5,840,851 A 11/1998 Plomer et al. 5,865,784 A 2/1999 Faithfull et al. 5,895,810 A 4/1999 Light et al. 5,905,141 A 5/1999 Rausch et al. 5,955,581 A 9/1999 Rausch et al. 6,007,774 A 12/1999 Faithfull et al. 6,054,427 A 4/2000 Winslow 6,127,043 A 10/2000 Lange 6,160,098 A 12/2000 Kerwin 6,242,417 B1 6/2001 Gerber et al. 6,270,952 B1 8/2001 Cook et al. 6,288,027 B1 9/2001 Gawryl et al. 6,323,175 B1 11/2001 Hsia 6,399,357 B1 6/2002 Winge 6,432,918 B1 8/2002 Winslow 6,486,306 B1 11/2002 Winge 6,506,725 B1 1/2003 Rausch et al. RE38,081 E 4/2003 Faithfull et al. 6,566,504 B2 5/2003 Bhattacharya et al. 6,599,878 B2 7/2003 Rooney 6,610,832 B1 8/2003 Gawryl et al. 6,709,810 B2 3/2004 Cook et al. 6,740,139 B2 5/2004 Russell et al. 6,747,132 B2 6/2004 Privalle et al. 6,844,317 B2 1/2005 Winslow et al. 6,894,150 B1 5/2005 Tye 7,038,016 B2 5/2006 Talarico et al. 7,101,846 B2 9/2006 Winslow 7,293,985 B2 11/2007 Cook et al. (Continued) OTHER PUBLICATIONS
Napolitano L.M., “Hemoglobin-based oxygen carriers: first, second or third generation? Human or bovine? Where are we now?”, Crit Care Clin. 25, 279-301 (2009).
Primary Examiner — Christina Bradley (74) Attorney, Agent, or Firm — Ella Cheong Hong Kong; Margaret Burke; Sam Yip
A highly purified and heat stable cross-linked nonpolymeric tetrameric hemoglobin suitable for use in mammals without causing renal injury and vasoconstriction is provided. A high temperature and short time (HTST) heat processing step is performed to remove undesired dimeric form of hemoglobin, uncross-linked tetrameric hemoglobin, and plasma protein impurities effectively. Addition of N-acetyl cysteine after heat treatment and optionally before heat treatment maintains a low level of met-hemoglobin. The heat stable cross-linked tetrameric hemoglobin can improve and prolong oxygenation in normal and hypoxic tissue. In another aspect, the product is used in the treatment of various types of cancer such as leukemia, colorectal cancer, lung cancer, breast cancer, liver cancer, nasopharyngeal carcinoma and esophageal cancer. The inventive hemoglobin can also be used to prevent tumor metastasis and recurrence following surgical tumor excision. Further the inventive tetrameric hemoglobin can be administered to patients prior to chemotherapy and radiation treatment.
7 Claims, 19 Drawing Sheets (2 of 19 Drawing Sheet(s) Filed in Color)
![[merged small][graphic]](http://www.google.fr/patents?id=d2D8AQAAEBAJ&hl=fr&ie=ISO-8859-1&output=text&pg=PA2&img=1&zoom=3&hl=fr&q=&cds=1&sig=ACfU3U1506DpP2iu9GSKooY0_G4AfZR_Mg&edge=0&edge=stretch&ci=127,111,733,21)
![[blocks in formation]](http://www.google.fr/patents?id=d2D8AQAAEBAJ&hl=fr&ie=ISO-8859-1&output=text&pg=PA2&img=1&zoom=3&hl=fr&q=&cds=1&sig=ACfU3U1506DpP2iu9GSKooY0_G4AfZR_Mg&edge=0&edge=stretch&ci=135,157,282,193)
Jiin-Yu Chen et al., “A review of blood substitutes; examining the history, clinical trial results, and ethics of hemoglobin-based oxygen carriers”, Clinics 64(8), 803-813 (2009).
Larny ML et al., “Randomized Trial of Dlaspirin Cross-linked Hemoglobin Solution as an Alternative to Blood Transfusion after Cardiac Surgery”, Anesthesiology 92(3), 646-656 (2000).
Lois R. Marming et al., “Subunit dissociations in natural and recombinant hemoglobins”, Protein Science 5(4), 775-781 (1996). Ronald Kluger et al., “Protein-protein coupling and its application to functional red cell substitutes”, Chem Commun (Camb). 46(8), 1194-1202 (2010).
