
- the invention also provides nucleic acid encoding such proteins.
- nucleic acid which can hybridise to this nucleic acid, preferably under “high stringency” conditions (eg. 65° C. in a 0.1 ⁇ SSC, 0.5% SDS solution).
- the invention also provides nucleic acid encoding proteins according to the invention.
- nucleic acid comprising sequences complementary to those described above (eg. for antisense or probing purposes).
- Nucleic acid according to the invention can, of course, be prepared in many ways (eg. by chemical synthesis, from genomic or cDNA libraries, from the organism itself etc.) and can take various forms (eg. single stranded, double stranded, vectors, probes etc.).
- nucleic acid includes DNA and RNA, and also their analogues, such as those containing modified backbones, and also peptide nucleic acids (PNA) etc.
- PNA peptide nucleic acids
- the invention also provides a composition comprising two or more (i.e. 2, 3, 4, 5, 6 or 7) of the following proteins:
- the mixture may include one or both of the following proteins, either in combination with two or more of (1) to (7), or in combination with only one of (1) to (7):
- proteins 287 and 741 are included in the mixture (i.e. in protein 1, 2, 5, 6, 7 or 8), they may be in the ‘ ⁇ G’ form. Where protein 961 is included, it is preferably in the form of ‘961c’ in which the N-terminus leader and C-terminus membrane anchor are absent [e.g. see refs. 1, 2 & 11].
- a preferred mixture comprises the following three proteins:
- the mixtures may also comprise N. meningitidis outer membrane vesicles.
- heterologous host Whilst expression of the proteins of the invention may take place in Neisseria, the present invention preferably utilises a heterologous host.
- the heterologous host may be prokaryotic (e.g. a bacterium) or eukaryotic. It is preferably E. coli, but other suitable hosts include Bacillus subtilis, Vibrio cholerae, Salmonella typhi, Salmonenna typhimurium, Neisseria lactamica, Neisseria cinerea, Mycobacteria (e.g. M. tuberculosis ), yeast etc.
- the invention provides (a) nucleic acid encoding the proteins described above (b) vectors comprising these nucleic acid sequences (c) host cells containing said vectors (d) compositions comprising the proteins or nucleic acids of the invention, which may be suitable as immunogenic compositions (e.g. vaccines) or as diagnostic reagents (e) these compositions for use as medicaments (e.g.
- compositions for treating or preventing infection due to Neisserial bacteria
- diagnostic reagent for detecting the presence of Neisserial bacteria or of antibodies raised against Neisseria bacteria
- a reagent which can raise antibodies against Neisseria bacteria for detecting the presence of Neisserial bacteria or of antibodies raised against Neisseria bacteria
- a method of treating a patient comprising administering to the patient a therapeutically effective amount of these compositions.
- Implementing the invention will typically involve the basic steps of: obtaining a first nucleic acid encoding a first protein; obtaining a second nucleic acid encoding a second protein; and ligating the first and second nucleic acids.
- the resulting nucleic acid may be inserted into an expression vector, or may already be part of an expression vector.
- purification of hybrid proteins may involve the refolding techniques disclosed herein.
- compositions of the invention are preferably immunogenic composition, and are more preferably vaccine compositions.
- the pH of the composition is preferably between 6 and 7.
- the pH may be maintained by the use of a buffer.
- the composition may be sterile.
- Vaccines according to the invention may either be prophylactic (i.e. to prevent infection) or therapeutic (i.e. to treat infection), but will typically be prophylactic.
- the invention also provides a composition of the invention for use as a medicament.
- the medicament is preferably able to raise an immune response in a mammal (i.e. it is an immunogenic composition) and is more preferably a vaccine.
- the invention also provides the use of a composition of the invention in the manufacture of a medicament for raising an immune response in a mammal.
- the medicament is preferably a vaccine.
- the invention also provides a method for raising an immune response in a mammal comprising the step of administering an effective amount of a composition of the invention.
- the immune response is preferably protective.
- the method may raise a booster response.
- the mammal is preferably a human.
- the human is preferably a child (e.g. a toddler or infant); where the vaccine is for prophylactic use, the human is preferably an adult.
- a vaccine intended for children may also be administered to adults e.g. to assess safety, dosage, immunogenicity, etc.
- These uses and methods are preferably for the prevention and/or treatment of a disease caused by a Neisseria (e.g. meningitis, septicaemia, gonorrhoea etc.).
- a Neisseria e.g. meningitis, septicaemia, gonorrhoea etc.
- the prevention and/or treatment of bacterial meningitis is preferred.
- composition of the invention will typically, in addition to the components mentioned above, comprise one or more ‘pharmaceutically acceptable carriers’, which include any carrier that does not itself induce the production of antibodies harmful to the individual receiving the composition.
- Suitable carriers are typically large, slowly metabolised macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, trehalose (WO00/56365) and lipid aggregates (such as oil droplets or liposomes).
- lipid aggregates such as oil droplets or liposomes.
- the vaccines may also contain diluents, such as water, saline, glycerol, etc. Additionally, auxiliary substances, such as wetting or emulsifying agents, pH buffering substances, and the like, may be present.
- auxiliary substances such as wetting or emulsifying agents, pH buffering substances, and the like, may be present.
- Immunogenic compositions used as vaccines comprise an immunologically effective amount of antigen, as well as any other of the above-mentioned components, as needed.
- immunologically effective amount it is meant that the administration of that amount to an individual, either in a single dose or as part of a series, is effective for treatment or prevention. This amount varies depending upon the health and physical condition of the individual to be treated, age, the taxonomic group of individual to be treated (e.g. non-human primate, primate, etc.), the capacity of the individual's immune system to synthesise antibodies, the degree of protection desired, the formulation of the vaccine, the treating doctor's assessment of the medical situation, and other relevant factors.
- Dosage treatment may be a single dose schedule or a multiple dose schedule (e.g. including booster doses).
- the vaccine may be administered in conjunction with other immunoregulatory agents.
- the vaccine may be administered in conjunction with other immunoregulatory agents.
- the composition may include other adjuvants in addition to (or in place of) the aluminium salt.
- Preferred adjuvants to enhance effectiveness of the composition include, but are not limited to: (1) oil-in-water emulsion formulations (with or without other specific immunostimulating agents such as muramyl peptides (see below) or bacterial cell wall components), such as for example (a) MF59TM (WO90/14837; Chapter 10 in ref.
- RibiTM adjuvant system Ribi Immunochem, Hamilton, Mont.
- MPL monophosphorylipid A
- TDM trehalose dimycolate
- CWS cell wall skeleton
- saponin adjuvants such as QS21 or StimulonTM
- cytokines such as interleukins (e.g. IL-1, IL-2, IL-4, IL-5, IL-6, IL-7, IL-12 (WO99/44636), etc.), interferons (e.g. gamma interferon), macrophage colony stimulating factor (M-CSF), tumor necrosis factor (TNF), etc.; (5) monophosphoryl lipid A (MPL) or 3-0-deacylated MPL (3dMPL) e.g.
- MPL monophosphoryl lipid A
- 3dMPL 3-0-deacylated MPL
- a polyoxyethylene sorbitan ester surfactant in combination with an octoxynol e.g. WO01/21207 or a polyoxyethylene alkyl ether or ester surfactant in combination with at least one additional non-ionic surfactant such as an octoxynol (e.g. WO01/21152);
- an immunostimulatory oligonucleotide e.g. a CpG oligonucleotide
- a saponin e.g. WO00/62800
- an immunostimulant and a particle of metal salt e.g.
- WO00/23105 (12) a saponin and an oil-in-water emulsion e.g. WO99/11241; (13) a saponin (e.g. QS21)+3dMPL+IL-12 (optionally+a sterol) e.g. WO98/57659; (14) other substances that act as immunostimulating agents to enhance the efficacy of the composition.
- Muramyl peptides include N-acetyl-muramyl-L-threonyl-D-isoglutamine (thr-MDP), N-acetyl-normuramyl-L-alanyl-D-isoglutamine (nor-MDP), N-acetylmuramyl-L-alanyl-D-isoglutaminyl-L-alanine-2-(1′-2′-dipalmitoyl-sn-glycero-3-hydroxyphosphoryloxy)-ethylamine MTP-PE), etc.
- thr-MDP N-acetyl-muramyl-L-threonyl-D-isoglutamine
- nor-MDP N-acetyl-normuramyl-L-alanyl-D-isoglutaminyl-L-alanine-2-(1′-2′-dipalmitoyl-sn-glycero-3-hydroxy
- composition of the invention include:
- composition may comprise one or more of these further antigens.
- a saccharide or carbohydrate antigen is used, it is preferably conjugated to a carrier protein in order to enhance immunogenicity [e.g. refs. 54 to 63].
- Preferred carrier proteins are bacterial toxins or toxoids, such as diphtheria or tetanus toxoids.
- the CRM 197 diphtheria toxoid is particularly preferred.
- Other suitable carrier proteins include the N. meningitidis outer membrane protein [e.g. ref. 64], synthetic peptides [e.g. 65, 66], heat shock proteins [e.g. 67], pertussis proteins [e.g. 68, 69], protein D from H. influenzae [e.g. 70], toxin A or B from C. difficile [e.g.
- a mixture comprises capsular saccharides from both serogroups A and C
- the ratio (w/w) of MenA saccharide:MenC saccharide is greater than 1 (e.g. 2:1, 3:1, 4:1, 5:1, 10:1 or higher).
- Saccharides from different serogroups of N. meningitidis may be conjugated to the same or different carrier proteins.
- Toxic protein antigens may be detoxified where necessary (e.g. detoxification of pertussis toxin by chemical and/or genetic means [32]).
- diphtheria antigen is included in the composition it is preferred also to include tetanus antigen and pertussis antigens. Similarly, where a tetanus antigen is included it is preferred also to include diphtheria and pertussis antigens. Similarly, where a pertussis antigen is included it is preferred also to include diphtheria and tetanus antigens.
- Antigens are preferably mixed with (and more preferably adsorbed to) an aluminium salt (e.g. phosphate, hydroxide, hydroxyphosphate, oxyhydroxide, orthophosphate, sulphate).
- the salt may take any suitable form (e.g. gel, crystalline, amorphous etc.).
- Antigens in the composition will typically be present at a concentration of at least 1 ⁇ g/ml each. In general, the concentration of any given antigen will be sufficient to elicit an immune response against that antigen.
- nucleic acid encoding the antigen may be used [e.g. refs. 72 to 80]. Protein components of the compositions of the invention may thus be replaced by nucleic acid (preferably DNA e.g. in the form of a plasmid) that encodes the protein.
- composition “comprising” means “including” as well as “consisting” e.g. a composition “comprising” X may consist exclusively of X or may include something additional e.g. X+Y.
- FIG. 1 shows an alignment of twenty-three sequences for protein 741. These are SEQ IDs 1 to 22 plus the sequence from MC58.
- FIG. 2 shows an alignment of the NMB 1343 sequence from gonococcus (top; SEQ ID 25) and meningococcus (bottom; SEQ ID 26).
- FIG. 3 shows hybrid and tandem proteins of the invention.
- FIG. 4 shows 9 domains within 961 2996
- FIG. 5 shows how these have been manipulated.
- FCA Freund's complete adjuvant
- mice were immunised with of three proteins adjuvanted with aluminium hydroxide, either single or in a triple combination: (1) 287 NZ -953; (2) 936-741; and (3) 961c. The mixture was able to induce high bactericidal titres against various strains:
- Hybrid proteins of the invention can be represented by formula NH 2 —[—X-L-] n -COOH. Where all n instances of —X— are the same basic protein (either identical, or the same protein from different strains or species), the protein is referred to as a ‘tandem’ protein.
- Proteins #1 to #5 have all been expressed in soluble form in E. coli. Expression levels were between 0.24 and 0.50 mg protein per litre of culture. The tandem proteins were purified and mixed with aluminium phosphate as an adjuvant. Tandem proteins #2, #4 and #5 adsorbed readily to aluminium phosphate; adsorption was less complete for tandem proteins #1 and #3.
- NMB1343 protein was found in 24/42 and was absent in 18/42 strains (Table 1).
- the NMB gene was sequenced for 10 of the NMB1343 + strains (Table 1, column 3).
- the nucleic acid sequence (and thus amino acid sequence SEQ ID 23; GenBank AAF41718) was identical in all 10 strains.
- NMB1343 was also detected in two strains of N. gonorrhoeae (F62 and SN4).
- the amino acid sequence from gonococcus is SEQ ID 24.
- An alignment with the meningococcal sequence is:
- FIG. 2 An alignment of the corresponding nucleotide sequences is shown in FIG. 2 . This shows that the gonococcal sequence has a 4 mer insertion in the 5′ region of the NMB1343 gene which causes a frameshift and consequent loss of the 5′ methionine residue.
- 961 is not present in the N. meningitidis serogroup A genome sequence [81], even though the surrounding regions are conserved (>90%) between serogroups A and B.
- References 11 and 12 disclose polymorphic forms of 961. The gene was found to be present in 91% of serogroup B strains belonging to hypervirulent lineages ET-5, ET-37 and cluster A4, but was absent in all strains of lineage 3 tested. Most of the serogroup C strains tested were positive even if not belonging to hypervirulent lineages. The same was true for the serogroup B strains with serotype 2a and 2b. For serogroup A, one strain belonging to subgroup III was positive whereas the other two strains belonging to subgroup IV-1 were negative. 961 was absent in N. gonorrhoeae and in commensal species N. lactamica and N. cinerea.
- FIGS. 4 and 5 show domains in protein 961.
- deletion mutants in the C-terminal region of 961 were constructed (961cL- ⁇ aro, 961cL ⁇ cc, 961aL, 961aL- ⁇ 1, 961aL- ⁇ 2, 961aL- ⁇ 3) on the basis of structural features (deletions of aromatic residues in the cases of 961c ⁇ aro mutant, and of coiled-coil regions for the others). These were analysed for expression and secretion into the periplasm and the supernatant of the culture. In all of these deletion mutants, the protein is produced in large amount, is present in periplasmic fraction, and is released in the supernatant of the culture.
- Protein Sera tested for bactericidal activity against strain* strain 2996 BZ232 MC58 1000 394/98 F6124 BZ133 2996 16000 128 4096 4096 1024 8000 16000 BZ232 >8000 256 2048 8000 2048 16000 8000 MC58 >8000 64 >8000 8000 2048 8000 8000 1000 >8000 64 4096 8000 1024 16000 16000 394/98 >16000 128 16000 >2048 >16000 — — * samples against homologous strain shown in bold
- Hybrid proteins were expressed in E. coli as follows:
- pellets were solubilised, refolded, ultrafiltered, dialysed, and protein was then purified:
- IB proteins were solubilised as follows: IB proteins were resuspended in 4 ml of 6M guanidine HCl, 1 mM EDTA pH 8.5 buffer, to a final protein concentration of 1 mg/ml. To refold the protein, 2 ml of solubilised protein was diluted in 400 ml of refolding buffer (0.1M Tris HCl, 1M L-arginine, 2 mM EDTA pH 8.2) and incubated for 1 hour at 15° C., resulting in a protein concentration of 5 ⁇ g/ml.
- refolding buffer 0.1M Tris HCl, 1M L-arginine, 2 mM EDTA pH 8.2
- a second dialysis of 24 h against 10 L of 300 mM NaCl, 50 mM sodium phosphate pH 8.0 buffer was performed.
- the dialysed material was centrifuged at 22000 rpm for 45 minutes at 4° C. in a Beckman centrifuge rotor JA25.5 The supernatant isolated after centrifugation was used for His-tag purification.
- IB proteins were solubilised as follows: IB proteins were resuspended in 4 ml of 6M guanidine HCl, 1 mM EDTA pH 8.5 buffer, to a final protein concentration of 1 mg/ml. To refold the protein, 2 ml of the solubilised protein was diluted in 400 ml refolding buffer (0.5M Tris HCl, 1M L-arginine, 2 mM EDTA pH 8.2) and incubated for 1 h at 15° C., resulting in a protein concentration of 5 ⁇ g/ml.
- refolding buffer 0.5M Tris HCl, 1M L-arginine, 2 mM EDTA pH 8.2
- a second dialysis of 24 h against 10 L of 300 mM NaCl, 50 mM sodium phosphate pH 8.0 buffer was performed.
- the dialysed material was centrifuged at 22000 rpm for 45 minutes at 4° C. in a Beckman centrifuge rotor JA25.5.
- the supernatant isolated after centrifugation was used for His-tag purification.
- IBs 961c-orf46.1-His IBs were solubilised as follows: IB proteins were resuspended in 4 ml of 6M guanidine HCl, 1 mM EDTA pH 8.5 buffer, to a final protein concentration of 1 mg/ml. To refold the protein, 2 ml of the solubilised protein was diluted in 400 ml refolding buffer (0.1M Tris HCl, 0.5 M L-arginine,2 mM EDTA pH 8.2) and incubated for 1 h at 15° C., resulting in a protein concentration of 5 ⁇ g/ml.
- refolding buffer 0.1M Tris HCl, 0.5 M L-arginine,2 mM EDTA pH 8.2
- a second dialysis of 24 h against 10 L of 300 mM NaCl, 50 mM sodium phosphate pH 8.0 buffer was performed.
- the dialysed material was centrifuged at 22000 rpm for 45 minutes at 4° C. in a Beckman centrifuge rotor JA25.5.
- the supernatant isolated after centrifugation was used for His-tag purification.
- IB proteins were solubilised as follows: IB proteins were resuspended in 4 ml of 6M guanidine HCl, 1 mM EDTA pH 8.5 buffer, to a final protein concentration of 10 mg/ml. To refold, 2 ml of the solubilised protein was diluted in 400 ml of the refolding buffer (0.5M Tris HCl, 0.7 M L-arginine, 2 mM EDTA pH 7.2) and incubated for 1 h at 15° C., resulting in a protein concentration of 50 ⁇ g/ml.
- the refolding buffer 0.5M Tris HCl, 0.7 M L-arginine, 2 mM EDTA pH 7.2
- a second dialysis of 24 h against 10 L of 300 mM NaCl, 50 mM sodium phosphate pH 8.0 buffer was performed.
- the dialysed material was centrifuged at 22000 rpm for 45 minutes at 4° C. in a Beckman centrifuge rotor JA25.5 The supernatant isolated after centrifugation was used for His-tag purification.
- bactericidal assay titres were as follows:
- ORF46.1K Similar procedures were used for ORF46.1 to purify the protein from IBs when expressed with no His-tag (‘ORF46.1K’):
- IB proteins were resuspended in 4 ml of 6M guanidine HCl, 1 mM EDTA pH 8.5 buffer, to a final protein concentration of 10 mg/ml.
- 2 ml of the solubilised protein was diluted in 400 ml of the refolding buffer (0.5M Tris HCl, 0.7 M L-arginine,2 mM EDTA pH 7.2) and incubated for 1 hours at 15° C., resulting in a protein concentration of 50 ⁇ g/ml. Subsequently another 2 ml of the solubilised protein was added and incubated for an additional hour at the same temperature resulting in a final protein concentration of 100 m/ml.
- the refolding buffer 0.5M Tris HCl, 0.7 M L-arginine,2 mM EDTA pH 7.2
- the material was ultrafiltered using a 300 ml Amicon ultrafiltration cell (8400), applying a 3 bar pressure on an Amicon membrane with a 30 kDa cut-off (YM30) resulting in 120 ml final volume.
- the ultrafiltered material was dialysed using a regenerated cellulose tubular membrane with a 12-14 kDa cutoff (Cellusep—Step bio) for 12 h against 10 L of 50 mM sodium phosphate, 2 mM EDTA, pH 7.2 buffer. A second dialysis of 24 h against 10 L of the same buffer was performed.
- the dialysed material was centrifuged at 22000 rpm for 45 minutes at 4° C. in a Beckman centrifuge rotor JA25.5.
- the supernatant isolated after centrifugation was used for cationic exchange chromatography.
- the purification was done on a AKTA explorer chromatography system (Amersham-Pharmacia Biotech) using a 5 ml HiTrap SP sepharose HP column (Amersham-Pharmacia Biotech). The flow rate applied was of 1.5 ml per minute.
- the column was washed with 35 ml of 50 mM sodium phosphate buffer pH 7.2.
- a linear gradient (0-1 M NaCl) was performed using a 50 mM sodium phosphate buffer pH 7.2.
- the protein eluted in two peaks at 92 mM and 380 mM NaCl.
- the fractions constituting each peak were pooled and respectively named pool 1 and pool 2.
- bactericidal assay titres when adjuvanted with aluminium hydroxide were improved from ⁇ 4 to 1024.
- the titre using aluminium phosphate adjuvant with the refolded protein was 2048.
- ELISA titres were as follows:
Abstract
Description
- This application is a Continuation of U.S. patent application Ser. No. 14/305,979, filed Jun. 16, 2014, now U.S. Pat. No. 9,056,075; which is a Divisional of U.S. patent application Ser. No. 13/366,252, filed Feb. 3, 2012, now U.S. Pat. No. 8,840,907; which is a Divisional of U.S. patent application Ser. No. 10/488,786, which claims an international filing date of Sep. 6, 2002, now U.S. Pat. No. 8,980,277; which is the National Stage of International Patent Application No. PCT/IB2002/003904, filed Sep. 6, 2002; which claims the benefit of United Kingdom Patent Application No. 0121591.2, filed Sep. 6, 2001; the disclosures of which are herein incorporated by reference in their entirety.
- All documents cited herein are incorporated by reference in their entirety.
- The content of the following submission on ASCII text file is incorporated herein by reference in its entirety: a computer readable form (CRF) of the Sequence Listing (file name: 223002100602SeqList.txt, date recorded: Jun. 12, 2015, size: 70 KB).
- This invention is in the field of protein expression. In particular, it relates to the expression of proteins from Neisseria (e.g. N. gonorrhoeae or, preferably, N. meningitidis).
-
References 1 and 2 disclose alternative and improved approaches for the expression of the Neisserial proteins disclosed in references 3 to 6. One such method is to produce ‘hybrid’ proteins in which two or more Neisserial proteins are expressed as a single polypeptide chain. This approach offers two advantages. First, a protein that may be unstable or poorly expressed on its own can be assisted by adding a suitable hybrid partner that overcomes the problem. Second, commercial manufacture is simplified as only one expression and purification need be employed in order to produce two separately-useful proteins. - It is an object of the present invention to provide further alternative and improved approaches for the expression of Neisserial proteins.
- Hybrid Proteins
- Thus the invention provides a method for the simultaneous expression of two or more (e.g. 3, 4, 5, 6 or more) Neisserial proteins, in which said two or more proteins are joined such that they are translated as a single polypeptide chain. In general, the hybrid proteins of the invention can be represented by the formula: NH2-A-[—X-L-]n-B—COOH wherein X is an amino acid sequence, L is an optional linker amino acid sequence, A is an optional N-terminal amino acid sequence, B is an optional C-terminal amino acid sequence, and n is an integer greater than 1.
- The value of n is between 2 and x, and the value of x is typically 3, 4, 5, 6, 7, 8, 9 or 10. Preferably n is 2, 3 or 4; it is more preferably 2 or 3; most preferably, n=2.
- The ˜X˜ Moieties
- There are two main groups of hybrid proteins according to the invention. These two groups are not mutually exclusive.
- In the first group, each ˜X˜ moiety is:
-
- (a) an orf1, orf4, orf25, orf40, orf46.1, orf83, NMB1343, 230, 233, 287, 292, 594, 687, 736, 741, 907, 919, 936, 953, 961 or 983 amino acid sequence;
- (b) an amino acid sequence having sequence identity to an amino acid sequence from (a); or
- (c) an amino acid sequence comprising a fragment of an amino acid sequence from (a).
- A preferred subset of (a) is: orf46.1, 230, 287, 741, 919, 936, 953, 961 and 983. A more preferred subset of (a) is: orf46.1, 287, 741 and 961.
FIG. 3 shows preferred hybrid proteins. - In the second group, the hybrid protein comprises a first —X— moiety (—Xa—) and a second —X— moiety (—Xb—). The —Xa— moiety has one of the following amino acid sequences:
-
- (d) the 446 even SEQ IDs (i.e. 2, 4, 6, . . . , 890, 892) disclosed in reference 3.
- (e) the 45 even SEQ IDs (i.e. 2, 4, 6, . . . , 88, 90) disclosed in reference 4;
- (f) the 1674 even SEQ IDs 2-3020, even SEQ IDs 3040-3114, and all SEQ IDs 3115-3241, disclosed in reference 5;
- (g) the 2160 amino acid sequences NMB0001 to NMB2160 from
reference 7; or - (h) an amino acid sequence disclosed in
reference 1 or reference 2.
- The —Xb— moiety is related to —Xa— such that: (i) —Xb— has sequence identity to 13 Xa—, and/or (j) —Xb— comprises a fragment of —Xa—.
- Examples of this second type of hybrid protein include proteins in which two or more —X— moieties are identical, or in which they are variants of the same protein e.g. two polymorphic forms of the same protein may be expressed as —Xa—Xb—, and three polymorphic forms may be expressed as —Xa—Xb—Xa— etc.
- The —Xa— and —Xb— moieties may be in either order from N-terminus to C-terminus.
- The —Xa— moiety is preferably an orf1, orf4, orf25, orf40, orf46.1, orf83, NMB1343, 230, 233, 287, 292, 594, 687, 736, 741, 907, 919, 936, 953, 961 or 983 amino acid sequence. The —Xa— moiety is more preferably an orf46.1, 230, 287, 741, 919, 936, 953, 961 or 983 amino acid sequence. The —Xa— moiety is most preferably an orf46.1, 287, 741 or 961 amino acid sequence.
- In proteins where each of the n-X— moieties shares sequence identity to each other —X— moiety, the protein is referred to as a ‘tandem protein’. Tandem proteins in which n=2 are preferred.
- The degree of ‘sequence identity’ referred to in (b) and (i) is preferably greater than 50% (eg. 60%, 70%, 80%, 90%, 95%, 99% or more, up to 100%). This includes mutants, homologs, orthologs, allelic variants etc. [e.g. see ref. 8]. Identity is preferably determined by the Smith-Waterman homology search algorithm as implemented in the MPSRCH program (Oxford Molecular), using an affine gap search with parameters gap open penalty=12 and gap extension penalty=1. Typically, 50% identity or more between two proteins is considered as an indication of functional equivalence.
- The ‘fragment’ referred to in (c) and (j) should consist of least m consecutive amino acids from an amino acid sequence from (a), (d), (e), (f), (g) or (h) and, depending on the particular sequence, m is 7 or more (eg. 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200 or more).
- Preferably the fragment comprises an epitope from an amino acid sequence from (a), (d), (e), (t), (g) or (h). Preferred fragments are those disclosed in
references 9 and 10. - Preferred (c) and (j) fragments are C- and/or N-terminal truncations (e.g. Δ1-287, A2-287 etc.).
- Preferred (b), (c), (i) and (j) sequences omit poly-glycine sequences. This has been found to aid expression [ref. 2]. Poly-glycine sequences can be represented as (Gly)g, where g>3 (e.g. 4, 5, 6, 7, 8, 9 or more). If a —X— moiety includes a poly-glycine sequence in its wild-type form, it is preferred to omit this sequence in the hybrid proteins of the invention. This may be by disrupting or removing the (Gly)g—by deletion (e.g. CGGGGS→CGGGS, CGGS, CGS or CS), by substitution (e.g. CGGGGS→CGXGGS, CGXXGS, CGXGXS etc.), and/or by insertion (e.g. CGGGGS→CGGXGGS, CGXGGGS, etc.). Deletion of (Gly)g is preferred, and deletion of the N-terminus portion of a protein up to and including the poly-glycine sequence (e.g. deletion of residues 1-32 in SEQ ID 1) is referred to herein as ‘ΔG’. Poly-glycine omission is particularly useful for
proteins - Preferred (c) and (j) fragments omit complete protein domains. This is particularly useful for
protein FIGS. 4 and 5 herein). - 287 protein has been notionally split into three domains, referred to as A, B & C (see FIG. 5 of reference 2). Domain B aligns with IgA proteases, domain C aligns with transferrin-binding proteins, and domain A shows no strong alignment with database sequences. An alignment of polymorphic forms of 287 is disclosed in
reference 8. - ORF46 has been notionally split into two domains—a first domain (amino acids 1-433; ORF46.1) which is well-conserved between species and serogroups, and a second domain (amino acids 434-608) which is not well-conserved. The second domain is preferably deleted, leaving ORF46.1. An alignment of polymorphic forms of ORF46 is disclosed in
reference 8. - 961 protein has been notionally split into several domains (
FIG. 4 ). - If a —X— moiety has a leader peptide sequence in its wild-type form, this may be included or omitted in the hybrid proteins of the invention. Where the leader peptide is omitted, this is a preferred example of an amino acid sequence within (c) and (j). In one embodiment, the leader peptides will be deleted except for that of the —X— moiety located at the N-terminus of the hybrid protein i.e. the leader peptide of X1 will be retained, but the leader peptides of X2 . . . Xn will be omitted. This is equivalent to deleting all leader peptides and using the leader peptide of X1 as moiety -A-.
- When n=2, preferred pairs of —X— moieties are: ΔG287 and 230; ΔG287 and 936; ΔG287 and 741; 961c and 287; 961c and 230; 961c and 936; 961cL and 287; 961cL and 230; 961cL and 936; ORF46.1 and 936; ORF46.1 and 230; 230 and 961; 230 and 741; 936 and 961; 936 and 741. When n=2, preferred pairs of —X— moieties for tandem proteins are: ΔG741 and 741; ΔG287 and 287. More specifically, the following combinations of X1 and X2 are preferred when n=2:
-
X1 X2 ΔG287 230 ΔG287 936 ΔG287 741 ΔG287 961 ΔG287 ORF46.1 ΔG287 919 ΔG287 953 961c 287 961c 230 961c 936 961c 741 961c 983 961c ΔG983 961c ORF46.1 961 ORF46.1 961cL 287 961cL 230 961cL 936 ORF46.1 936 ORF46.1 230 ORF46.1 741 ORF46.1 ΔG741 ORF46.1 983 ORF46.1 ΔG983 230 961 230 741 230 ΔG741 936 961 936 741 936 ΔG741 ΔG741 741 ORF46.1 983 ΔG741 ORF46.1 ΔG741 983 ΔG741 961 ΔG741 961c ΔG983 ORF46.1 ΔG983 961 ΔG983 961c 230 ΔG287 936 ΔG287 741 ΔG287 961 ΔG287 ORF46.1 ΔG287 919 ΔG287 953 ΔG287 287 961c 230 961c 936 961c 741 961c 983 961c ΔG983 961c ORF46.1 961c ORF46.1 961 287 961cL 230 961cL 936 961cL 936 ORF46.1 230 ORF46.1 741 ORF46.1 ΔG741 ORF46.1 983 ORF46.1 ΔG983 ORF46.1 961 230 741 230 ΔG741 230 961 936 741 936 ΔG741 936 ΔG287 287 983 ORF46.1 ORF46.1 ΔG741 983 ΔG741 961 ΔG741 961c ΔG741 ORF46.1 ΔG983 961 ΔG983 961c ΔG983 - Where 287 is used in full-length form, it is preferably at the C-terminal end of a hybrid protein; if it is to be used at the N-terminus, if is preferred to use a ΔG form of 287. Similarly, Where 741 is used in full-length form, it is preferably at the C-terminal end of a hybrid protein; if it is to be used at the N-terminus, if is preferred to use a ΔG form of 741.
- The -L- Moieties
- For each n instances of [—X-L-], linker amino acid sequence -L- may be present or absent. For instance, when n=2 the hybrid may be NH2—X1-L1-X2-L2-COOH, NH2—X1—X2—COOH, NH2—X1-L1-X2—COOH, NH2—X1—X2-L2-COOH, etc.
- Linker amino acid sequence(s) -L- will typically be short (e.g. 20 or fewer amino acids i.e. 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1). Examples include short peptide sequences which facilitate cloning, poly-glycine linkers (i.e. Glyn where n=2, 3, 4, 5, 6, 7, 8, 9, 10 or more), and histidine tags (i.e. Hisn where n=3, 4, 5, 6, 7, 8, 9, 10 or more). Other suitable linker amino acid sequences will be apparent to those skilled in the art. A useful linker is GSGGGG (SEQ ID 27), with the Gly-Ser dipeptide being formed from a BamHI restriction site, thus aiding cloning and manipulation, and the Gly4 tetrapeptide being a typical poly-glycine linker.
- If Xn+1 is a ΔG protein and Ln is a glycine linker, this may be equivalent to Xn+1 not being a ΔG protein and Ln being absent.
- The -A- Moiety
- -A- is an optional N-terminal amino acid sequence. This will typically be short (e.g. 40 or fewer amino acids i.e. 39, 38, 37, 36, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1). Examples include leader sequences to direct protein trafficking, or short peptide sequences which facilitate cloning or purification (e.g. histidine tags i.e. Hisn where n=3, 4, 5, 6, 7, 8, 9, 10 or more). Other suitable N-terminal amino acid sequences will be apparent to those skilled in the art. If X1 lacks its own N-terminus methionine, -A- may be a methionine residue.
- The —B— Moiety
- —B— is an optional C-terminal amino acid sequence. This will typically be short (e.g. 40 or fewer amino acids i.e. 39, 38, 37, 36, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1). Examples include sequences to direct protein trafficking, short peptide sequences which facilitate cloning or purification (e.g. comprising histidine tags i.e. Hisn where n=3, 4, 5, 6, 7, 8, 9, 10 or more), or sequences which enhance protein stability. Other suitable C-terminal amino acid sequences will be apparent to those skilled in the art.
- Polymorphic Forms of Proteins
- The invention can use amino acid sequences from any strains of N. meningitidis. References to a particular protein (e.g. ‘287’, or ‘ORF46.1’) therefore include that protein from any strain. Sequence variations between strains are included within (b), (c), (i) and (j).
- Reference sequences from N. meningitidis serogroup B include:
-
Protein Reference orf1 Ref. 3, SEQ ID 650 orf25 Ref. 3, SEQ ID 684 orf46 Ref. 6, SEQ ID 1049 NMB1343 Ref. 7, NMB1343 233 Ref. 5, SEQ ID 860 292 Ref. 5, SEQ ID 1220 687 Ref. 5, SEQ ID 2282 741 Ref. 5, SEQ ID 2536 919 Ref. 5, SEQ ID 3070 953 Ref. 5, SEQ ID 2918 983 Ref. 7, NMB1969 orf4 Ref. 3, SEQ ID 218 orf40 Ref. 4, SEQ ID 4 orf83 Ref. 3, SEQ ID 314 230 Ref. 5, SEQ ID 830 287 Ref. 5, SEQ ID 3104 594 Ref. 5, SEQ ID 1862 736 Ref. 5, SEQ ID 2506 907 Ref. 5, SEQ ID 2732 936 Ref. 5, SEQ ID 2884 961 Ref. 5, SEQ ID 940 -
Reference 8 discloses polymorphic forms of proteins ORF4, ORF40, ORF46, 225, 235, 287, 519, 726, 919 and 953. Polymorphic forms of 961 are disclosed inreferences 11 & 12. Any of these polymorphic forms may be used in accordance with the present invention. - The sequence listing herein includes polymorphic forms of proteins 741 (SEQ IDs 1-22) and NMB 1343 (SEQ IDs 23-24) which have been identified.
- Serogroups and Strains
- Preferred proteins of the invention comprise —X— moieties having an amino acid sequence found in N. meningitidis serogroup B. Within a single protein of the invention, individual —X— moieties may be from one or more strains. Where n=2, for instance, X2 may be from the same strain as X1 or from a different strain. Where n=3, the strains might be (i) X1═X2═X3 (ii) X1═X2≠X3 (iii) X1≠X2═X3 (iv) X1≠X2≠X3 or (v) X1═X3≠X2, etc.
- Within serogroup B, preferred —X— moieties are from strains 2996, MC58, 95N477, or 394/98. Strain 95N477 is sometimes referred to herein as ‘ET37’, this being its electrophoretic type. Strain 394/98 is sometimes referred to herein as ‘nz’, as it is a New Zealand strain.
- Where a form of 287 is used, this is preferably from strain 2996 or from strain 394/98.
- Where a form of 741 is used, this is preferably from serogroup B strains MC58, 2996, 394/98, or 95N477, or from
serogroup C strain 90/18311. - Where a form of 961 is used, this is preferably from strain 2996.