Ronald Kluger, “Red cell substitutes from hemoglobin-do we start all over again?”, Current Opinion in Chemical Biology 14(4), 538-543 (2010).
Kenji Sampei et al., “Role of nitric oxide scavenging in vascular response to cell-free hemoglobin transfusion”, Am J Physiol Heart Circ Physiol 289(3), H1191-H1201 (2005).
Tao Hu et al., “Preparation and characterization of dimeric bovine hemoglobin tetramers”, Journal of Protein Chemistry 22(5), 411416(2003).
Tao Hu et al., “PEGylation of Val- 1(alpha) destabilizes the tetrameric structure of hemoglobin”, Biochemistry 48(3), 608-616 (2009). Kim D Vandegriff et al., “Hemospan: design principles for a new class ofoxygen therapeutic”, Artificial organs 33(2), 133-138 (2009). Thoralf Kerner of al., “DCL-Hb for trauma patients with severe hemorrhagic shock; the European “On-Scene” multicenter study”, Intensive Care Medicine 29(3), 378-386 (2003).
Chad R. Haney et al., “Purification and chemical modifications of hemoglobin in developing hemoglobin based oxygen carriers”, Advanced Drug Delivery Reviews 40(3), 153-169 (2000).
Donat R. Spalm et al., “Artificial O2 carriers : Status in 2005”, Current pharmaceutical design 11(31), 4099-4114 (2005).
Andre F. Palmer et al., “Tangential flow filtration of hemoglobin”, Biotechnol Prog. 25(1), 189-199 (2009).
David C. Irwin et al., “Polymerized bovine hemoglobin decreases oxygen delivery during normoxia and acute hypoxia in the rat”, Am J Physiol Heart Circ Physiol 295(3), H1090-H1099 (2008). Guoyong Sun et al, “Preparation of Ultrapure Bovine and Human Hemoglobin by Anion Exchange Chromatography”, J Chromatogr B Analyt Technol Biomed Life Sci. 867(1), 1-7 (2008).
Yiping Jia et al., “Effects of cross-linking end zero-link polyrnerization on oxygen transport and redox chemistry of bovine hemoglobin”, Biochimica et Biophysica Acta 1794(8), 1234-1242 (2009). Cai Jin et al., “Chemically Modified Porcine Hemoglobins and Their Biological Properties”, Protein and Peptide Letters, vol. 11, No. 4, 353-360 (2004).
U.S. Appl. No. 12/821,214, Wong et al.
Ameri K et al., (2010) Circulating tumour cells demonstrate an altered response to hypoxia and an aggressive phenotype. Br J Cancer; 102(3):561-9.
Morris Sherman. (2008) Recurrence of Hepatocellular Carcinoma. N Engl J Med; 35912045-2047.
Van Der Bilt J . D. et al., (2005) Ischemia/reperfusion accelerates the outgrowth of hepatic micrometastases in a highly standardized murine model. Hepatology;42(1): 165-75.
KuY. et al ., (1999) Stimulation of haematogenous liver metastases by ischaemia-reperfusion in rats. Eur J Surg.; 165(8):801-7.
Yu et al., Cancer Treatment Reviews (2007) 33, pp. 757-761.
U.S. Appl. No. 13/013,850, Wong et al.
U.S. Appl. No. 13/083,639, Wong et al.
U.S. Appl. No. 13/097,183, Wong et al.
Raabe et al., Strahlentherapie und Onkologie, No. 11, 2005, pp. 730-737, “No Effect of the Hemoglobin Solution HBOC-201 on the Response of the Rat R1H Tumor to Fractionated Irradiation” Teicher (I) et al. I. J. Radiation Oncology, vol. 21, No. 4, pp. 969-975 1998, “Effect of Oxygen Level on the Enhancement of Tumor Response to Radiation by Perfluorochemical Emulsions of a Bovine Hemoglobin Preparation”.
Teicher (II) et al., In Vivo, 9: 11-18 (1995), “Increased Efficacy of Chemo- and Radio-therapy by a Hemoglobin Solution in the 9L Gliosarcoma”.
Lindberg et al., In Vivo, 12: 167-174 (1998).