- Strains are indicated as a subscript e.g. 741MC58 is
protein 741 from strain MC58. Unless otherwise stated, proteins mentioned herein (e.g. with no subscript) are from N. meningitidis strain 2996, which can be taken as a ‘reference’ strain. It will be appreciated, however, that the invention is not in general limited by strain. As mentioned above, general references to a protein (e.g. ‘287’, ‘919’ etc.) may be taken to include that protein from any strain. This will typically have sequence identity to 2996 of 90% or more (eg. 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more). - Domain-Based Expression of
Protein 961 -
References 1 and 2 disclose how a protein can be notionally divided into domains and how the protein can be manipulated based on these domains. The present invention extends the application of this approach to protein 961 (also known as ‘NadA’ [11,12]). - In N. meningitidis serogroup B strain 2996, NadA has 405 amino acids. This protein has notionally been divided into the following nine domains (
FIG. 4 ): -
Domain name Amino acids Domain name Amino acids 961-1 ‘L’ 1-23 961-6 269-286 961-2 24-87 961-7 287-330 961-3 88-143 961-8 331-350 961-4 144-180 961-9 351-405 961-5 181-268 - This information can be used to locate the same domains in other forms of 961.
- These domains have been deleted from 961 in strain 2996 in various ways (
FIG. 5 ). Preferred fragments of 961 omit one or more of these nine domains e.g. the following: -
- 961-2 to 961-5 (‘961a’)
- 961-6 to 961-9 (‘961b’)
- 961-1 to 961-8 (‘961 cL’)
- 961-2 to 961-8 (‘961c’)
- 961-2 to 961-6 and amino acids 287-325 from domain 961-7 (‘961d’)
- 961-2 to 961-8 and amino acids 351-383 from domain 961-9 (‘961Δ1’)
- 961-1 to 961-8 and amino acids 351-383 from domain 961-9 (‘961Δ1L’)
- 961-1 to 961-7 and amino acids 331-343 from domain 961-8 (‘961cL-Δaro’)
- 961-1 to 961-6 and amino acids 287-315 from domain 961-7 (‘961cL-Δcc’)
- 961-1 to 961-5 (‘961aL’)
- 961-1 to 961-4 (‘961aL-Δ1’)
- 961-1 to 961-3 (‘961aL-Δ2’)
- 961-1 to 961-2 (‘961aL-Δ3’)
- These thirteen fragments (and sub-fragments thereof missing 1, 2, 3, 4 or 5 amino acids at either or both ends) are preferred (c) and (j) fragments, but they may also be expressed in their own right i.e. not in the form of a hybrid protein of the invention. Thus the invention provides a protein comprising one of these fragments, providing that the protein is not full-
length 961 and is not a protein specifically disclosed inreference 1 or 2. This protein may be a fusion protein (e.g. a GST-fusion or a His-tag fusion). - Sequences
- The invention also provides a protein having an amino acid sequence from
SEQ IDs 1 to 24. It also provides proteins and nucleic acid having sequence identity to these. As described above, the degree of ‘sequence identity’ is preferably greater than 50% (eg. 60%, 70%, 80%, 90%, 95%, 99% or more). - The invention also provides nucleic acid encoding such proteins.
- Furthermore, the invention provides nucleic acid which can hybridise to this nucleic acid, preferably under “high stringency” conditions (eg. 65° C. in a 0.1×SSC, 0.5% SDS solution).
- The invention also provides nucleic acid encoding proteins according to the invention.
- It should also be appreciated that the invention provides nucleic acid comprising sequences complementary to those described above (eg. for antisense or probing purposes).
- Nucleic acid according to the invention can, of course, be prepared in many ways (eg. by chemical synthesis, from genomic or cDNA libraries, from the organism itself etc.) and can take various forms (eg. single stranded, double stranded, vectors, probes etc.).
- In addition, the term “nucleic acid” includes DNA and RNA, and also their analogues, such as those containing modified backbones, and also peptide nucleic acids (PNA) etc.
- Mixtures
- The invention also provides a composition comprising two or more (i.e. 2, 3, 4, 5, 6 or 7) of the following proteins:
-
- (1) 287
- (2) 741
- (3) ORF46.1
- (4) 961
- (5) NH2-A-[—X-L-]n-B—COOH, wherein n=2, X1=287, X2=953
- (6) NH2-A-[—X-L-]n-B—COOH, wherein n=2, X1=287, X2=919
- (7) NH2-A-[—X-L-]n-B—COOH, wherein n=2, X1=287, X2=961
- The mixture may include one or both of the following proteins, either in combination with two or more of (1) to (7), or in combination with only one of (1) to (7):
-
- (8) NH2-A-[—X-L-]n-B—COOH, wherein n=2, X1=287, X2=741
- (9) NH2-A-[—X-L-]n-B—COOH, wherein n=2, X1=936, X2=741
- Where
proteins protein protein 961 is included, it is preferably in the form of ‘961c’ in which the N-terminus leader and C-terminus membrane anchor are absent [e.g. see refs. 1, 2 & 11]. - A preferred mixture comprises the following three proteins:
-
- (1) 961c, preferably 961c2996 (e.g. SEQ ID 31 herein);
- (2) NH2-A-[—X-L-]n-B—COOH, wherein n is 2, —X1— is ΔG287 (preferably ΔG287NZ), —X2— is 953 (preferably 9532996) lacking its leader peptide, -L1- is GSGGGG, and -A- comprises a N-terminus methionine (e.g. -A- is M or MA) (e.g. SEQ IDs 28 & 29 herein); and
- (3) NH2-A-[—X-L-]n-B—COOH, wherein n=2, X1=936 (preferably 9362996), X2=ΔG741 (preferably ΔG741 MC58), L1=GSGGGG (
e.g. SEQ ID 30 herein).
- The mixtures may also comprise N. meningitidis outer membrane vesicles.
- Heterologous Host
- Whilst expression of the proteins of the invention may take place in Neisseria, the present invention preferably utilises a heterologous host. The heterologous host may be prokaryotic (e.g. a bacterium) or eukaryotic. It is preferably E. coli, but other suitable hosts include Bacillus subtilis, Vibrio cholerae, Salmonella typhi, Salmonenna typhimurium, Neisseria lactamica, Neisseria cinerea, Mycobacteria (e.g. M. tuberculosis), yeast etc.
- Vectors Etc.
- The invention provides (a) nucleic acid encoding the proteins described above (b) vectors comprising these nucleic acid sequences (c) host cells containing said vectors (d) compositions comprising the proteins or nucleic acids of the invention, which may be suitable as immunogenic compositions (e.g. vaccines) or as diagnostic reagents (e) these compositions for use as medicaments (e.g. as vaccines) or as diagnostic reagents (f) the use of these compositions in the manufacture of (1) a medicament for treating or preventing infection due to Neisserial bacteria (2) a diagnostic reagent for detecting the presence of Neisserial bacteria or of antibodies raised against Neisseria bacteria, and/or (3) a reagent which can raise antibodies against Neisseria bacteria and (g) a method of treating a patient, comprising administering to the patient a therapeutically effective amount of these compositions.
- Implementing the invention will typically involve the basic steps of: obtaining a first nucleic acid encoding a first protein; obtaining a second nucleic acid encoding a second protein; and ligating the first and second nucleic acids. The resulting nucleic acid may be inserted into an expression vector, or may already be part of an expression vector.
- To improve solubility, purification of hybrid proteins may involve the refolding techniques disclosed herein.
- Immunogenic Compositions and Medicaments
- The compositions of the invention are preferably immunogenic composition, and are more preferably vaccine compositions. The pH of the composition is preferably between 6 and 7. The pH may be maintained by the use of a buffer. The composition may be sterile.
- Vaccines according to the invention may either be prophylactic (i.e. to prevent infection) or therapeutic (i.e. to treat infection), but will typically be prophylactic.
- The invention also provides a composition of the invention for use as a medicament. The medicament is preferably able to raise an immune response in a mammal (i.e. it is an immunogenic composition) and is more preferably a vaccine.
- The invention also provides the use of a composition of the invention in the manufacture of a medicament for raising an immune response in a mammal. The medicament is preferably a vaccine.
- The invention also provides a method for raising an immune response in a mammal comprising the step of administering an effective amount of a composition of the invention. The immune response is preferably protective. The method may raise a booster response.
- The mammal is preferably a human. Where the vaccine is for prophylactic use, the human is preferably a child (e.g. a toddler or infant); where the vaccine is for prophylactic use, the human is preferably an adult. A vaccine intended for children may also be administered to adults e.g. to assess safety, dosage, immunogenicity, etc.
- These uses and methods are preferably for the prevention and/or treatment of a disease caused by a Neisseria (e.g. meningitis, septicaemia, gonorrhoea etc.). The prevention and/or treatment of bacterial meningitis is preferred.
- Further Components of the Composition
- The composition of the invention will typically, in addition to the components mentioned above, comprise one or more ‘pharmaceutically acceptable carriers’, which include any carrier that does not itself induce the production of antibodies harmful to the individual receiving the composition. Suitable carriers are typically large, slowly metabolised macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, trehalose (WO00/56365) and lipid aggregates (such as oil droplets or liposomes). Such carriers are well known to those of ordinary skill in the art. The vaccines may also contain diluents, such as water, saline, glycerol, etc. Additionally, auxiliary substances, such as wetting or emulsifying agents, pH buffering substances, and the like, may be present. A thorough discussion of pharmaceutically acceptable excipients is available in Remington's Pharmaceutical Sciences.
- Immunogenic compositions used as vaccines comprise an immunologically effective amount of antigen, as well as any other of the above-mentioned components, as needed. By ‘immunologically effective amount’, it is meant that the administration of that amount to an individual, either in a single dose or as part of a series, is effective for treatment or prevention. This amount varies depending upon the health and physical condition of the individual to be treated, age, the taxonomic group of individual to be treated (e.g. non-human primate, primate, etc.), the capacity of the individual's immune system to synthesise antibodies, the degree of protection desired, the formulation of the vaccine, the treating doctor's assessment of the medical situation, and other relevant factors. It is expected that the amount will fall in a relatively broad range that can be determined through routine trials. Dosage treatment may be a single dose schedule or a multiple dose schedule (e.g. including booster doses). The vaccine may be administered in conjunction with other immunoregulatory agents.
- The vaccine may be administered in conjunction with other immunoregulatory agents.
- The composition may include other adjuvants in addition to (or in place of) the aluminium salt. Preferred adjuvants to enhance effectiveness of the composition include, but are not limited to: (1) oil-in-water emulsion formulations (with or without other specific immunostimulating agents such as muramyl peptides (see below) or bacterial cell wall components), such as for example (a) MF59™ (WO90/14837; Chapter 10 in ref. 13), containing 5% Squalene, 0.5% Tween 80, and 0.5% Span 85 (optionally containing MTP-PE) formulated into submicron particles using a microfluidizer, (b) SAF, containing 10% Squalane, 0.4% Tween 80, 5% pluronic-blocked polymer L121, and thr-MDP either microfluidized into a submicron emulsion or vortexed to generate a larger particle size emulsion, and (c) Ribi™ adjuvant system (RAS), (Ribi Immunochem, Hamilton, Mont.) containing 2% Squalene, 0.2% Tween 80, and one or more bacterial cell wall components from the group consisting of monophosphorylipid A (MPL), trehalose dimycolate (TDM), and cell wall skeleton (CWS), preferably MPL+CWS (Detox™); (2) saponin adjuvants, such as QS21 or Stimulon™ (Cambridge Bioscience, Worcester, Mass.) may be used or particles generated therefrom such as ISCOMs (immunostimulating complexes), which ISCOMS may be devoid of additional detergent e.g. WO00/07621; (3) Complete Freund's Adjuvant (CFA) and Incomplete Freund's Adjuvant (IFA); (4) cytokines, such as interleukins (e.g. IL-1, IL-2, IL-4, IL-5, IL-6, IL-7, IL-12 (WO99/44636), etc.), interferons (e.g. gamma interferon), macrophage colony stimulating factor (M-CSF), tumor necrosis factor (TNF), etc.; (5) monophosphoryl lipid A (MPL) or 3-0-deacylated MPL (3dMPL) e.g. GB-2220221, EP-A-0689454; (6) combinations of 3dMPL with, for example, QS21 and/or oil-in-water emulsions e.g. EP-A-0835318, EP-A-0735898, EP-A-0761231; (7) oligonucleotides comprising CpG motifs [Krieg Vaccine 2000, 19, 618-622; Krieg Curr opin Mol Ther 2001 3:15-24; Roman et al., Nat. Med., 1997, 3, 849-854; Weiner et al., PNAS USA, 1997, 94, 10833-10837; Davis et al., J. Immunol., 1998, 160, 870-876; Chu et al., J. Exp. Med., 1997, 186, 1623-1631; Lipford et al., Eur. J. Immunol., 1997, 27, 2340-2344; Moldoveanu et al., Vaccine, 1988, 16, 1216-1224, Krieg et al., Nature, 1995, 374, 546-549; Klinman et al., PNAS USA, 1996, 93, 2879-2883; Ballas et al., J. Immunol., 1996, 157, 1840-1845; Cowdery et al., J. Immunol., 1996, 156, 4570-4575; Halpern et al., Cell. Immunol., 1996, 167, 72-78; Yamamoto et al., Jpn. J. Cancer Res., 1988, 79, 866-873; Stacey et al., J. Immunol., 1996, 157, 2116-2122; Messina et al., J. Immunol., 1991, 147, 1759-1764; Yi et al., J. Immunol., 1996, 157, 4918-4925; Yi et al., J. Immunol., 1996, 157, 5394-5402; Yi et al., J. Immunol., 1998, 160, 4755-4761; and Yi et al., J. Immunol., 1998, 160, 5898-5906; International patent applications WO96/02555, WO98/16247, WO98/18810, WO98/40100, WO98/55495, WO98/37919 and WO98/52581] i.e. containing at least one CG dinucleotide, with 5-methylcytosine optionally being used in place of cytosine; (8) a polyoxyethylene ether or a polyoxyethylene ester e.g. WO99/52549;
- (9) a polyoxyethylene sorbitan ester surfactant in combination with an octoxynol (e.g. WO01/21207) or a polyoxyethylene alkyl ether or ester surfactant in combination with at least one additional non-ionic surfactant such as an octoxynol (e.g. WO01/21152); (10) an immunostimulatory oligonucleotide (e.g. a CpG oligonucleotide) and a saponin e.g. WO00/62800; (11) an immunostimulant and a particle of metal salt e.g. WO00/23105; (12) a saponin and an oil-in-water emulsion e.g. WO99/11241; (13) a saponin (e.g. QS21)+3dMPL+IL-12 (optionally+a sterol) e.g. WO98/57659; (14) other substances that act as immunostimulating agents to enhance the efficacy of the composition.
- Muramyl peptides include N-acetyl-muramyl-L-threonyl-D-isoglutamine (thr-MDP), N-acetyl-normuramyl-L-alanyl-D-isoglutamine (nor-MDP), N-acetylmuramyl-L-alanyl-D-isoglutaminyl-L-alanine-2-(1′-2′-dipalmitoyl-sn-glycero-3-hydroxyphosphoryloxy)-ethylamine MTP-PE), etc.
- Further Antigens
- Further antigens which can be included in the composition of the invention include:
-
- an outer-membrane vesicle (OMV) preparation from N. meningitidis serogroup B, such as those disclosed in refs. 14, 15, 16, 17 etc.
- a saccharide antigen from N. meningitidis serogroup A, C, W135 and/or Y, such as the oligosaccharide disclosed in ref. 18 from serogroup C [see also ref. 19] or the oligosaccharides of ref. 20.
- a saccharide antigen from Streptococcus pneumoniae [e.g. refs. 21, 22, 23].
- a protein antigen from Helicobacter pylori such as CagA [e.g. 24], VacA [e.g. 24], NAP [e.g. 25], HopX [e.g. 26], HopY [e.g. 26] and/or urease.
- an antigen from hepatitis A virus, such as inactivated virus [e.g. 27, 28].
- an antigen from hepatitis B virus, such as the surface and/or core antigens [e.g. 28, 29].
- an antigen from hepatitis C virus [e.g. 30].
- an antigen from Bordetella pertussis, such as pertussis holotoxin (PT) and filamentous haemagglutinin (FHA) from B. pertussis, optionally also in combination with pertactin and/or agglutinogens 2 and 3 [e.g. refs. 31 & 32].
- a diphtheria antigen, such as a diphtheria toxoid [e.g. chapter 3 of ref. 33] e.g. the CRM197 mutant [e.g. 34].
- a tetanus antigen, such as a tetanus toxoid [e.g. chapter 4 of ref. 33].
- a saccharide antigen from Haemophilus influenzae B [e.g. 19].
- an antigen from N. gonorrhoeae [e.g. 3, 4, 5].
- an antigen from Chlamydia pneumoniae [e.g. 35, 36, 37, 38, 39, 40, 41].
- an antigen from Chlamydia trachomatis [e.g. 42].
- an antigen from Porphyromonas gingivalis [e.g. 43].
- polio antigen(s) [e.g. 44, 45] such as IPV or OPV.
- rabies antigen(s) [e.g. 46] such as lyophilised inactivated virus [e.g.47, RabAvert™]
- measles, mumps and/or rubella antigens [
e.g. chapters 9, 10 & 11 of ref. 33]. - influenza antigen(s) [e.g. chapter 19 of ref. 33], such as the haemagglutinin and/or neuraminidase surface proteins.
- an antigen from Moraxella catarrhalis [e.g. 48].
- a protein antigen from Streptococcus agalactiae (group B streptococcus) [e.g. 49, 50].
- a saccharide antigen from Streptococcus agalactiae
- an antigen from Streptococcus pyogenes (group A streptococcus) [e.g. 50, 51, 52].
- an antigen from Staphylococcus aureus [e.g. 53].
- The composition may comprise one or more of these further antigens.
- Where a saccharide or carbohydrate antigen is used, it is preferably conjugated to a carrier protein in order to enhance immunogenicity [e.g. refs. 54 to 63]. Preferred carrier proteins are bacterial toxins or toxoids, such as diphtheria or tetanus toxoids. The CRM197 diphtheria toxoid is particularly preferred. Other suitable carrier proteins include the N. meningitidis outer membrane protein [e.g. ref. 64], synthetic peptides [e.g. 65, 66], heat shock proteins [e.g. 67], pertussis proteins [e.g. 68, 69], protein D from H. influenzae [e.g. 70], toxin A or B from C. difficile [e.g. 71], etc. Where a mixture comprises capsular saccharides from both serogroups A and C, it is preferred that the ratio (w/w) of MenA saccharide:MenC saccharide is greater than 1 (e.g. 2:1, 3:1, 4:1, 5:1, 10:1 or higher). Saccharides from different serogroups of N. meningitidis may be conjugated to the same or different carrier proteins.
- Any suitable conjugation reaction can be used, with any suitable linker where necessary.
- Toxic protein antigens may be detoxified where necessary (e.g. detoxification of pertussis toxin by chemical and/or genetic means [32]).
- Where a diphtheria antigen is included in the composition it is preferred also to include tetanus antigen and pertussis antigens. Similarly, where a tetanus antigen is included it is preferred also to include diphtheria and pertussis antigens. Similarly, where a pertussis antigen is included it is preferred also to include diphtheria and tetanus antigens.
- Antigens are preferably mixed with (and more preferably adsorbed to) an aluminium salt (e.g. phosphate, hydroxide, hydroxyphosphate, oxyhydroxide, orthophosphate, sulphate). The salt may take any suitable form (e.g. gel, crystalline, amorphous etc.).
- Antigens in the composition will typically be present at a concentration of at least 1μg/ml each. In general, the concentration of any given antigen will be sufficient to elicit an immune response against that antigen.
- As an alternative to using proteins antigens in the composition of the invention, nucleic acid encoding the antigen may be used [e.g. refs. 72 to 80]. Protein components of the compositions of the invention may thus be replaced by nucleic acid (preferably DNA e.g. in the form of a plasmid) that encodes the protein.
- Definitions
- The term “comprising” means “including” as well as “consisting” e.g. a composition “comprising” X may consist exclusively of X or may include something additional e.g. X+Y.
- The term “about” in relation to a numerical value x means, for example, x±10%.
-
FIG. 1 shows an alignment of twenty-three sequences forprotein 741. These areSEQ IDs 1 to 22 plus the sequence from MC58. -
FIG. 2 shows an alignment of the NMB 1343 sequence from gonococcus (top; SEQ ID 25) and meningococcus (bottom; SEQ ID 26). -
FIG. 3 shows hybrid and tandem proteins of the invention. -
FIG. 4 shows 9 domains within 9612996, andFIG. 5 shows how these have been manipulated. - Hybrid Proteins—X1=ΔG287
- In addition to those disclosed in
references 1 & 2, seven hybrid proteins with ΔG287 from strain 2996 at the N-terminus were constructed. Eight 287 tandem proteins were also made (see below). -
# n X1 L1 X2 L2 1 2 ΔG287 — 230 (His)6 2 2 — 936 (His)6 3 2 — 741MC58 (His)6 4 2 — 741ET37 (His)6 5 2 — 74190/18311 (His)6 6 2 — 74195N477 (His)6 7 2 ΔG287nz — 741MC58 (His)6 - These proteins were adjuvanted with either Freund's complete adjuvant (FCA) or 3 mg/ml alum and used to immunise mice. The resulting sera were tested against various Neisserial strains using the bactericidal assay. Titres using protein #3 were as follows:
-
Strain(serogroup) 2996(B) MC58(B) NGH38(B) 394/98(B) 44/76(B) F6124(A) Al hydroxide 8192 32768 8192 >2048 16384 8192 FCA 16384 262144 8192 >2048 >32768 8192 - In further experiments using protein #3 adjuvanted with aluminium hydroxide, anti-287 and anti-741 ELISA titres each exceeded 984150 and BCA titres were as follows:
-
2996(B) MC58(B) NGH38(B) 394/98(B) 44/76(B) F6124(A) BZ133(C) 8000 65000 4000 4000 32000 8000 16000 - Results obtained after immunisation with proteins disclosed in refs. 1 & 2, tested against the homologous strain, were as follows:
-
Bactericidal titre ELISA n X1 L1 X2 L2 FCA Alum FCA Alum 2 ΔG287394/98 — 961 (His)6 — 32768 — >109350 919 32768 4096 4718 3678 953 >32768 >16384 1900 6936 741 16384 2048 232 862 2 ΔG2872996 — 961 (His)6 65536 32768 108627 >109350 919 128000 32000 11851 2581 953 65536 — 3834 — 741 16384 8192 315 4645 - Hybrid Proteins—X1=961c or 961cL
- In addition to those disclosed in
references 1 & 2, eight hybrid proteins with either 961c or 961cL (i.e. 961c+leader peptide) at the N-terminus were constructed: -
# n X1 L1 X2 L2 1 2 961c — 287 — 2 2 — 287 (His)6 3 2 — 230 (His)6 4 2 — 936 (His)6 5 2 961cL — 287 — 6 2 — 287 (His)6 7 2 — 230 (His)6 8 2 — 936 (His)6 - These proteins were adjuvanted with either Freund's complete adjuvant (FCA) or 3.3 mg/ml alum and used to immunise mice. The resulting sera were tested against various Neisserial strains using the bactericidal assay. Titres using
protein # 8 were as follows: -
Strain(serogroup) 2996(B) MC58(B) 394/98(B) 44/76(B) F6124(A) Al hydroxide 8192 8192 512 1024 <16 FCA 65536 16384 >2048 >2048 8192 - Titres obtained after immunisation with 961c-741 [refs. 1 & 2] were as follows:
-
Strain(serogroup) 2996(B) MC58(B) 394/98(B) 44/76(B) F6124(A) BZ133(C) Al hydroxide 65536 32768 4096 >32768 16384 >2048 FCA >16384 262144 4096 >16384 — >2048 - These results could be improved by mixing 961c-741 with ORF46.1 or with ΔG287-919.
- Results obtained after immunisation with proteins disclosed in refs. 1 & 2, tested against the homologous strain, were as follows:
-
Bactericidal titre ELISA n X1 L1 X2 L2 FCA Alum FCA Alum 2 961c — ORF46.1 (His)6 32768 1024 >109350 >109350 741 >16384 8192 >109350 >109350 936 >32768 8192 >109350 >109350 - Hybrid Proteins—X1=ORF46.1
- In addition to those disclosed in
references 1 & 2, two hybrid proteins with ORF46.1 at the N-terminus were constructed: -
# n X1 L1 X2 L2 1 2 ORF46.1 — 936 (His)6 2 2 — 230 (His)6 - These proteins were adjuvanted with either Freund's complete adjuvant (FCA) or 3 mg/ml alum and used to immunise mice. The resulting sera were tested against the homologous strain using the bactericidal assay and by ELISA.
- Results obtained after immunisation with proteins disclosed in refs. 1 & 2 were as follows:
-
Bacteri- cidal titre ELISA n X1 L1 X2 L2 FCA Alum FCA Alum 2 ORF46.1 — 961 (His)6 8192 8192 21558 >109350 — 961c (His)6 8192 128 9020 76545 - Hybrid Proteins—X1=230
- In addition to those disclosed in
references 1 & 2, four hybrid proteins with 230 at the N-terminus were constructed: -
# n X1 L1 X2 L2 1 2 230 — ORF46.1 (His)6 2 2 — 961 (His)6 3 2 — 961c (His)6 4 2 — 741MC58 (His)6 - Hybrid Proteins—Xj=936
- In addition to those disclosed in
references 1 & 2, seven hybrid proteins with 936 at the N-terminus were constructed: -
# n X1 L1 X2 L2 1 2 936 — ORF46.1 (His)6 2 2 — 961 (His)6 3 2 — 741ET37 (His)6 4 2 — 741MC58 (His)6 5 2 — 74190/18311 (His)6 6 2 — 74195N477 (His)6 7 2 — 741 (His)6 - These proteins were adjuvanted with either Freund's complete adjuvant (FCA) or 3 mg/ml alum and used to immunise mice. The resulting sera were tested against various Neisserial strains using the bactericidal assay. Titres using protein #2 were as follows:
-
Strain(serogroup) 2996(B) MC58(B) 394/98(B) 44/76(B) F6124(A) Al hydroxide 16384 32768 1024 2048 <16 FCA 65536 65536 >2048 8192 2048 (36%) - Titres using protein #4 were as follows:
-
Strain(serogroup) 2996(B) MC58(B) 394/98(B) 44/76(B) F6124(A) Al hydroxide 256 >262144 >2048 32768 8192 FCA 1024 >262144 >2048 >32768 >32768 - Titres using
protein # 7 were as follows: -
Strain(serogroup) 2996(B) MC58(B) 394/98(B) 44/76(B) F6124(A) BZ133(C) Al hydroxide 256 130000 16000 32000 8000 16000 - Results obtained after immunisation with proteins disclosed in refs. 1 & 2, tested against the homologous strain, were as follows:
-
Bactericidal titre ELISA n X1 L1 X2 L2 FCA Alum FCA Alum 2 936 — 741 (His)6 1024 256 1466 5715 936 >32768 >32768 >109350 >109350 - Mixtures of Hybrid Proteins
- Mice were immunised with of three proteins adjuvanted with aluminium hydroxide, either single or in a triple combination: (1) 287NZ-953; (2) 936-741; and (3) 961c. The mixture was able to induce high bactericidal titres against various strains:
-
2996(B) MC58(B) NGH38 394/98(B) H44/76(B) F6124(A) BZ133(C) C11(C) (1) 32000 16000 130000 16000 32000 8000 16000 8000 (2) 256 131000 128 16000 32000 8000 16000 <4 (3) 32000 8000 — — — 8000 — 32000 mix 32000 32000 65000 16000 260000 65000 >65000 8000 (X) 4000 4000 1000 1000 >4000 1000 4000 n.d. ‘—’ indicates that this strain contains no NadA gene (X) was a combination of protein 287 with outer membrane vesicles, for comparison - Looking at individual mice, the mixture induced high and consistent bactericidal titres:
-
# 1 2 3 4 5 6 7 8 9 10 2996 32768 16384 65536 32768 32768 65536 65536 32768 65536 8192 MC58 65536 32768 65536 65536 65536 8192 65536 32768 32768 65536 394/98 65536 4096 16384 4096 8192 4096 32768 16384 8192 16384 - Tandem Proteins
- Hybrid proteins of the invention can be represented by formula NH2—[—X-L-]n-COOH. Where all n instances of —X— are the same basic protein (either identical, or the same protein from different strains or species), the protein is referred to as a ‘tandem’ protein.
- Twelve specific tandem proteins are:
-
# n X1 L1 X2 L2 1 2 ΔG741MC58 — 741MC58 (His)6 2 2 ΔG2872996 (Gly)6 ΔG287394/98 (His)6 3 2 ΔG2872996 (Gly)6 ΔG2872996 (His)6 4 2 ΔG287394/98 (Gly)6 ΔG287394/98 (His)6 5 2 ΔG287394/98 (Gly)6 ΔG2872996 (His)6 6 2 ΔG2872996 (Gly)6 ΔG287394/98 — 7 2 ΔG2872996 (Gly)6 ΔG2872996 — 8 2 ΔG287394/98 (Gly)6 ΔG287394/98 — 9 2 ΔG287394/98 (Gly)6 ΔG2872996 — 10 2 ΔG741MC58 — 741394/98 (His)6 11 2 ΔG741MC58 — 74190/18311 (His)6 12 2 ΔG741MC58 — 74195N477 (His)6 -
Proteins # 1 to #5 have all been expressed in soluble form in E. coli. Expression levels were between 0.24 and 0.50 mg protein per litre of culture. The tandem proteins were purified and mixed with aluminium phosphate as an adjuvant. Tandem proteins #2, #4 and #5 adsorbed readily to aluminium phosphate; adsorption was less complete fortandem proteins # 1 and #3. - Allelic Variants—741
- Twenty-two polymorphic sequences of 741 were found (
SEQ IDs 1 to 22). These and the MC58 sequence are aligned inFIG. 1 . - Allelic Variants—NMB1343
- Using PCR on 42 strains of meningococcus of various serogroups, the gene encoding NMB1343 protein was found in 24/42 and was absent in 18/42 strains (Table 1). The NMB gene was sequenced for 10 of the NMB1343+ strains (Table 1, column 3). The nucleic acid sequence (and thus amino acid sequence SEQ ID 23; GenBank AAF41718) was identical in all 10 strains.
- NMB1343 was also detected in two strains of N. gonorrhoeae (F62 and SN4). The amino acid sequence from gonococcus is SEQ ID 24. An alignment with the meningococcal sequence is:
- An alignment of the corresponding nucleotide sequences is shown in
FIG. 2 . This shows that the gonococcal sequence has a 4 mer insertion in the 5′ region of the NMB1343 gene which causes a frameshift and consequent loss of the 5′ methionine residue. - Domain Deletion—961
- 961 is not present in the N. meningitidis serogroup A genome sequence [81], even though the surrounding regions are conserved (>90%) between serogroups A and B. References 11 and 12 disclose polymorphic forms of 961. The gene was found to be present in 91% of serogroup B strains belonging to hypervirulent lineages ET-5, ET-37 and cluster A4, but was absent in all strains of lineage 3 tested. Most of the serogroup C strains tested were positive even if not belonging to hypervirulent lineages. The same was true for the serogroup B strains with serotype 2a and 2b. For serogroup A, one strain belonging to subgroup III was positive whereas the other two strains belonging to subgroup IV-1 were negative. 961 was absent in N. gonorrhoeae and in commensal species N. lactamica and N. cinerea.
-
FIGS. 4 and 5 show domains inprotein 961. - When the anchor region (domain 9) of
protein 961 is deleted (‘961cL’) and expressed in E. coli, the protein is exported in the periplasm and secreted in the supernatant of the culture. - To investigate this further, deletion mutants in the C-terminal region of 961 were constructed (961cL-Δaro, 961cLΔcc, 961aL, 961aL-Δ1, 961aL-Δ2, 961aL-Δ3) on the basis of structural features (deletions of aromatic residues in the cases of 961cΔaro mutant, and of coiled-coil regions for the others). These were analysed for expression and secretion into the periplasm and the supernatant of the culture. In all of these deletion mutants, the protein is produced in large amount, is present in periplasmic fraction, and is released in the supernatant of the culture.
- ΔG287—Cross-Strain Bactericidal Activity
- 287 was cloned for five different N. meningitidis serogroup B strains and was manipulated to delete the N-terminus up to the end of the poly-glycine region and to introduce a C-terminal his-tag. This gave five ΔG287 proteins. These were adjuvanted with FCA and used to raise immune sera in mice, which were then tested for bactericidal activity against all five serogroup B strains and also against serogroup A and C strains. Bactericidal titres were as follows:
-
Protein Sera tested for bactericidal activity against strain* strain 2996 BZ232 MC58 1000 394/98 F6124 BZ133 2996 16000 128 4096 4096 1024 8000 16000 BZ232 >8000 256 2048 8000 2048 16000 8000 MC58 >8000 64 >8000 8000 2048 8000 8000 1000 >8000 64 4096 8000 1024 16000 16000 394/98 >16000 128 16000 >2048 >16000 — — *titres against homologous strain shown in bold - Refolding
- To improve the levels of soluble protein for some hybrid proteins, alternative refolding protocols to those disclosed in reference 2 were adopted.
- Inclusion Bodies (IBs) Were Isolated as Follows:
-
- 1. Homogenize cells (5 g wet weight) in 25 ml 0.1 M Tris-
HCl pH - 2. Add 1.5 mg lysozyme per gram cells, mix shortly with an ultraturrax, and incubate at 4° C. for 30 min.
- 3. Use sonication or high-pressure homogenization (French press) to disrupt the cells.
- 4. To digest DNA, add MgCl2 to a final concentration of 3 mM and DNase to a final concentration of 10 μg/ml, and incubate for 30 min at 25° C.
- 5. Add 0.5 vol. 60 mM EDTA, 6% Triton X-100, 1,5M NaCl pH7, to the solution, and incubate for 30 min at 4° C.
- 6. Spin down inclusion bodies by centrifugation at 31000 g (20 000 rpm) for 10 min, 4° C.
- 7. Resuspend pellet in 40 ml 0.1 M tris-
HCl pH - 8. Repeat centrifugation step 6.
- 9. The inclusion body pellet may be used, or stored frozen at −20° C.
- 1. Homogenize cells (5 g wet weight) in 25 ml 0.1 M Tris-
- Hybrid proteins were expressed in E. coli as follows:
-
Culture Flask Inclusion volume volume Temp Final body yield Protein (liters) (liters) (° C.) OD600 (w/w) ORF46.1-961-His 1 2 37 1.51 33.2% ORF46.1-961c-His 1 2 37 1.6 28.3% 961c- ORF46.1His 1 2 37 1.18 23.5% orf46.1-741 His 5 5 37 12.42 35.2 - The pellets were solubilised, refolded, ultrafiltered, dialysed, and protein was then purified:
- ORF46.1-961-His IBs were solubilised as follows: IB proteins were resuspended in 4 ml of 6M guanidine HCl, 1 mM EDTA pH 8.5 buffer, to a final protein concentration of 1 mg/ml. To refold the protein, 2 ml of solubilised protein was diluted in 400 ml of refolding buffer (0.1M Tris HCl, 1M L-arginine, 2 mM EDTA pH 8.2) and incubated for 1 hour at 15° C., resulting in a protein concentration of 5 μg/ml. Subsequently, another 2 ml of the solubilised protein was added and incubated for an additional hour at the same temperature resulting in a final protein concentration of 10 μg/ml. The material was ultrafiltered using a 300 ml Amicon ultrafiltration cell (8400), applying a 3 bar pressure on an Amicon membrane with a 30 kDa cut-off (YM30) resulting in 130 ml final volume. The ultrafiltered material was dialysed using a regenerated cellulose tubular membrane with a 12-14 kDa cutoff (Cellusep—Step bio) for 24 hours against 10 L of 0.1M Tris HCl pH 8.2 buffer. A second dialysis of 24 h against 10 L of 300 mM NaCl, 50 mM sodium phosphate pH 8.0 buffer was performed. The dialysed material was centrifuged at 22000 rpm for 45 minutes at 4° C. in a Beckman centrifuge rotor JA25.5 The supernatant isolated after centrifugation was used for His-tag purification.
- orf 46.1-961c-His IBs were solubilised as follows: IB proteins were resuspended in 4 ml of 6M guanidine HCl, 1 mM EDTA pH 8.5 buffer, to a final protein concentration of 1 mg/ml. To refold the protein, 2 ml of the solubilised protein was diluted in 400 ml refolding buffer (0.5M Tris HCl, 1M L-arginine, 2 mM EDTA pH 8.2) and incubated for 1 h at 15° C., resulting in a protein concentration of 5 μg/ml. Subsequently another 2 ml of the solubilised protein was added and incubated for an additional hour at the same temperature resulting in a final protein concentration of 10 μg/ml. The material was ultrafiltered using a 300 ml Amicon ultrafiltration cell (8400), applying a 3 bar pressure on an Amicon membrane with a 30 kDa cut-off (YM30) resulting in 150 ml final volume. The ultrafiltered material was dialysed using a regenerated cellulose tubular membrane with a 12-14 kDa cutoff (Cellusep—Step bio) for 24 h against 10 L of 0.1M Tris HCl pH 8.2 buffer. A second dialysis of 24 h against 10 L of 300 mM NaCl, 50 mM sodium phosphate pH 8.0 buffer was performed. The dialysed material was centrifuged at 22000 rpm for 45 minutes at 4° C. in a Beckman centrifuge rotor JA25.5. The supernatant isolated after centrifugation was used for His-tag purification.