Man et al., Liver Transplantation, vol. 13, (2007) pp. 1669-1677. Ozaki et al., Liver Transplantation, vol. 13, (2007) pp. 1623-1626. Title for Ozaki et al. is “Surgical Stress and Tumor Behavior: Impact of Ischemia-Reperfusion and Hepatic Resection on Tumor Progression”.
Title for Lindberg et al. is “Increased Tissue Oxygenation and Enhanced Radiation Sensitivity of Solid Tumors in Rodents Following Polyethylene Glycol Conjugated Bovine Hemoglobin Administration”.
Title for Man et al. is Ischemia-Reperfusion of Small Liver Remnant Promotes Liver Tumor Growth and Metastases-Activation of Cell Invasion and Migration Pathways.
I'l'1"U(UCEUU lTJ"U(§Z\2‘U~7
-VLSAADKG1\VKAAWGKVGGH/\AEYGAEALER1\1FLSFPT1‘KTYFPHFDLSHGSAQVKGHGAKVAAALTKAVE1-HQDDLPGA MW .SPADKTYWKAAWGKVGAHAGEYGAEAIER1»1F11SFP’1"'11{TYFPF1FDl ‘S1-1GSAQVKGHG'r\'KVADAl .TNAVAl-WDDIVIPNA - VL SPADKTN IKS TWDK 1(1GH4GDYGGE/\LDRTF QSFPTTKTYF PHF DL SPG SAQVKAHG1<KV1\DAL"1'1“AVAHLDDLPGA -VLSAADKADVKAAYGKVGA1-1AGEAGAEALERI\1F1l}FT"1TKTYFPHFDLSHGSDEVKAHGEKVADALTKAVG1-HJDD1\1PGA 1\1VLSAAD1§'11W1§AAWSKVGGHAGEFGAEAL15R1\114UJFP'1'1‘1§'1“fFPH1~'DLSHGSA()V1§A11G1§1{V(}DA1j1‘1J\VGHLD1)LP(iA
LSELSDLHAI-1l{LRW)PVNF1§LLSHSLLV'[1JASHLPSDFTPAVH/\SLDKFL/DWSTVLTSKYR LSALSDLHA111{LR\’1)PVNb'KLLSHCLL\/ '1‘LAA11LPA1:'1""1‘PAV1L4SL1)1§1*‘LASVS'1‘VL1'S1<YR LSALSDLI-1AY1\'LRVDPV1\1F KLLSHCLLVTLACHHP'1EF TPAV1-LASLDKFF AAVSTVLTSKYR LSALSDLI 1A1 IKLRVDPVDFKLL SI ICLLSTLAVI 1LPDDFTPAV1 LADLDKPLADVSTVLD SKYR LSNLSDLHAHKLRVDPVNFKLLSHCLLSTLAV1-ILPNDFTPAVHASLDKFLS SVSTVLTSKYR
11- -LTAEEKAAVTAFWGKVKVDE\/GGEALGRLLVVYPWTQRFFESFGDLSTADAV1‘/l1\1NPKVKAHGKKVLDSFSNGMKHLD MVHLTPEEKSAVTALWGK\/NVDEVGGEALGRLLV\/YPWTQRFFESPGDLS1"PDAV1\/lG1\1PKVKAHGKKVDGAFSDGLAI-ILD 1\M/HLSAEEKEAWJGLWGKVNV DEVGGEALGRLLVVYPWTQRFFESPGDLSNADA\/11/IGNPKVKAHGKKVLQSFSDGLKHLD MVQLSGEEK1\AVLALWDKVNEEE\/F 1GB/XLGRLLVVYPWTQRFFDSPGDLSNPGM/1/1G1\1PKVKAHGKl{VLHSFGEGVHHLD
DLKGPFAALSE111-1C1)1§LHVDP1iN1*1§L1£}[\1\’LWVLARN1-'G1<.1i1*"1'PVLQA1JFQ1§VVAGV/WALA1-IRYH NLKGTFATLSELHCDKLHVDPENF RLLBNVLVCVLAH1-IF GKEF TPP\/'OAAYO1§VVAGVA\1ALAH1{YH NLKG TFAKLSI ICDQLI IVDPENFRLIE NVI WVLARRLGI IDFNPIWQAAFQKWAGVANALAI IKYI I NLKGTPAALSELHCDKLHVDPENFRLLGNVLWVLARH13GKDP1'PELQASYQKWAGV/&\IALA111\’YH
« PrécédentContinuer » |