- 961c-orf46.1-His IBs were solubilised as follows: IB proteins were resuspended in 4 ml of 6M guanidine HCl, 1 mM EDTA pH 8.5 buffer, to a final protein concentration of 1 mg/ml. To refold the protein, 2 ml of the solubilised protein was diluted in 400 ml refolding buffer (0.1M Tris HCl, 0.5 M L-arginine,2 mM EDTA pH 8.2) and incubated for 1 h at 15° C., resulting in a protein concentration of 5 μg/ml. Subsequently another 2 ml of the solubilized protein was added and incubated for an additional hour at the same temperature resulting in a final protein concentration of 10 μg/ml. The material was ultrafiltered using a 300 ml Amicon ultrafiltration cell (8400), applying a 3 bar pressure on an Amicon membrane with a 30 kDa cut-off (YM30) resulting in 150 ml final volume. The ultrafiltered material was dialysed using a regenerated cellulose tubular membrane with a 12-14 kDa cutoff (Cellusep—Step bio) for 24 h against 10 L of 0.1 M Tris HCl pH 8.2 buffer. A second dialysis of 24 h against 10 L of 300 mM NaCl, 50 mM sodium phosphate pH 8.0 buffer was performed. The dialysed material was centrifuged at 22000 rpm for 45 minutes at 4° C. in a Beckman centrifuge rotor JA25.5. The supernatant isolated after centrifugation was used for His-tag purification.
- orf46.1-741-His IBs were solubilised as follows: IB proteins were resuspended in 4 ml of 6M guanidine HCl, 1 mM EDTA pH 8.5 buffer, to a final protein concentration of 10 mg/ml. To refold, 2 ml of the solubilised protein was diluted in 400 ml of the refolding buffer (0.5M Tris HCl, 0.7 M L-arginine, 2 mM EDTA pH 7.2) and incubated for 1 h at 15° C., resulting in a protein concentration of 50 μg/ml. Subsequently another 2 ml of the solubilised protein was added and incubated for an additional hour at the same temperature resulting in a final protein concentration of 100 μg/ml. The material was ultrafiltered using a 300 ml Amicon ultrafiltration cell (8400), applying a 3 bar pressure on an Amicon membrane with a 30 kDa cut-off (YM30) resulting in 120 ml final volume. The ultrafiltered material was dialysed using a regenerated cellulose tubular membrane with a 12-14 kDa cutoff (Cellusep—Step bio) for 24 h against 10 L of 0.1M Tris HCl pH 8.2 buffer. A second dialysis of 24 h against 10 L of 300 mM NaCl, 50 mM sodium phosphate pH 8.0 buffer was performed. The dialysed material was centrifuged at 22000 rpm for 45 minutes at 4° C. in a Beckman centrifuge rotor JA25.5 The supernatant isolated after centrifugation was used for His-tag purification.
- Compared with proteins purified as described in ref. 2, bactericidal assay titres were as follows:
-
Reference 2 Refolded Alumin- Alumin- Alumin- ium ium ium hydrox- hydrox- phos- Protein CFA ide ide MF59 phate ORF46.1-961-His 8192 8192 32768 — — ORF46.1-961c-His 8192 128 <64 8192 — 961c-ORF46.1His 32768 1024 16384 — — orf46.1-741 His <4 16 <4 256 — - Similar procedures were used for ORF46.1 to purify the protein from IBs when expressed with no His-tag (‘ORF46.1K’):
-
Culture Flask Inclusion volume volume Temp Final body yield Protein (liters) (liters) (° C.) OD600 (w/w) orf46.1K 5 5 37 13.7 29.4 - IB proteins were resuspended in 4 ml of 6M guanidine HCl, 1 mM EDTA pH 8.5 buffer, to a final protein concentration of 10 mg/ml. To refold, 2 ml of the solubilised protein was diluted in 400 ml of the refolding buffer (0.5M Tris HCl, 0.7 M L-arginine,2 mM EDTA pH 7.2) and incubated for 1 hours at 15° C., resulting in a protein concentration of 50μg/ml. Subsequently another 2 ml of the solubilised protein was added and incubated for an additional hour at the same temperature resulting in a final protein concentration of 100 m/ml. The material was ultrafiltered using a 300 ml Amicon ultrafiltration cell (8400), applying a 3 bar pressure on an Amicon membrane with a 30 kDa cut-off (YM30) resulting in 120 ml final volume. The ultrafiltered material was dialysed using a regenerated cellulose tubular membrane with a 12-14 kDa cutoff (Cellusep—Step bio) for 12 h against 10 L of 50 mM sodium phosphate, 2 mM EDTA, pH 7.2 buffer. A second dialysis of 24 h against 10 L of the same buffer was performed. The dialysed material was centrifuged at 22000 rpm for 45 minutes at 4° C. in a Beckman centrifuge rotor JA25.5. The supernatant isolated after centrifugation was used for cationic exchange chromatography. The purification was done on a AKTA explorer chromatography system (Amersham-Pharmacia Biotech) using a 5 ml HiTrap SP sepharose HP column (Amersham-Pharmacia Biotech). The flow rate applied was of 1.5 ml per minute. The column was washed with 35 ml of 50 mM sodium phosphate buffer pH 7.2. A linear gradient (0-1 M NaCl) was performed using a 50 mM sodium phosphate buffer pH 7.2. The protein eluted in two peaks at 92 mM and 380 mM NaCl. The fractions constituting each peak were pooled and respectively named
pool 1 and pool 2. - Compared with proteins purified as described in ref. 2, bactericidal assay titres when adjuvanted with aluminium hydroxide were improved from <4 to 1024. The titre using aluminium phosphate adjuvant with the refolded protein was 2048. ELISA titres were as follows:
-
Elisa SBA Protein Aluminium adjuvant (M7) (2996) Orf46.1k (pool 1) Hydroxide 3.3 mg/ml 1212 512 Phosphate 0.6 mg/ml 154 1024 Orf46.1k (pool 2) Hydroxide 3.3 mg/ml 1085 1024 Phosphate 0.6 mg/ ml 250 1024 - It will be understood that the invention has been described by way of example only and modifications may be made whilst remaining within the scope and spirit of the invention.
-
TABLE 1 Strain 1343 Sequence Strain classification 72/00 + ET5 B:15:P1.7, 13, 13a 30/00 + ET5 B:15:P1.7, 16 39/99 + ET5 C:15:P1.7, 16 95330 + ET5 B:4:P1.15 M4102 + ET5 nd MC58(21) + + ET5 B:15:P1.7, 16b BZ169(7) + + ET5 B:NT:P1.16 BZ83(19) + ET5 B:15:—.— CU385 + + ET5 B:4:P1.15 220173I + ET5 NG:4:P1.15 64/96 + + ET5 NG:15:P1.7, 16 (carrier) 220173I + ET5 B:4:P1.15 (carrier) ISS1071 + nd B:15:P1.7, 16 (ET5?) BZ198(2) + + lin.3 B:8:P1.1 980-2543 + + lin.3 B:NT:P1.4 16060 + + other B:4:P1.14 (carrier) 394-98 + nd B:4:P1.4 (lin 3?) ISS1106 + nd B:4:P1.4 (lin.3?) BZ133(10) + + sub I B:NT:—.— S3446 + + nd B:14:P1.23, 14 ISS1001 + + nd B:14:P1.13 241175I + other NG:21:P1.16 (carrier) 171274I + other NG:15:— (carrier) 66/96 + other B:17:P1.15 (carrier) 961-5945 − A4 96217 − A4 312294 − A4 90/18311(24) − ET37 93/4286(25) − ET37 M986 − ET37 1000(5) − other NGE28(13) − other carrier NGH38(14) − other carrier BZ232(18) − other F6124(23) − sub III A:—.— C11 − C:— NMB − nd 8047 − nd ISS759 − nd C:2b:P1.2 ISS1113 − nd C:2:P1.5 65/96 − nd 4:P1.14 2996(96) − nd B:2b:P1.5, 2 -
- 1—International patent application WO01/64920.
- 2—International patent application WO01/64922.
- 3—International patent application WO99/24578.
- 4—International patent application WO99/36544.
- 5—International patent application WO99/57280.
- 6—International patent application WO00/22430.
- 7—Tettelin et al. (2000) Science 287:1809-1815.
- 8—International patent application WO00/66741.
- 9—International patent application WO00/71574.
- 10—International patent application WO01/04316
- 11—International patent application PCT/IB02/03396.
- 12—Comanducci et al. (2002) J Exp Med 195:1445-1454.
- 13—Vaccine Design: subunit & adjuvant approach (1995) Powell & Newman (ISBN: 030644867X).
- 14—International patent application WO01/52885.
- 15—Bjune et al. (1991) Lancet 338(8775):1093-1096.
- 16—Fukasawa et al. (1999) Vaccine 17:2951-2958.
- 17—Rosenqvist et al. (1998) Dev. Biol. Stand. 92:323-333.
- 18—Costantino et al. (1992) Vaccine 10:691-698.
- 19—Costantino et al. (1999) Vaccine 17:1251-1263.
- 20—International patent application PCT/IB02/03191.
- 21—Watson (2000) Pediatr Infect Dis J 19:331-332.
- 22—Rubin (2000) Pediatr Clin North Am 47:269-285, v.
- 23—Jedrzejas (2001) Microbiol Mol Biol Rev 65:187-207.
- 24—International patent application WO93/18150.
- 25—International patent application WO99/53310.
- 26—International patent application WO98/04702.
- 27—Bell (2000) Pediatr Infect Dis J 19:1187-1188.
- 28—Iwarson (1995) APMIS 103:321-326.
- 29—Gerlich et al. (1990)
Vaccine 8 Suppl:S63-68 & 79-80. - 30—Hsu et al. (1999) Clin Liver Dis 3:901-915.
- 31—Gustafsson et al. (1996) N. Engl. J. Med. 334:349-355.
- 32—Rappuoli et al. (1991) TIBTECH 9:232-238.
- 33—Vaccines (1988) eds. Plotkin & Mortimer. ISBN 0-7216-1946-0.
- 34—Del Guidice et al. (1998) Molecular Aspects of Medicine 19:1-70.
- 35—International patent application WO02/02606.
- 36—Kalman et al. (1999) Nature Genetics 21:385-389.
- 37—Read et al. (2000) Nucleic Acids Res 28:1397-406.
- 38—Shirai et al. (2000) J. Infect. Dis. 181(Suppl 3):S524-S527.
- 39—International patent application WO99/27105.
- 40—International patent application WO00/27994.
- 41—International patent application WO00/37494.
- 42—International patent application WO99/28475.
- 43—Ross et al. (2001) Vaccine 19:4135-4142.
- 44—Sutter et al. (2000) Pediatr Clin North Am 47:287-308.
- 45—Zimmerman & Spann (1999) Am Fam Physician 59:113-118, 125-126.
- 46—Dreesen (1997) Vaccine 15 Suppl:S2-6.
- 47—MMWR Morb Mortal Wkly Rep 1998 Jan. 16; 47(1):12, 19.
- 48—McMichael (2000) Vaccine 19 Suppl 1:S101-107.
- 49—Schuchat (1999) Lancet 353(9146):51-6.
- 50—WO02/34771.
- 51—Dale (1999) Infect Dis Clin North Am 13:227-43, viii.
- 52—Ferretti et al. (2001) PNAS USA 98: 4658-4663.
- 53—Kuroda et al. (2001) Lancet 357(9264):1225-1240; see also pages 1218-1219.
- 54—Ramsay et al. (2001) Lancet 357(9251):195-196.
- 55—Lindberg (1999) Vaccine 17 Suppl 2:S28-36.
- 56—Buttery & Moxon (2000) J R Coll Physicians Lond 34:163-168.
- 57—Ahmad & Chapnick (1999) Infect Dis Clin North Am 13:113-133, vii.
- 58—Goldblatt (1998) J. Med. Microbiol. 47:563-567.
- 59—European patent 0 477 508.
- 60—U.S. Pat. No. 5,306,492.
- 61—International patent application WO98/42721.
- 62—Conjugate Vaccines (eds. Cruse et al.) ISBN 3805549326, particularly vol. 10:48-114.
- 63—Hermanson (1996) Bioconjugate Techniques ISBN: 0123423368 or 012342335X.
- 64—European patent application 0372501.
- 65—European patent application 0378881.
- 66—European patent application 0427347.
- 67—International patent application WO93/17712.
- 68—International patent application WO98/58668.
- 69—European patent application 0471177.
- 70—International patent application WO00/56360.
- 71—International patent application WO00/61761.
- 72—Robinson & Torres (1997) Seminars in Immunology 9:271-283.
- 73—Donnelly et al. (1997) Annu Rev Immunol 15:617-648.
- 74—Scott-Taylor & Dalgleish (2000) Expert Opin Investig Drugs 9:471-480.
- 75—Apostolopoulos & Plebanski (2000) Curr Opin Mol Ther 2:441-447.
- 76—Ilan (1999) Curr Opin Mol Ther 1:116-120.
- 77—Dubensky et al. (2000) Mol Med 6:723-732.
- 78—Robinson & Pertmer (2000) Adv Virus Res 55:1-74.
- 79—Donnelly et al. (2000) Am J Respir Crit Care Med 162(4 Pt 2):S190-193.
- 80—Davis (1999) Mt. Sinai J. Med. 66:84-90.
- 81—Parkhill et al. (2000) Nature 404:502-506.
-
SEQUENCE LISTING 741 from strain 1000 SEQ ID 1 MTRSKPVNRTAFCCLSLTAALILTACSSGGGGVAADIGAGLADAL TTPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT GKLKNDKVSRFDFIRQIEVDGQTITLASGEFQIYKQNHSAVVALQ IEKINNPDKIDSLINQRSFLVSGLGGEHTAFNQLPDGKAEYHGKA FSSDDPNGRLHYSIDFTKKQGYGRIEHLKTPEQNVELASAELKAD EKSHAVILGDTRYGGEEKGTYHLALFGDRAQEIAGSATVKIREKV HEIGIAGKQ 741 from strain 2201731 (premature stop codon, though reliable sequence) SEQ ID 2 MTRSKPVNRTAFCCLSLTTALILTACSSGGGGVAADIGAGLADAL TAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT GKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQ TEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGT AFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKP DGKRHAVISGSVLYNQAEKGSYSLGIFGGKA 741 from strain 90/18311 (incomplete) SEQ ID 3 GLADALTAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGN GDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQIYKQDHS AVVALQIEKINNPDKIDSLINQRSFLVSGLGGEHTAFNQLPSGKA EYHGKAFSSDDPNGRLHYSIDFTKKQGYGRIEHLKTPEQNVELAS AELKADEKSHAVILGDTRYGGEEKGTYHLALFGDRAQEIAGSATV KIREKVHET 741 from strain L93/4286 (incomplete) SEQ ID 4 VAADIGAGLADALTAPLDHKDKGLQSLMLDQSVRKNEKLKLAAQG AEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQTITLASGEFQ IYKQNHSAVVALQIEKINNPDKIDSLINQRSFLVSGLGGEHTAFN QLPDGKAEYHGKAFSSDDPNGRLHYSIDFTKKQGYGRIEHLKTPE QNVELASAELKADEKSHAVILGDTRYGGEEKGTYHLALFGDRAQE IAGSATVKIREKVHEIGIAGKQ 741 from strain 2996 SEQ ID 5 MTRSKPVNRTAFCCLSLTAALILTACSSGGGGVAADIGAGLADAL TAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT GKLKNDKVSRFDFIRQIEVDGQLITLESGEFQIYKQDHSAVVALQ IEKINNPDKIDSLINQRSFLVSGLGGEHTAFNQLPDGKAEYHGKA FSSDDAGGKLTYTIDFAAKQGHGKIEHLKTPEQNVELAAAELKAD EKSHAVILGDTRYGSEEKGTYHLALFGDRAQEIAGSATVKIGEKV HEIGIAGKQ 741 from strain 30/00 SEQ ID 6 KDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKND KVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQD SEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDD AGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHA VISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGL AAKQ 741 from strain 312294 SEQ ID 7 MTRSKPVNRTAFCCLSLTAALILTACSSGGGGVAADIGAGLADAL TAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT GKLKNDKVSRFDFIRQIEVDGQLITLESGEFQIYKQDHSAVVALQ IEKINNPDKIDSLINQRSFLVSGLGGEHTAFNQLPDGKAEYHGKA FSSDDAGGKLTYTIDFAAKQGHGKIEHLKTPEQNVELAAAELKAD EKSHAVILGDTRYGSEEKGTYHLALFGDRAQEIAGSATVKIGEKV HEIGIAGKQ 741 from strain 39/99 (incomplete) SEQ ID 8 DKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDK VSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDS EHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDA GGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAV ISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLA AKQ 741 from strain 5/99 SEQ ID 9 MTRSKPVNRTAFCCLSLTAALILTACSSGGGGVAADIGAGLADAL TAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT GKLKNDKVSRFDFIRQIEVDGQLITLESGEFQIYKQDHSAVVALQ IEKINNPDKIDSLINQRSFLVSGLGGEHTAFNQLPSGKAEYHGKA FSSDDPNGRLHYSIDFTKKQGYGRIEHLKTPEQNVELASAELKAD EKSHAVILGDTRYGGEEKGTYHLALFGDRAQEIAGSATVKIREKV HEIGIAGKQ 741 from strain 67/00 SEQ ID 10 MTRSKPVNRTAFCCFSLTAALILTACSSGGGGVAADIGAGLADAL TAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT GKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTALQ TEQEQDPEHSGKMVAKRRFKIGDIAGEHTSFDKLPKDVMATYRGT AFGSDDAGGKLTYTIDFAAKQGHGKIEHLKSPELNVELATAYIKP DEKHHAVISGSVLYNQDEKGSYSLGIFGGQAQEVAGSAEVETANG IHHIGLAAKQ 741 from strain BZ169 SEQ ID 11 LQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSR FDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHS GKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGK LTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISG SVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQ 741 from strain 72/00 SEQ ID 12 LQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSR FDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHS GKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGK LTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISG SVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQ 741 from strain 93/114 SEQ ID 13 MTRSKPVNRTAFCCFSLTAALILTACSSGGGGVAADIGAGLADAL TAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT GKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTALQ TEQEQDPEHSGKMVAKRRFKIGDIAGEHTSFDKLPKDVMATYRGT AFGSDDAGGKLTYTIDFAAKQGHGKIEHLKSPELNVELATAYIKP DEKHHAVISGSVLYNQDEKGSYSLGIFGGQAQEVAGSAEVETANG IHHIGLAAKQ 741 from strain 95N477 SEQ ID 14 MTRSKPVNRTAFCCLSLTAALILTACSSGGGGVAADIGAGLADAL TAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT GKLKNDKVSRFDFIRQIEVDGQLITLESGEFQIYKQDHSAVVALQ IEKINNPDKIDSLINQRSFLVSGLGGEHTAFNQLPSGKAEYHGKA FSSDDPNGRLHYSIDFTKKQGYGRIEHLKTPEQNVELASAELKAD EKSHAVILGDTRYGGEEKGTYHLALFGDRAQEIAGSATVKIREKV HEIGIAGKQ 741 from strain 96217 SEQ ID 15 MTRSKPVNRTAFCCLSLTAALILTACSSGGGGVAADIGAGLADAL TAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT GKLKNDKVSRFDFIRQIEVDGQLITLESGEFQIYKQDHSAVVALQ IEKINNPDKIDSLINQRSFLVSGLGGEHTAFNQLPDGKAEYHGKA FSSDDAGGKLTYTIDFAAKQGHGKIEHLKTPEQNVELAAAELKAD EKSHAVILGDTRYGSEEKGTYHLALFGDRAQEIAGSATVKIGEKV HEIGIAGKQ 741 from strain BZ133 SEQ ID 16 MTRSKPVNRTAFCCLSLTAALILTACSSGGGGVAADIGAGLADAL TAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT GKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTALQ TEQVQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGT AFGSDDASGKLTYTIDFAAKQGHGKIEHLKSPELNVDLAASDIKP DKKRHAVISGSVLYNQAEKGSYSLGIFGGQAQEVAGSAEVETANG IRHIGLAAKQ 741 from strain BZ232 SEQ ID 17 MTRSKPVNRTAFCCLSLTAALILTACSSGGGGVAADIGAGLADAL TAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT GKLKNDKVSRFDFIRQIEVDGQTITLASGEFQIYKQNHSAVVALQ IEKINNPDKIDSLINQRSFLVSGLGGEHTAFNQLPDGKAEYHGKA FSSDDPNGRLHYSIDFTKKQGYGRIEHLKTPEQNVELASAELKAD EKSHAVILGDTRYGGEEKGTYHLALFGDRAQEIAGSATVKIREKV HEIGIAGKQ 741 from strain C11 SEQ ID 18 MTRSKPVNRTAFCCLSLTAALILTACSSGGGGVAADIGAGLADAL TAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT GKLKNDKVSRFDFIRQIEVDGQLITLESGEFQIYKQDHSAVVALQ IEKINNPDKIDSLINQRSFLVSGLGGEHTAFNQLPSGKAEYHGKA FSSDDPNGRLHYSIDFTKKQGYGRIEHLKTPEQNVELASAELKAD EKSHAVILGDTRYGGEEKGTYHLALFGDRAQEIAGSATVKIREKV HEIGIAGKQ 741 from strain M1090 SEQ ID 19 MTRSKPVNRTAFCCLSLTAALILTACSSGGGGVAADIGAGLADAL TAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT GKLKNDKVSRFDFIRQIEVDGQLITLESGEFQIYKQDHSAVVALQ IEKINNPDKIDSLINQRSFLVSGLGGEHTAFNQLPSGKAEYHGKA FSSDDAGGKLTYTIDFAAKQGHGKIEHLKTPEQNVELASAELKAD EKSHAVILGDTRYGGEEKGTYHLALFGDRAQEIAGSATVKIREKV HEIGIAGKQ 741 from strain M1096 SEQ ID 20 MTRSKPVNRTAFCCLSLTAALILTACSSGGGGVAADIGAGLADAL TTPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT GKLKNDKVSRFDFIRQIEVDGQTITLASGEFQIYKQNHSAVVALQ IEKINNPDKIDSLINQRSFLVSGLGGEHTAFNQLPDGKAEYHGKA FSSDDPNGRLHYSIDFTKKQGYGRIEHLKTPEQNVELASAELKAD EKSHAVILGDTRYGGEEKGTYHLALFGDRAQEIAGSATVKIREKV HEIGIAGKQ 741 from strain M198/172 SEQ ID 21 MTRSKPVNRTAFCCLSLTAALILTACSSGGGGVAADIGAGLADAL TAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT GKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTALQ TEQVQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGT AFGSDDASGKLTYTIDFAAKQGHGKIEHLKSPELNVDLAASDIKP DKKRHAVISGSVLYNQAEKGSYSLGIFGGQAQEVAGSAEVETANG IRHIGLAAKQ 741 from strain NGH38 SEQ ID 22 MTRSKPVNRTAFCCLSLTAALILTACSSGGGGVAADIGAGLADAL TAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNT GKLKNDKVSRFDFIRQIEVDGQTITLASGEFQIYKQNHSAVVALQ IEKINNPDKIDSLINQRSFLVSGLGGEHTAFNQLPDGKAEYHGKA FSSDDPNGRLHYSIDFTKKQGYGRIEHLKTPEQNVELASAELKAD EKSHAVILGDTRYGGEEKGTYHLALFGDRAQEIAGSATVKIREKV HEIGIAGKQ NMB1343 from ten meningococcal strains SEQ ID 23 MGNFLYRGISCQQDEQNNGQLKPKGNKAEVAIRYDGKFKYDGKAT HGPSVKNAVYAHQIETGLYDGCYISTTTDKEIAKKFATSSGIENG YIYVLNRDLFGQYSIFEYEVEHPENPNEKEVTIRAEDCGCIPEEV IIAKELIEIN NMB1343 from gonococcus SEQ ID 24 INNLWEISYLYRGISCQQDEQNNGQLKPKGNKAEVAIRYDGKFKY DGKATHGPSVKNAVYAHQIETDLYDGCYISTTTDKEIAKKFATSS GIENGYIYVLNRDLFGQYSIFEYEVEHPENPDEKEVTIRAEDCGC IPEEVIIAKELIEIN NMB1343 nucleic acid sequence (gonococcus) SEQ ID 25 TCCGCCGCATTACCTTATAAAATAAAACATCCCTCTCAAGCAGTC TGATAATGTTTGGATTGCTTGAGATTGATGAGTGATGGTGTTAAA TTCAAACTTTAAATTAATAACTTATGGGAAATTTCTTATTTATAT AGAGGCATTAGTTGCCAACAAGATGAGCAAAATAATGGACAGTTA AAACCTAAAGGTAATAAAGCTGAAGTTGCAATTCGTTATGATGGT AAGTTTAAATATGATGGTAAAGCTACACATGGTCCAAGTGTGAAG AATGCAGTTTACGCCCATCAAATTGAAACAGATCTATATGACGGA TGTTATATATCTACGACAACAGACAAGGAAATTGCCAAGAAATTT GCAACAAGCTCCGGCATCGAAAATGGCTATATATATGTTTTAAAT AGAGATTTGTTTGGTCAATATTCTATTTTTGAATATGAGGTTGAA CATCCAGAAAACCCAGATGAGAAGGAAGTAACAATCAGAGCTGAA GATTGTGGCTGTATTCCTGAAGAAGTGATTATTGCTAAAGAGTTG ATAGAAATTAACTAAGTTGAAAGGTCAATATAATGGCTTTAGTTG AATTGAAAGTGCCCGACATTGGCGGACACGAAAATGTAGATATTA TCGC NMB1343 nucleic acid sequence (meningococcus) SEQ ID 26 TCCGCCGCATTACCTTATAAAATAAAACATCCCTCTCAAGCAGTC TGATAATGTTTGGATTGCTTGAGATTGATGAGTAATGGTGTTAAA TTCAACCTTTAAATTAATAACTTATGGGAAATTTCTTATATAGAG GCATTAGTTGCCAACAAGATGAGCAAAATAATGGACAGTTAAAAC CTAAAGGTAATAAAGCTGAAGTTGCAATTCGTTATGATGGTAAGT TTAAATATGATGGTAAAGCTACACATGGTCCAAGTGTGAAGAATG CAGTTTACGCCCATCAAATTGAAACAGGTCTATATGACGGATGTT ATATATCTACGACAACAGACAAGGAAATTGCCAAGAAATTTGCAA CAAGTTCCGGCATCGAAAATGGCTATATATATGTTTTAAATAGGG ATTTGTTTGGTCAATATTCTATTTTTGAATATGAGGTTGAACATC CAGAAAACCCAAATGAGAAGGAAGTAACAATCAGAGCTGAAGATT GTGGCTGTATTCCTGAAGAAGTGATTATTGCTAAAGAGTTGATAG AAATTAACTAAGTTGAAAGGTCAATATAATGGCTTTAGTTGAATT GAAAGTGCCCGACATTGGCGGACACGAAAATGTAGATATTATCGC linker SEQ ID 27 GSGGGG preferred ΔG287NZ-953 hybrid SEQ ID 28 MASPDVKSADTLSKPAAPVVAEKETEVKEDAPQAGSQGQGAPSTQ GSQDMAAVSAENTGNGGAATTDKPKNEDEGPQNDMPQNSAESANQ TGNNQPADSSDSAPASNPAPANGGSNFGRVDLANGVLIDGPSQNI TLTHCKGDSCNGDNLLDEEAPSKSEFENLNESERIEKYKKDGKSD KFTNLVATAVQANGTNKYVIIYKDKSASSSSARFRRSARSRRSLP AEMPLIPVNQADTLIVDGEAVSLTGHSGNIFAPEGNYRYLTYGAE KLPGGSYALRVQGEPAKGEMLAGTAVYNGEVLHFHTENGRPYPTR GRFAAKVDFGSKSVDGIIDSGDDLHMGTQKFKAAIDGNGFKGTWT ENGGGDVSGRFYGPAGEEVAGKYSYRPTDAEKGGFGVFAGKKEQD GSGGGGATYKVDEYHANARFAIDHFNTSTNVGGFYGLTGSVEFDQ AKRDGKIDITIPVANLQSGSQHFTDHLKSADIFDAAQYPDIRFVS TKFNFNGKKLVSVDGNLTMHGKTAPVKLKAEKFNCYQSPMAKTEV CGGDFSTTIDRTKWGVDYLVNVGMTKSVRIDIQIEAAKQ ΔG287NZ-953 hybrid SEQ ID 29 MASPDVKSADTLSKPAAPVVSEKETEAKEDAPQAGSQGQGAPSAQ GGQDMAAVSEENTGNGGAAATDKPKNEDEGAQNDMPQNAADTDSL TPNHTPASNMPAGNMENQAPDAGESEQPANQPDMANTADGMQGDD PSAGGENAGNTAAQGTNQAENNQTAGSQNPASSTNPSATNSGGDF GRTNVGNSVVIDGPSQNITLTHCKGDSCSGNNFLDEEVQLKSEFE KLSDADKISNYKKDGKNDGKNDKFVGLVADSVQMKGINQYIIFYK PKPTSFARFRRSARSRRSLPAEMPLIPVNQADTLIVDGEAVSLTG HSGNIFAPEGNYRYLTYGAEKLPGGSYALRVQGEPSKGEMLAGTA VYNGEVLHFHTENGRPSPSRGRFAAKVDFGSKSVDGIIDSGDGLH MGTQKFKAAIDGNGFKGTWTENGGGDVSGKFYGPAGEEVAGKYSY RPTDAEKGGFGVFAGKKEQDGSGGGGATYKVDEYHANARFAIDHF NTSTNVGGFYGLTGSVEFDQAKRDGKIDITIPVANLQSGSQHFTD HLKSADIFDAAQYPDIRFVSTKFNFNGKKLVSVDGNLTMHGKTAP VKLKAEKFNCYQSPMAKTEVCGGDFSTTIDRTKWGVDYLVNVGMT KSVRIDIQIEAAKQ 936-ΔG741 hybrid SEQ ID 30 MKPKPHTVRTLIAAIFSLALSGCVSAVIGSAAVGAKSAVDRRTTG AQTDDNVMALRIETTARSYLRQNNQTKGYTPQISVVGYNRHLLLL GQVATEGEKQFVGQIARSEQAAEGVYNYITVASLPRTAGDIAGDT WNTSKVRATLLGISPATQARVKIVTYGNVTYVMGILTPEEQAQIT QKVSTTVGVQKVITLYQNYVQRGSGGGGVAADIGAGLADALTAPL DHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLK NDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQI QDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGS DDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKR HAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHI GLAAKQ 961c SEQ ID 31 MATNDDDVKKAATVAIAAAYNNGQEINGFKAGETIYDIDEDGTIT KKDATAADVEADDFKGLGLKKVVTNLTKTVNENKQNVDAKVKAAE SEIEKLTTKLADTDAALADTDAALDATTNALNKLGENITTFAEET KTNIVKIDEKLEAVADTVDKHAEAFNDIADSLDETNTKADEAVKT ANEAKQTAEETKQNVDAKVKAAETAAGKAEAAAGTANTAADKAEA VAAKVTDIKADIATNKDNIAKKANSADVYTREESDSKFVRIDGLN ATTEKLDTRLASAEKSIADHDTRLNGLDKTVSDLRKETRQGLAEQ AALSGLFQPYNVG
Claims (21)
NH2-A-[—X-L-]n-B—COOH
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US14/739,985 US20150273044A1 (en) | 2001-09-06 | 2015-06-15 | Methods of inducing an immune response with compositions comprising a neisseria meningitidis 741 protein |
US15/802,347 US20180169210A1 (en) | 2001-09-06 | 2017-11-02 | Hybrid and tandem expression of neisserial proteins |
Applications Claiming Priority (7)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
GBGB0121591.2A GB0121591D0 (en) | 2001-09-06 | 2001-09-06 | Hybrid and tandem expression of neisserial proteins |
GB0121591.2 | 2001-09-06 | ||
PCT/IB2002/003904 WO2003020756A2 (en) | 2001-09-06 | 2002-09-06 | Hybrid and tandem expression of neisserial proteins |
US48878605A | 2005-02-25 | 2005-02-25 | |
US13/366,252 US8840907B2 (en) | 2001-09-06 | 2012-02-03 | Isolated protein and compositions comprising the protein |
US14/305,979 US9056075B2 (en) | 2001-09-06 | 2014-06-16 | Methods of inducing an immune response with compositions comprising a Neisseria meningitidis 741 protein |
US14/739,985 US20150273044A1 (en) | 2001-09-06 | 2015-06-15 | Methods of inducing an immune response with compositions comprising a neisseria meningitidis 741 protein |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/305,979 Continuation US9056075B2 (en) | 2001-09-06 | 2014-06-16 | Methods of inducing an immune response with compositions comprising a Neisseria meningitidis 741 protein |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/802,347 Continuation US20180169210A1 (en) | 2001-09-06 | 2017-11-02 | Hybrid and tandem expression of neisserial proteins |
Publications (1)
Publication Number | Publication Date |
---|---|
US20150273044A1 true US20150273044A1 (en) | 2015-10-01 |
Family
ID=9921633
Family Applications (6)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US10/488,786 Active 2027-01-24 US8980277B2 (en) | 2001-09-06 | 2002-09-06 | Hybrid and tandem expression of neisserial proteins |
US13/159,370 Expired - Fee Related US9011869B2 (en) | 2001-09-06 | 2011-06-13 | Hybrid and tandem expression of Neisserial proteins |
US13/366,252 Expired - Fee Related US8840907B2 (en) | 2001-09-06 | 2012-02-03 | Isolated protein and compositions comprising the protein |
US14/305,979 Expired - Fee Related US9056075B2 (en) | 2001-09-06 | 2014-06-16 | Methods of inducing an immune response with compositions comprising a Neisseria meningitidis 741 protein |
US14/739,985 Abandoned US20150273044A1 (en) | 2001-09-06 | 2015-06-15 | Methods of inducing an immune response with compositions comprising a neisseria meningitidis 741 protein |
US15/802,347 Abandoned US20180169210A1 (en) | 2001-09-06 | 2017-11-02 | Hybrid and tandem expression of neisserial proteins |
Family Applications Before (4)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US10/488,786 Active 2027-01-24 US8980277B2 (en) | 2001-09-06 | 2002-09-06 | Hybrid and tandem expression of neisserial proteins |
US13/159,370 Expired - Fee Related US9011869B2 (en) | 2001-09-06 | 2011-06-13 | Hybrid and tandem expression of Neisserial proteins |
US13/366,252 Expired - Fee Related US8840907B2 (en) | 2001-09-06 | 2012-02-03 | Isolated protein and compositions comprising the protein |
US14/305,979 Expired - Fee Related US9056075B2 (en) | 2001-09-06 | 2014-06-16 | Methods of inducing an immune response with compositions comprising a Neisseria meningitidis 741 protein |
Family Applications After (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/802,347 Abandoned US20180169210A1 (en) | 2001-09-06 | 2017-11-02 | Hybrid and tandem expression of neisserial proteins |
Country Status (18)
Country | Link |
---|---|
US (6) | US8980277B2 (en) |
EP (4) | EP2327719B1 (en) |
JP (4) | JP4511832B2 (en) |
CN (2) | CN100390196C (en) |
AT (1) | ATE496063T1 (en) |
AU (2) | AU2002339217B2 (en) |
BR (1) | BR0212363A (en) |
CA (1) | CA2459816C (en) |
CY (2) | CY1113218T1 (en) |
DE (1) | DE60238993D1 (en) |
DK (3) | DK2360176T3 (en) |
ES (3) | ES2523365T3 (en) |
GB (1) | GB0121591D0 (en) |
MX (2) | MXPA04002216A (en) |
NZ (3) | NZ532115A (en) |
PT (3) | PT2327719E (en) |
RU (2) | RU2339646C2 (en) |
WO (1) | WO2003020756A2 (en) |
Families Citing this family (81)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
PT1047784E (en) * | 1998-01-14 | 2009-12-21 | Novartis Vaccines & Diagnostic | Neissera meningitidis antigens |
EP2261343A3 (en) | 1998-05-01 | 2012-01-18 | Novartis Vaccines and Diagnostics, Inc. | Neisseria meningitidis antigens and compositions |
US20070026021A1 (en) * | 1998-05-01 | 2007-02-01 | Chiron S.R.I. | Neisseria meningitidis antigens and compositions |
PT1228217E (en) | 1999-04-30 | 2013-01-28 | Novartis Vaccines & Diagnostic | Conserved neisserial antigens |
CA2929348A1 (en) * | 1999-05-19 | 2000-11-30 | Novartis Vaccines And Diagnostics S.R.L. | Combination neisserial compositions |
GB9911683D0 (en) * | 1999-05-19 | 1999-07-21 | Chiron Spa | Antigenic peptides |
ES2564463T3 (en) * | 1999-10-29 | 2016-03-22 | Glaxosmithkline Biologicals S.A. | Neisserial antigenic peptides |
GB9928196D0 (en) | 1999-11-29 | 2000-01-26 | Chiron Spa | Combinations of B, C and other antigens |
BRPI0107679B8 (en) | 2000-01-17 | 2021-05-25 | Chiron Spa | composition comprising Neisseria meningitidis serum group b outer membrane vesicles and an inorganic component and use thereof |
CN100339482C (en) | 2000-02-28 | 2007-09-26 | 启龙股份公司 | Hybrid expression of neisserial proteins |
GB0115176D0 (en) | 2001-06-20 | 2001-08-15 | Chiron Spa | Capular polysaccharide solubilisation and combination vaccines |
GB0118249D0 (en) | 2001-07-26 | 2001-09-19 | Chiron Spa | Histidine vaccines |
GB0121591D0 (en) | 2001-09-06 | 2001-10-24 | Chiron Spa | Hybrid and tandem expression of neisserial proteins |
BR0211494A (en) | 2001-07-27 | 2004-08-17 | Chiron Srl | Meningococcal adhesins nothing, app and orf 40 |
AR045702A1 (en) | 2001-10-03 | 2005-11-09 | Chiron Corp | COMPOSITIONS OF ASSISTANTS. |
US7838015B2 (en) | 2001-10-03 | 2010-11-23 | Novartis Vaccines And Diagnostics, Inc. | Adjuvanted meningococcus compositions |
MX339524B (en) | 2001-10-11 | 2016-05-30 | Wyeth Corp | Novel immunogenic compositions for the prevention and treatment of meningococcal disease. |
NZ574530A (en) | 2002-08-02 | 2010-12-24 | Glaxosmithkline Biolog Sa | Vaccine compositions comprising L2 and/or L3 immunotype lipooligosaccharides from lgtB-neisseria minigitidis |
US7785608B2 (en) | 2002-08-30 | 2010-08-31 | Wyeth Holdings Corporation | Immunogenic compositions for the prevention and treatment of meningococcal disease |
GB0220194D0 (en) | 2002-08-30 | 2002-10-09 | Chiron Spa | Improved vesicles |
EP2351579B1 (en) | 2002-10-11 | 2016-09-21 | Novartis Vaccines and Diagnostics S.r.l. | Polypeptide vaccines for broad protection against hypervirulent meningococcal lineages |
EP2279746B1 (en) | 2002-11-15 | 2013-10-02 | Novartis Vaccines and Diagnostics S.r.l. | Surface proteins in neisseria meningitidis |
GB0227346D0 (en) | 2002-11-22 | 2002-12-31 | Chiron Spa | 741 |
ATE552844T1 (en) | 2003-01-30 | 2012-04-15 | Novartis Ag | INJECTABLE VACCINE AGAINST MULTIPLE MENINGOCOCC SEROGROUPES |
BR122017002991B1 (en) | 2003-10-02 | 2023-01-10 | Novartis Vaccines And Diagnostics S.R.L. | AQUEOUS IMMUNOGENIC COMPOSITIONS FOR MULTIPLE MENINGOCOCCAL SEROGROUPS |
GB0323103D0 (en) | 2003-10-02 | 2003-11-05 | Chiron Srl | De-acetylated saccharides |
GB0408977D0 (en) | 2004-04-22 | 2004-05-26 | Chiron Srl | Immunising against meningococcal serogroup Y using proteins |
GB0415160D0 (en) * | 2004-07-06 | 2004-08-11 | Chiron Srl | Inhibitors of bacterial infection |
GB0419408D0 (en) * | 2004-09-01 | 2004-10-06 | Chiron Srl | 741 chimeric polypeptides |
ATE552267T1 (en) | 2005-02-18 | 2012-04-15 | Novartis Vaccines & Diagnostic | IMMUGENES OF UROPATHOGENS ESCHERICHIA COLI |
DK1858920T3 (en) | 2005-02-18 | 2016-02-29 | Glaxosmithkline Biolog Sa | PROTEINS AND NUCLEIC ACIDS FROM MENINGITIS / SEPSIS-ASSOCIATED ESCHERICHIA COLI |
AU2013201318B2 (en) * | 2005-11-25 | 2015-11-19 | Glaxosmithkline Biologicals Sa | Chimeric, hybrid and tandem polypeptides of meningococcal NMB 1870 |
GB0524066D0 (en) | 2005-11-25 | 2006-01-04 | Chiron Srl | 741 ii |
US20110008279A1 (en) * | 2005-12-06 | 2011-01-13 | Vega Masignani | Methods and Compositions Relating to Adhesins as Adjuvants |
CA2659552A1 (en) | 2006-08-16 | 2008-02-21 | Novartis Ag | Immunogens from uropathogenic escherichia coli |
GB0700562D0 (en) | 2007-01-11 | 2007-02-21 | Novartis Vaccines & Diagnostic | Modified Saccharides |
GB0713880D0 (en) | 2007-07-17 | 2007-08-29 | Novartis Ag | Conjugate purification |
CN101951949B (en) | 2007-10-19 | 2013-10-02 | 诺华股份有限公司 | Meningococcal vaccine formulations |
EP2886551A3 (en) | 2008-02-21 | 2015-09-23 | Novartis AG | Meningococcal fhbp polypeptides |
CA2716706C (en) | 2008-03-03 | 2014-02-18 | Irm Llc | Compounds and compositions as tlr activity modulators |
ES2557282T3 (en) * | 2008-03-10 | 2016-01-25 | Children's Hospital & Research Center At Oakland | Chimeric H-factor binding proteins (fHBP) containing a heterologous B domain, and methods of use |
WO2009150531A1 (en) * | 2008-06-09 | 2009-12-17 | Novartis Ag | Antibodies against neisserial factor h binding protein |
NZ593674A (en) * | 2008-12-17 | 2013-03-28 | Novartis Ag | Meningococcal vaccines including hemoglobin receptor |
CA2756522C (en) | 2009-03-24 | 2018-06-26 | Novartis Ag | Adjuvanting meningococcal factor h binding protein |
BRPI1013902A2 (en) * | 2009-04-30 | 2019-09-24 | Children´S Hospital & Res Center At Oakland | chimeric factor binding protein h (fhbp) is method of use |
CN102762226A (en) | 2009-06-10 | 2012-10-31 | 诺华有限公司 | Benzonaphthyridine-containing vaccines |
EP2443250B8 (en) | 2009-06-16 | 2016-09-21 | GlaxoSmithKline Biologicals SA | High-throughput complement-mediated antibody-dependent and opsonic bactericidal assays |
CA2772104A1 (en) * | 2009-08-27 | 2011-03-03 | Novartis Ag | Hybrid polypeptides including meningococcal fhbp sequences |
TWI445708B (en) | 2009-09-02 | 2014-07-21 | Irm Llc | Compounds and compositions as tlr activity modulators |
JP5988492B2 (en) | 2009-09-02 | 2016-09-07 | ノバルティス アーゲー | Immunogenic composition comprising a TLR activity modulator |
AU2010302344A1 (en) | 2009-09-30 | 2012-04-26 | Novartis Ag | Expression of meningococcal fhbp polypeptides |
MX2012004850A (en) | 2009-10-27 | 2012-05-22 | Novartis Ag | Modified meningococcal fhbp polypeptides. |
WO2011057148A1 (en) | 2009-11-05 | 2011-05-12 | Irm Llc | Compounds and compositions as tlr-7 activity modulators |
EP2512478B1 (en) | 2009-12-15 | 2017-04-19 | GlaxoSmithKline Biologicals SA | Homogeneous suspension of immunopotentiating compounds and uses thereof |
JP5363381B2 (en) * | 2010-03-09 | 2013-12-11 | パナソニック株式会社 | Plasma display panel |
WO2011119759A1 (en) | 2010-03-23 | 2011-09-29 | Irm Llc | Compounds (cystein based lipopeptides) and compositions as tlr2 agonists used for treating infections, inflammations, respiratory diseases etc. |
BR122021020829B8 (en) | 2010-03-30 | 2022-12-27 | Children´S Hospital & Res Center At Oakland | NON-NATURALLY OCCURRING FACTOR H-BINDING PROTEIN (FHBP), COMPOSITION, AND GENETICALLY MODIFIED NEISSERIA MENINGITIDIS HOST CELL |
WO2011161653A1 (en) | 2010-06-25 | 2011-12-29 | Novartis Ag | Combinations of meningococcal factor h binding proteins |
CN103189071A (en) | 2010-08-23 | 2013-07-03 | 惠氏有限责任公司 | Stable formulations of neisseria meningitidis rLP2086 antigens |
WO2012032489A1 (en) | 2010-09-10 | 2012-03-15 | Wyeth Llc | Non-lipidated variants of neisseria meningitidis orf2086 antigens |
EP2613805B1 (en) | 2010-09-10 | 2019-10-23 | GlaxoSmithKline Biologicals SA | Meningococcus overexpressing nada and/or nhba and outer membrane vesicles derived therefrom |
CN102028941B (en) * | 2011-02-11 | 2013-02-13 | 中国医学科学院医学生物学研究所 | Neisseria meningitidis group B recombinant protein chimeric vaccine and preparation method thereof |
US20140186861A1 (en) * | 2011-07-11 | 2014-07-03 | Uvic Industry Partnerships Inc. | Soluble treponema pallidum protein tp0453, tp0453-tp0326 fusion protein, and use in syphilis diagnosis |
WO2013098589A1 (en) | 2011-12-29 | 2013-07-04 | Novartis Ag | Adjuvanted combinations of meningococcal factor h binding proteins |
AU2013229063B2 (en) | 2012-03-09 | 2016-10-06 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
SA115360586B1 (en) | 2012-03-09 | 2017-04-12 | فايزر انك | Neisseria meningitidis compositions and methods thereof |
RU2644340C2 (en) | 2012-06-14 | 2018-02-08 | Новартис Аг | Vaccines for serogroup x meningococcus |
WO2014016152A1 (en) | 2012-07-27 | 2014-01-30 | Institut National De La Sante Et De La Recherche Medicale | Cd147 as receptor for pilus-mediated adhesion of meningococci to vascular endothelia |
CA2903716C (en) | 2013-03-08 | 2019-04-09 | Pfizer Inc. | Immunogenic fusion polypeptides |
AU2014296027A1 (en) * | 2013-08-02 | 2016-02-04 | Children's Hospital & Research Center At Oakland | Non-naturally occurring factor H binding proteins (fHbp) and methods of use thereof |
KR102199096B1 (en) | 2013-09-08 | 2021-01-06 | 화이자 인코포레이티드 | Neisseria meningitidis compositions and methods thereof |
AU2015222121B2 (en) | 2014-02-28 | 2018-01-18 | Glaxosmithkline Biologicals Sa | Modified meningococcal fHbp polypeptides |
NZ766005A (en) | 2014-07-23 | 2024-03-22 | Children’S Hospital & Res Center At Oakland | Factor h binding protein variants and methods of use thereof |
RU2723045C2 (en) | 2015-02-19 | 2020-06-08 | Пфайзер Инк. | Compositions of neisseria meningitidis and methods for preparation thereof |
CA3035320A1 (en) | 2016-09-02 | 2018-03-08 | Glaxosmithkline Biologicals Sa | Vaccines for neisseria gonorrhoeae |
US10183070B2 (en) | 2017-01-31 | 2019-01-22 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
CA3211240A1 (en) | 2021-02-19 | 2022-08-25 | Sanofi Pasteur Inc. | Meningococcal b recombinant vaccine |
GB202115151D0 (en) | 2021-10-21 | 2021-12-08 | Glaxosmithkline Biologicals Sa | Methods |
GB202208093D0 (en) | 2022-06-01 | 2022-07-13 | Glaxosmithkline Biologicals Sa | Immunogenic composition |
GB202208089D0 (en) | 2022-06-01 | 2022-07-13 | Glaxosmithkline Biologicals Sa | Immunogenic composition |
WO2024030931A1 (en) | 2022-08-03 | 2024-02-08 | Sanofi Pasteur Inc. | Adjuvanted immunogenic composition against neisseria meningitidis b |
Family Cites Families (107)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP0196056B1 (en) | 1985-03-28 | 1991-05-22 | Chiron Corporation | Improved expression using fused genes providing for protein product |
DE3622221A1 (en) * | 1986-07-02 | 1988-01-14 | Max Planck Gesellschaft | METHOD FOR THE GENE-TECHNOLOGICAL EXTRACTION OF PROTEINS USING GRAM-NEGATIVE HOST CELLS |
EP0273116A3 (en) | 1986-10-09 | 1990-05-02 | Max-Planck-Gesellschaft zur Förderung der Wissenschaften e.V. | Gonococcal and meningococcal polypeptides, vaccines and diagnostics |
GB8815795D0 (en) | 1988-07-02 | 1988-08-10 | Bkl Extrusions Ltd | Glazing bead |
DE3841091A1 (en) | 1988-12-07 | 1990-06-13 | Behringwerke Ag | SYNTHETIC ANTIGENS, METHOD FOR THEIR PRODUCTION AND THEIR USE |
ES2070312T5 (en) | 1988-12-19 | 2003-05-16 | American Cyanamid Co | CLASS 1 MENINGOCOCIC EXTERNAL MEMBRANE PROTEIN VACCINE. |
NL8803111A (en) | 1988-12-19 | 1990-07-16 | Nederlanden Staat | Meningococcus class 1 outer-membrane protein vaccine - useful to immunise against meningococcal disease |
DE68907045T2 (en) | 1989-01-17 | 1993-12-02 | Eniricerche Spa | Synthetic peptides and their use as general carriers for the preparation of immunogenic conjugates suitable for the development of synthetic vaccines. |
HU212924B (en) | 1989-05-25 | 1996-12-30 | Chiron Corp | Adjuvant formulation comprising a submicron oil droplet emulsion |
IT1237764B (en) | 1989-11-10 | 1993-06-17 | Eniricerche Spa | SYNTHETIC PEPTIDES USEFUL AS UNIVERSAL CARRIERS FOR THE PREPARATION OF IMMUNOGENIC CONJUGATES AND THEIR USE FOR THE DEVELOPMENT OF SYNTHETIC VACCINES. |
ES2071288T3 (en) * | 1989-12-14 | 1995-06-16 | Ca Nat Research Council | IMPROVED VACCINE OF MENINGOCOCCAL POLYSACCHARIDE CONJUGATE. |
CU22302A1 (en) * | 1990-09-07 | 1995-01-31 | Cigb | Codifying nucleotidic sequence for a protein of the external membrane of neisseria meningitidis and the use of that protein in preparing vaccines. |
IE912559A1 (en) | 1990-07-19 | 1992-01-29 | Merck & Co Inc | The class ii protein of the outer membrane of neisseria¹meningitidis, and vaccines containing same |
EP0471177B1 (en) | 1990-08-13 | 1995-10-04 | American Cyanamid Company | Filamentous hemagglutinin of bordetella pertussis as a carrier molecule for conjugate vaccines |
US5153312A (en) | 1990-09-28 | 1992-10-06 | American Cyanamid Company | Oligosaccharide conjugate vaccines |
ES2127217T3 (en) | 1991-03-14 | 1999-04-16 | Imclone Systems Inc | RECOMBINATION HYBRID PORINE EPITOPES. |
EP0967279B1 (en) | 1992-03-02 | 2008-01-02 | Novartis Vaccines and Diagnostics S.r.l. | Helicobacter pylori cytotoxin useful for vaccines and diagnostics |
IT1262896B (en) | 1992-03-06 | 1996-07-22 | CONJUGATE COMPOUNDS FORMED FROM HEAT SHOCK PROTEIN (HSP) AND OLIGO-POLY-SACCHARIDES, THEIR USE FOR THE PRODUCTION OF VACCINES. | |
FR2692592B1 (en) | 1992-06-19 | 1995-03-31 | Pasteur Merieux Serums Vacc | DNA fragments encoding the Neisseria meningitidis transferrin receptor subunits and methods of expressing them. |
ATE188613T1 (en) | 1992-06-25 | 2000-01-15 | Smithkline Beecham Biolog | VACCINE COMPOSITION CONTAINING ADJUVANTS |
JP4028593B2 (en) | 1993-03-23 | 2007-12-26 | グラクソスミスクライン・バイオロジカルス・ソシエテ・アノニム | 3-O deacylated monophosphoryl lipid A-containing vaccine composition |
US5439808A (en) | 1993-07-23 | 1995-08-08 | North American Vaccine, Inc. | Method for the high level expression, purification and refolding of the outer membrane group B porin proteins from Neisseria meningitidis |
GB9326253D0 (en) | 1993-12-23 | 1994-02-23 | Smithkline Beecham Biolog | Vaccines |
US6165747A (en) | 1993-12-30 | 2000-12-26 | President & Fellows Of Harvard College | Nucleic acids encoding hedgehog proteins |
FR2720408B1 (en) | 1994-05-31 | 1996-08-14 | Pasteur Merieux Serums Vacc | Fragments Tbp2 of Neisseria meningitidis. |
US6207646B1 (en) | 1994-07-15 | 2001-03-27 | University Of Iowa Research Foundation | Immunostimulatory nucleic acid molecules |
EP1167379A3 (en) | 1994-07-15 | 2004-09-08 | University Of Iowa Research Foundation | Immunomodulatory oligonucleotides |
IL117483A (en) * | 1995-03-17 | 2008-03-20 | Bernard Brodeur | Proteinase k resistant surface protein of neisseria meningitidis |
GB9513261D0 (en) | 1995-06-29 | 1995-09-06 | Smithkline Beecham Biolog | Vaccines |
FR2739624B1 (en) | 1995-10-10 | 1997-12-05 | Pasteur Merieux Serums Vacc | NEW NEISSERIA MENINGITIDIS TBP2 SUBUNIT |
DE19630390A1 (en) | 1996-07-26 | 1998-01-29 | Chiron Behring Gmbh & Co | Proteins, in particular membrane proteins from Helicobacter pylori, their production and use |
ES2241042T3 (en) | 1996-10-11 | 2005-10-16 | The Regents Of The University Of California | IMMUNO STIMULATOR POLINUCLEOTIDE CONJUGATES / IMMUNOMODULATOR MOLECULA. |
US6472518B1 (en) | 1996-10-24 | 2002-10-29 | Centers For Disease Control And Prevention, As Represented By The Secretary, Department Of Health And Human Services | Invasion associated genes from Neisseria meningitidis serogroup B |
US6214806B1 (en) | 1997-02-28 | 2001-04-10 | University Of Iowa Research Foundation | Use of nucleic acids containing unmethylated CPC dinucleotide in the treatment of LPS-associated disorders |
WO1998040100A1 (en) | 1997-03-10 | 1998-09-17 | Ottawa Civic Loeb Research Institute | USE OF NUCLEIC ACIDS CONTAINING UNMETHYLATED CpG DINUCLEOTIDE AS AN ADJUVANT |
US6299881B1 (en) | 1997-03-24 | 2001-10-09 | Henry M. Jackson Foundation For The Advancement Of Military Medicine | Uronium salts for activating hydroxyls, carboxyls, and polysaccharides, and conjugate vaccines, immunogens, and other useful immunological reagents produced using uronium salts |
AU7690898A (en) | 1997-05-20 | 1998-12-11 | Ottawa Civic Hospital Loeb Research Institute | Vectors and methods for immunization or therapeutic protocols |
EP1003850B1 (en) | 1997-06-06 | 2009-05-27 | The Regents of the University of California | Inhibitors of dna immunostimulatory sequence activity |
GB9712347D0 (en) | 1997-06-14 | 1997-08-13 | Smithkline Beecham Biolog | Vaccine |
GB9713156D0 (en) | 1997-06-20 | 1997-08-27 | Microbiological Res Authority | Vaccines |
CA2302554C (en) | 1997-09-05 | 2007-04-10 | Smithkline Beecham Biologicals S.A. | Oil in water emulsions containing saponins |
US6914131B1 (en) | 1998-10-09 | 2005-07-05 | Chiron S.R.L. | Neisserial antigens |
CA2308606A1 (en) * | 1997-11-06 | 1999-05-20 | Chiron S.P.A. | Neisserial antigens |
ATE352624T1 (en) | 1997-11-21 | 2007-02-15 | Serono Genetics Inst Sa | CHLAMYDIA PNEUMONIAE GENOMIC SEQUENCES AND POLYPEPTIDES, FRAGMENTS AND APPLICATIONS THEREOF FOR DETECTION, PREVENTION AND CURE |
EP2218731A1 (en) | 1997-11-28 | 2010-08-18 | Merck Serono Biodevelopment | Chlamydia trachomatis genomic sequence and polypeptides, fragments thereof and uses thereof, in particular for the diagnosis, prevention and treatment of infection |
GB9726398D0 (en) | 1997-12-12 | 1998-02-11 | Isis Innovation | Polypeptide and coding sequences |
PT1047784E (en) | 1998-01-14 | 2009-12-21 | Novartis Vaccines & Diagnostic | Neissera meningitidis antigens |
KR100627590B1 (en) | 1998-01-30 | 2006-09-25 | 다이이치 아스비오파마 가부시키가이샤 | Process for producing peptide with the use of accessory peptide |
US6303114B1 (en) | 1998-03-05 | 2001-10-16 | The Medical College Of Ohio | IL-12 enhancement of immune responses to T-independent antigens |
GB9807721D0 (en) | 1998-04-08 | 1998-06-10 | Chiron Spa | Antigen |
HUP0101619A3 (en) | 1998-04-09 | 2003-11-28 | Smithkline Beecham Biolog | Adjuvant compositions |
US20070026021A1 (en) | 1998-05-01 | 2007-02-01 | Chiron S.R.I. | Neisseria meningitidis antigens and compositions |
EP2261343A3 (en) | 1998-05-01 | 2012-01-18 | Novartis Vaccines and Diagnostics, Inc. | Neisseria meningitidis antigens and compositions |
US6248329B1 (en) * | 1998-06-01 | 2001-06-19 | Ramaswamy Chandrashekar | Parasitic helminth cuticlin nucleic acid molecules and uses thereof |
GB9817052D0 (en) | 1998-08-05 | 1998-09-30 | Smithkline Beecham Biolog | Vaccine |
EP1559795A3 (en) | 1998-10-09 | 2005-11-09 | Chiron Corporation | Neisseria genomic sequences and methods of their use |
HU228473B1 (en) | 1998-10-16 | 2013-03-28 | Smithkline Beecham Biolog | Adjuvant systems and vaccines |
DK1535928T3 (en) * | 1998-10-22 | 2008-10-20 | Univ Montana | Vaccine Compositions Containing Omp85 Proteins of Neisseria gonorrhoeae and Neisseria meningitidis |
CA2350775A1 (en) | 1998-11-12 | 2000-05-18 | The Regents Of The University Of California | Chlamydia pneumoniae genome sequence |
GB9828000D0 (en) | 1998-12-18 | 1999-02-10 | Chiron Spa | Antigens |
JP2002540074A (en) | 1999-03-19 | 2002-11-26 | スミスクライン ビーチャム バイオロジカルズ ソシエテ アノニム | vaccine |
FR2791895B1 (en) | 1999-03-23 | 2001-06-15 | Pasteur Merieux Serums Vacc | USE OF TREHALOSE TO STABILIZE A LIQUID VACCINE |
WO2000061761A2 (en) | 1999-04-09 | 2000-10-19 | Techlab, Inc. | Recombinant clostridium toxin a protein carrier for polysaccharide conjugate vaccines |
BRPI0010612B8 (en) | 1999-04-19 | 2021-05-25 | Smithkline Beecham Biologicals S A | vaccines |
CN1359426A (en) | 1999-04-30 | 2002-07-17 | 希龙公司 | Neisseria genomic sequences and methods of their use |
PT1228217E (en) | 1999-04-30 | 2013-01-28 | Novartis Vaccines & Diagnostic | Conserved neisserial antigens |
CA2929348A1 (en) | 1999-05-19 | 2000-11-30 | Novartis Vaccines And Diagnostics S.R.L. | Combination neisserial compositions |
GB9911683D0 (en) | 1999-05-19 | 1999-07-21 | Chiron Spa | Antigenic peptides |
GB9916529D0 (en) | 1999-07-14 | 1999-09-15 | Chiron Spa | Antigenic peptides |
HUP0202885A3 (en) | 1999-09-24 | 2004-07-28 | Smithkline Beecham Biolog | Vaccines |
TR200200777T2 (en) | 1999-09-24 | 2002-09-23 | Smithkline Beecham Biologicals S.A. | At least one non-ionic surfactant adjuvant with polyoxyethylene alkyl ether or ester. |
ES2564463T3 (en) | 1999-10-29 | 2016-03-22 | Glaxosmithkline Biologicals S.A. | Neisserial antigenic peptides |
BRPI0107679B8 (en) | 2000-01-17 | 2021-05-25 | Chiron Spa | composition comprising Neisseria meningitidis serum group b outer membrane vesicles and an inorganic component and use thereof |
ES2389719T3 (en) | 2000-01-25 | 2012-10-30 | The University Of Queensland | Proteins comprising conserved regions of the Neisseria meningitidis NhhA surface antigen |
CN100339482C (en) | 2000-02-28 | 2007-09-26 | 启龙股份公司 | Hybrid expression of neisserial proteins |
US20040167058A1 (en) * | 2000-06-29 | 2004-08-26 | Colgate-Palmolive Company | Multi-phase clear fabric softening composition |
ATE440861T1 (en) | 2000-07-03 | 2009-09-15 | Novartis Vaccines & Diagnostic | IMMUNIZATION AGAINST CHLAMYDIA PNEUMONIAE |
IL154853A0 (en) | 2000-10-27 | 2003-10-31 | Chiron Spa | Nucleic acids and proteins from streptococcus groups a & b |
GB0108024D0 (en) | 2001-03-30 | 2001-05-23 | Chiron Spa | Bacterial toxins |
GB0118249D0 (en) | 2001-07-26 | 2001-09-19 | Chiron Spa | Histidine vaccines |
AU2002330681C1 (en) | 2001-07-26 | 2015-04-02 | Glaxosmithkline Biologicals S.A. | Vaccines comprising aluminium adjuvants and histidine |
BR0211494A (en) | 2001-07-27 | 2004-08-17 | Chiron Srl | Meningococcal adhesins nothing, app and orf 40 |
GB0121591D0 (en) | 2001-09-06 | 2001-10-24 | Chiron Spa | Hybrid and tandem expression of neisserial proteins |
MX339524B (en) | 2001-10-11 | 2016-05-30 | Wyeth Corp | Novel immunogenic compositions for the prevention and treatment of meningococcal disease. |
NZ574530A (en) | 2002-08-02 | 2010-12-24 | Glaxosmithkline Biolog Sa | Vaccine compositions comprising L2 and/or L3 immunotype lipooligosaccharides from lgtB-neisseria minigitidis |
US7785608B2 (en) | 2002-08-30 | 2010-08-31 | Wyeth Holdings Corporation | Immunogenic compositions for the prevention and treatment of meningococcal disease |
EP2351579B1 (en) | 2002-10-11 | 2016-09-21 | Novartis Vaccines and Diagnostics S.r.l. | Polypeptide vaccines for broad protection against hypervirulent meningococcal lineages |
GB0227346D0 (en) | 2002-11-22 | 2002-12-31 | Chiron Spa | 741 |
CA2512917A1 (en) | 2003-01-15 | 2004-08-05 | Wyeth Holdings Corporation | Methods for increasing neisseria protein expression |
ATE552844T1 (en) | 2003-01-30 | 2012-04-15 | Novartis Ag | INJECTABLE VACCINE AGAINST MULTIPLE MENINGOCOCC SEROGROUPES |
US20070253964A1 (en) | 2003-04-16 | 2007-11-01 | Zlotnick Gary W | Novel Immunogenic Compositions for the Prevention and Treatment of Meningococcal Disease |
BR122017002991B1 (en) | 2003-10-02 | 2023-01-10 | Novartis Vaccines And Diagnostics S.R.L. | AQUEOUS IMMUNOGENIC COMPOSITIONS FOR MULTIPLE MENINGOCOCCAL SEROGROUPS |
GB0409748D0 (en) | 2004-04-30 | 2004-06-09 | Chiron Srl | Lactoferrin cleavage |
GB0419408D0 (en) | 2004-09-01 | 2004-10-06 | Chiron Srl | 741 chimeric polypeptides |
AR051836A1 (en) | 2004-11-30 | 2007-02-14 | Centocor Inc | RECEIVER ANTAGONISTS 3 SIMIL TOLL METHODS AND USES |
CN101107007B (en) | 2005-01-27 | 2011-08-17 | 奥克兰儿童医院及研究中心 | GNA1870-based vesicle vaccines for broad spectrum protection against diseases caused by neisseria meningitidis |
GB0524066D0 (en) | 2005-11-25 | 2006-01-04 | Chiron Srl | 741 ii |
TW200806315A (en) | 2006-04-26 | 2008-02-01 | Wyeth Corp | Novel formulations which stabilize and inhibit precipitation of immunogenic compositions |
AR064642A1 (en) | 2006-12-22 | 2009-04-15 | Wyeth Corp | POLINUCLEOTIDE VECTOR THAT INCLUDES IT RECOMBINATING CELL THAT UNDERSTANDS THE VECTOR POLYPEPTIDE, ANTIBODY, COMPOSITION THAT UNDERSTANDS THE POLINUCLEOTIDE, VECTOR, RECOMBINATING CELL POLYPEPTIDE OR ANTIBODY, USE OF THE COMPOSITION AND A COMPOSITION AND A METHOD |
US20100150912A1 (en) | 2007-04-11 | 2010-06-17 | Novartis Ag | Blocking interaction between pathogen factors and factor h to inhibit hemorrhagic syndromes |
IN2009KN04098A (en) | 2007-06-04 | 2015-08-28 | Novartis Ag | |
EP2886551A3 (en) | 2008-02-21 | 2015-09-23 | Novartis AG | Meningococcal fhbp polypeptides |
ES2557282T3 (en) | 2008-03-10 | 2016-01-25 | Children's Hospital & Research Center At Oakland | Chimeric H-factor binding proteins (fHBP) containing a heterologous B domain, and methods of use |
IT1394288B1 (en) | 2008-09-12 | 2012-06-06 | Novartis Vaccines & Diagnostic | PROTEIN IMMUNOGENES THAT LINK THE FACTOR H. |
GB0819633D0 (en) | 2008-10-25 | 2008-12-03 | Isis Innovation | Composition |
CA2756522C (en) | 2009-03-24 | 2018-06-26 | Novartis Ag | Adjuvanting meningococcal factor h binding protein |
EP2613805B1 (en) | 2010-09-10 | 2019-10-23 | GlaxoSmithKline Biologicals SA | Meningococcus overexpressing nada and/or nhba and outer membrane vesicles derived therefrom |
-
2001
- 2001-09-06 GB GBGB0121591.2A patent/GB0121591D0/en not_active Ceased
-
2002
- 2002-09-06 DE DE60238993T patent/DE60238993D1/en not_active Expired - Lifetime
- 2002-09-06 WO PCT/IB2002/003904 patent/WO2003020756A2/en active IP Right Grant
- 2002-09-06 EP EP10179755.3A patent/EP2327719B1/en not_active Revoked
- 2002-09-06 NZ NZ532115A patent/NZ532115A/en not_active IP Right Cessation
- 2002-09-06 BR BR0212363-0A patent/BR0212363A/en not_active Application Discontinuation
- 2002-09-06 ES ES10179755.3T patent/ES2523365T3/en not_active Expired - Lifetime
- 2002-09-06 MX MXPA04002216A patent/MXPA04002216A/en active IP Right Grant
- 2002-09-06 EP EP14172613.3A patent/EP2829549A3/en not_active Withdrawn
- 2002-09-06 DK DK10179788.4T patent/DK2360176T3/en active
- 2002-09-06 RU RU2004110230/13A patent/RU2339646C2/en not_active IP Right Cessation
- 2002-09-06 DK DK10179755.3T patent/DK2327719T3/en active
- 2002-09-06 NZ NZ547145A patent/NZ547145A/en not_active IP Right Cessation
- 2002-09-06 CN CNB028221877A patent/CN100390196C/en not_active Expired - Fee Related
- 2002-09-06 ES ES02777592T patent/ES2357503T3/en not_active Expired - Lifetime
- 2002-09-06 CN CN200810092103XA patent/CN101260148B/en not_active Expired - Fee Related
- 2002-09-06 AT AT02777592T patent/ATE496063T1/en active
- 2002-09-06 PT PT101797553T patent/PT2327719E/en unknown
- 2002-09-06 EP EP02777592A patent/EP1423419B1/en not_active Expired - Lifetime
- 2002-09-06 RU RU2008122435/10A patent/RU2475495C2/en not_active IP Right Cessation
- 2002-09-06 US US10/488,786 patent/US8980277B2/en active Active
- 2002-09-06 CA CA2459816A patent/CA2459816C/en not_active Expired - Fee Related
- 2002-09-06 DK DK02777592.3T patent/DK1423419T3/en active
- 2002-09-06 PT PT02777592T patent/PT1423419E/en unknown
- 2002-09-06 NZ NZ537976A patent/NZ537976A/en not_active IP Right Cessation
- 2002-09-06 AU AU2002339217A patent/AU2002339217B2/en active Active
- 2002-09-06 PT PT101797884T patent/PT2360176E/en unknown
- 2002-09-06 JP JP2003525026A patent/JP4511832B2/en not_active Expired - Fee Related
- 2002-09-06 EP EP10179788.4A patent/EP2360176B1/en not_active Expired - Lifetime
- 2002-09-06 ES ES10179788.4T patent/ES2556770T3/en not_active Expired - Lifetime
-
2004
- 2004-03-08 MX MX2012000967A patent/MX336118B/en unknown
-
2005
- 2005-09-05 JP JP2005256658A patent/JP2005350486A/en not_active Withdrawn
-
2008
- 2008-10-24 AU AU2008234959A patent/AU2008234959B2/en not_active Ceased
-
2010
- 2010-07-23 JP JP2010166543A patent/JP5542276B2/en not_active Expired - Fee Related
-
2011
- 2011-04-15 CY CY20111100383T patent/CY1113218T1/en unknown
- 2011-06-13 US US13/159,370 patent/US9011869B2/en not_active Expired - Fee Related
-
2012
- 2012-02-03 US US13/366,252 patent/US8840907B2/en not_active Expired - Fee Related
-
2013
- 2013-09-24 JP JP2013196675A patent/JP2014051497A/en not_active Withdrawn
-
2014
- 2014-06-16 US US14/305,979 patent/US9056075B2/en not_active Expired - Fee Related
-
2015
- 2015-06-15 US US14/739,985 patent/US20150273044A1/en not_active Abandoned
- 2015-12-22 CY CY20151101166T patent/CY1117065T1/en unknown
-
2017
- 2017-11-02 US US15/802,347 patent/US20180169210A1/en not_active Abandoned
Non-Patent Citations (2)
Title |
---|
Parkhill et al (Accession Number G81977, May 5, 2000). * |
Tettelin et al (Accession Number D81032, March 31, 2000). * |
Also Published As
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20180169210A1 (en) | Hybrid and tandem expression of neisserial proteins | |
AU2002339217A1 (en) | Hybrid and tandem expression of Neisserial proteins | |
US20100233205A1 (en) | Adjuvanted antigenic meningococcal compositions | |
AU2014201962B2 (en) | Hybrid and tandem expression of Neisserial proteins | |
AU2012202488B2 (en) | Hybrid and tandem expression of Neisserial proteins |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: NOVARTIS VACCINES AND DIAGNOSTICS S.R.L., ITALY Free format text: CHANGE OF NAME;ASSIGNOR:CHIRON S.R.L.;REEL/FRAME:035930/0128 Effective date: 20080304 Owner name: CHIRON S.R.L., ITALY Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:PIZZA, MARIAGRAZIA;REEL/FRAME:035934/0433 Effective date: 20041203 Owner name: NOVARTIS AG, SWITZERLAND Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:NOVARTIS VACCINES AND DIAGNOSTICS SRL;REEL/FRAME:035977/0640 Effective date: 20140807 |
|
AS | Assignment |
Owner name: GLAXOSMITHKLINE BIOLOGICALS SA, BELGIUM Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:NOVARTIS VACCINES AND DIAGNOSTICS SRL;REEL/FRAME:040077/0722 Effective date: 20161020 |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |